Psyllid ID: psy9697
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 128 | ||||||
| 327270233 | 160 | PREDICTED: 28S ribosomal protein S14, mi | 0.578 | 0.462 | 0.537 | 5e-16 | |
| 225716046 | 139 | Mitochondrial 28S ribosomal protein S14 | 0.570 | 0.525 | 0.594 | 5e-16 | |
| 350589017 | 132 | PREDICTED: 28S ribosomal protein S14, mi | 0.578 | 0.560 | 0.525 | 2e-15 | |
| 291397270 | 128 | PREDICTED: mitochondrial ribosomal prote | 0.570 | 0.570 | 0.594 | 3e-15 | |
| 149707900 | 128 | PREDICTED: 28S ribosomal protein S14, mi | 0.578 | 0.578 | 0.525 | 3e-15 | |
| 126306263 | 128 | PREDICTED: 28S ribosomal protein S14, mi | 0.578 | 0.578 | 0.525 | 3e-15 | |
| 403266445 | 128 | PREDICTED: 28S ribosomal protein S14, mi | 0.578 | 0.578 | 0.525 | 4e-15 | |
| 296229727 | 128 | PREDICTED: 28S ribosomal protein S14, mi | 0.578 | 0.578 | 0.525 | 4e-15 | |
| 351696813 | 128 | 28S ribosomal protein S14, mitochondrial | 0.578 | 0.578 | 0.525 | 4e-15 | |
| 270008302 | 129 | hypothetical protein TcasGA2_TC030556 [T | 0.390 | 0.387 | 0.78 | 4e-15 |
| >gi|327270233|ref|XP_003219894.1| PREDICTED: 28S ribosomal protein S14, mitochondrial-like [Anolis carolinensis] | Back alignment and taxonomy information |
|---|
Score = 89.0 bits (219), Expect = 5e-16, Method: Compositional matrix adjust.
Identities = 43/80 (53%), Positives = 56/80 (70%), Gaps = 6/80 (7%)
Query: 55 DNKIGLGTFKPNEVM------AAREDATNHPRDSHPCRTQPRCVITSRPRGVVLRWRLSR 108
D ++ L + N+++ A ++ PRDS P R + RCV+TSRPRGVV RWRLSR
Sbjct: 81 DQRLRLDALRKNKILPKELREVASQEIAALPRDSCPVRIRNRCVLTSRPRGVVWRWRLSR 140
Query: 109 IMFRHLADYNKLSGVQRAMW 128
I+FRHLAD+ +LSGVQRAMW
Sbjct: 141 IVFRHLADHAQLSGVQRAMW 160
|
Source: Anolis carolinensis Species: Anolis carolinensis Genus: Anolis Family: Iguanidae Order: Squamata Class: Phylum: Chordata Superkingdom: Eukaryota |
| >gi|225716046|gb|ACO13869.1| Mitochondrial 28S ribosomal protein S14 [Esox lucius] | Back alignment and taxonomy information |
|---|
| >gi|350589017|ref|XP_003482769.1| PREDICTED: 28S ribosomal protein S14, mitochondrial-like [Sus scrofa] | Back alignment and taxonomy information |
|---|
| >gi|291397270|ref|XP_002715046.1| PREDICTED: mitochondrial ribosomal protein S14-like [Oryctolagus cuniculus] | Back alignment and taxonomy information |
|---|
| >gi|149707900|ref|XP_001497831.1| PREDICTED: 28S ribosomal protein S14, mitochondrial-like [Equus caballus] | Back alignment and taxonomy information |
|---|
| >gi|126306263|ref|XP_001365530.1| PREDICTED: 28S ribosomal protein S14, mitochondrial-like [Monodelphis domestica] | Back alignment and taxonomy information |
|---|
| >gi|403266445|ref|XP_003925393.1| PREDICTED: 28S ribosomal protein S14, mitochondrial [Saimiri boliviensis boliviensis] | Back alignment and taxonomy information |
|---|
| >gi|296229727|ref|XP_002760443.1| PREDICTED: 28S ribosomal protein S14, mitochondrial [Callithrix jacchus] | Back alignment and taxonomy information |
|---|
| >gi|351696813|gb|EHA99731.1| 28S ribosomal protein S14, mitochondrial [Heterocephalus glaber] | Back alignment and taxonomy information |
|---|
| >gi|270008302|gb|EFA04750.1| hypothetical protein TcasGA2_TC030556 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 128 | ||||||
| UNIPROTKB|F1S721 | 128 | MRPS14 "Uncharacterized protei | 0.570 | 0.570 | 0.581 | 9.5e-18 | |
| UNIPROTKB|I3L904 | 128 | MRPS14 "Uncharacterized protei | 0.570 | 0.570 | 0.581 | 9.5e-18 | |
| UNIPROTKB|E1BQP4 | 126 | MRPS14 "Uncharacterized protei | 0.562 | 0.571 | 0.586 | 1.1e-16 | |
| UNIPROTKB|Q6B860 | 128 | MRPS14 "28S ribosomal protein | 0.570 | 0.570 | 0.554 | 1.1e-16 | |
| UNIPROTKB|E2RMB2 | 128 | MRPS14 "Uncharacterized protei | 0.570 | 0.570 | 0.540 | 2.9e-16 | |
| MGI|MGI:1928141 | 128 | Mrps14 "mitochondrial ribosoma | 0.570 | 0.570 | 0.554 | 2.9e-16 | |
| RGD|1309432 | 128 | Mrps14 "mitochondrial ribosoma | 0.570 | 0.570 | 0.554 | 2.9e-16 | |
| ZFIN|ZDB-GENE-060825-75 | 138 | mrps14 "mitochondrial ribosoma | 0.570 | 0.528 | 0.554 | 2.9e-16 | |
| UNIPROTKB|O60783 | 128 | MRPS14 "28S ribosomal protein | 0.570 | 0.570 | 0.554 | 3.7e-16 | |
