Diaphorina citri psyllid: psy968

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270--

MFSPAVCKCRRPKIFKTGQLFCKSFKVFRAILDYYKGQVIKCPPSVSVQELREACDYLLVPFDAHTVRCQNLRGLLHELSNEGARCQFEVFLEDLILPLMVNSAQRGDRECHVVVLLDDDTVDWDEAYPPQMGEEYSQSSLSRPTNKNSTNDHTSSGANTIPTSEERVTLVVDNTRFVLDPALFTAYPNTMLGRMFSSGREFTHTNDRGEYEVAEGIPAAVFRAILDYYKGQVIKCPPSVSVQELREACDYLLVPFDAHTVRCQNLRRKVFF

cccccccccccccccccccEEEHHHHHHHHHHHHHHcccccccccccHHHHHHHHcccccccccccccHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEEccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEccEEEEEcccccccccccCEECccccccccccccccccEEEcccccHHHHHHHHHHHcccCEEccccccHHHHHHHHcccccccccccEEEcccHHHccc

*****VCKCRRPKIFKTGQLFCKSFKVFRAILDYYKGQVIKCPPSVSVQELREACDYLLVPFDAHTVRCQNLRGLLHELSNEGARCQFEVFLEDLILPLMVNSAQRGDRECHVVVLLDDDTVDWDEAYPPQMG*********************************RVTLVVDNTRFVLDPALFTAYPNTMLGRMFSSGREFTHTNDRGEYEVAEGIPAAVFRAILDYYKGQVIKCPPSVSVQELREACDYLLVPFDAHTVRCQNLRRKVFF

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
BTB/POZ domain-containing protein KCTD20		confident	Q8CDD8
BTB/POZ domain-containing protein KCTD20		confident	Q7Z5Y7

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0005737 [CC]	cytoplasm	probable	GO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0005730 [CC]	nucleolus	probable	GO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0035071 [BP]	salivary gland cell autophagic cell death	probable	GO:0010259, GO:0016271, GO:0009791, GO:0048102, GO:0002165, GO:0032501, GO:0007569, GO:0009653, GO:0007275, GO:0044699, GO:0007559, GO:0007435, GO:0007431, GO:0007552, GO:0008150, GO:0048513, GO:0022612, GO:0032502, GO:0048707, GO:0009886, GO:0035070, GO:0009987, GO:0009888, GO:0044767, GO:0012501, GO:0035272, GO:0044763, GO:0044707, GO:0048856, GO:0048731, GO:0048732
GO:0046331 [BP]	lateral inhibition	probable	GO:0032502, GO:0044700, GO:0045165, GO:0048869, GO:0030154, GO:0045168, GO:0008150, GO:0044763, GO:0023052, GO:0007267, GO:0007154, GO:0009987, GO:0044699
GO:0003674 [MF]	molecular_function	probable
GO:0050975 [BP]	sensory perception of touch	probable	GO:0032501, GO:0044707, GO:0050954, GO:0007600, GO:0008150, GO:0050877, GO:0044699, GO:0003008

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1S1G, chain A
Confidence level:very confident
Coverage over the Query: 165-265
View the alignment between query and template
View the model in PyMOL

Template: 3KVT, chain A
Confidence level:confident
Coverage over the Query: 23-70
View the alignment between query and template
View the model in PyMOL