Diaphorina citri psyllid: psy9697


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------13
MAWFHSVNRERAVQMVAAGGEGCFLVRPSSSSEPLTLTLWYGGRAYNIFIRKRDDNKIGLGTFKPNEVMAAREDATNHPRDSHPCRTQPRCVITSRPRGVVLRWRLSRIMFRHLADYNKLSGVQRAMW
ccccccccHHHHHHHHHHcccccEEEccccccccHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHccccccccHHcccccccccccccHHccccHHHHHHHHHHcccccccccccc
*AWFHSVNRERAVQMVAAGGEGCFLVRPSSSSEPLTLTLWYGGRAYNIFIRKRDDNKIGLGTFKPNEVMAAREDATNHPRDSHPCRTQPRCVITSRPRGVVLRWRLSRIMFRHLADYNKLSGVQRAMW
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAWFHSVNRERAVQMVAAGGEGCFLVRPSSSSEPLTLTLWYGGRAYNIFIRKRDDNKIGLGTFKPNEVMAAREDATNHPRDSHPCRTQPRCVITSRPRGVVLRWRLSRIMFRHLADYNKLSGVQRAMW

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
30S ribosomal protein S14 Binds 16S rRNA, required for the assembly of 30S particles and may also be responsible for determining the conformation of the 16S rRNA at the A site.confidentA4SCS2
30S ribosomal protein S14 Binds 16S rRNA, required for the assembly of 30S particles and may also be responsible for determining the conformation of the 16S rRNA at the A site.confidentA6KYI2
30S ribosomal protein S14 Binds 16S rRNA, required for the assembly of 30S particles and may also be responsible for determining the conformation of the 16S rRNA at the A site.confidentQ64NM1

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0031965 [CC]nuclear membraneprobableGO:0005575, GO:0005635, GO:0031090, GO:0005634, GO:0016020, GO:0044464, GO:0031967, GO:0031975, GO:0044446, GO:0043229, GO:0044428, GO:0012505, GO:0044424, GO:0005623, GO:0005622, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0005739 [CC]mitochondrionprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2OZO, chain A
Confidence level:very confident
Coverage over the Query: 1-93
View the alignment between query and template
View the model in PyMOL
Template: 1OPK, chain A
Confidence level:very confident
Coverage over the Query: 1-115
View the alignment between query and template
View the model in PyMOL