| FB|FBgn0044030 | 128 | mRpS14 "mitochondrial ribosoma | 0.570 | 0.570 | 0.554 | 9.8e-16 |
| UNIPROTKB|F1S721 MRPS14 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
Score = 216 (81.1 bits), Expect = 9.5e-18, P = 9.5e-18
Identities = 43/74 (58%), Positives = 53/74 (71%)
Query: 56 NKIGLGTFKPNEVM-AAREDATNHPRDSHPCRTQPRCVITSRPRGVVLRWRLSRIMFRHL 114
N + T P ++ A E+ + PRDS P R + RCV+TSRPRGV RWRLSRI+FRHL
Sbjct: 55 NSLRKNTILPKDLQEVADEEIASLPRDSCPVRIRNRCVMTSRPRGVKRRWRLSRIVFRHL 114
Query: 115 ADYNKLSGVQRAMW 128
AD+ +LSGVQRAMW
Sbjct: 115 ADHGQLSGVQRAMW 128
|
|
| UNIPROTKB|I3L904 MRPS14 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1BQP4 MRPS14 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q6B860 MRPS14 "28S ribosomal protein S14, mitochondrial" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2RMB2 MRPS14 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1928141 Mrps14 "mitochondrial ribosomal protein S14" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| RGD|1309432 Mrps14 "mitochondrial ribosomal protein S14" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-060825-75 mrps14 "mitochondrial ribosomal protein S14" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|O60783 MRPS14 "28S ribosomal protein S14, mitochondrial" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0044030 mRpS14 "mitochondrial ribosomal protein S14" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 128 | |||
| pfam00253 | 53 | pfam00253, Ribosomal_S14, Ribosomal protein S14p/S | 1e-12 | |
| smart00252 | 84 | smart00252, SH2, Src homology 2 domains | 1e-11 | |
| PRK08881 | 101 | PRK08881, rpsN, 30S ribosomal protein S14; Reviewe | 8e-11 | |
| COG0199 | 61 | COG0199, RpsN, Ribosomal protein S14 [Translation, | 6e-09 | |
| cd10348 | 86 | cd10348, SH2_Cterm_shark_like, C-terminal Src homo | 3e-07 | |
| CHL00074 | 100 | CHL00074, rps14, ribosomal protein S14 | 3e-07 | |
| cd00173 | 79 | cd00173, SH2, Src homology 2 (SH2) domain | 3e-07 | |
| pfam00017 | 77 | pfam00017, SH2, SH2 domain | 1e-06 | |
| cd09929 | 121 | cd09929, SH2_BLNK_SLP-76, Src homology 2 (SH2) dom | 2e-06 | |
| cd10341 | 99 | cd10341, SH2_N-SH2_PLC_gamma_like, N-terminal Src | 2e-05 | |
| cd10352 | 91 | cd10352, SH2_a2chimerin_b2chimerin, Src homology 2 | 4e-05 | |
| cd10347 | 81 | cd10347, SH2_Nterm_shark_like, N-terminal Src homo | 4e-05 | |
| PRK08061 | 61 | PRK08061, rpsN, 30S ribosomal protein S14; Reviewe | 2e-04 | |
| cd09937 | 98 | cd09937, SH2_csk_like, Src homology 2 (SH2) domain | 7e-04 | |
| cd09935 | 94 | cd09935, SH2_ABL, Src homology 2 (SH2) domain foun | 0.002 | |
| cd10402 | 105 | cd10402, SH2_C-SH2_Zap70, C-terminal Src homology | 0.003 | |
| cd10354 | 77 | cd10354, SH2_Cterm_RasGAP, C-terminal Src homology | 0.004 |
| >gnl|CDD|201115 pfam00253, Ribosomal_S14, Ribosomal protein S14p/S29e | Back alignment and domain information |
|---|
Score = 57.6 bits (140), Expect = 1e-12
Identities = 24/47 (51%), Positives = 33/47 (70%)
Query: 79 PRDSHPCRTQPRCVITSRPRGVVLRWRLSRIMFRHLADYNKLSGVQR 125
PR+S P R + RCV+T RPRGV+ ++ LSRI FR LA + GV++
Sbjct: 7 PRNSSPTRIRNRCVLTGRPRGVIRKFGLSRICFRELAHKGLIPGVKK 53
|
This family includes both ribosomal S14 from prokaryotes and S29 from eukaryotes. Length = 53 |
| >gnl|CDD|214585 smart00252, SH2, Src homology 2 domains | Back alignment and domain information |
|---|
| >gnl|CDD|181574 PRK08881, rpsN, 30S ribosomal protein S14; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|223277 COG0199, RpsN, Ribosomal protein S14 [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|198211 cd10348, SH2_Cterm_shark_like, C-terminal Src homology 2 (SH2) domain found in SH2 domains, ANK, and kinase domain (shark) proteins | Back alignment and domain information |
|---|
| >gnl|CDD|214354 CHL00074, rps14, ribosomal protein S14 | Back alignment and domain information |
|---|
| >gnl|CDD|198173 cd00173, SH2, Src homology 2 (SH2) domain | Back alignment and domain information |
|---|
| >gnl|CDD|215658 pfam00017, SH2, SH2 domain | Back alignment and domain information |
|---|
| >gnl|CDD|198183 cd09929, SH2_BLNK_SLP-76, Src homology 2 (SH2) domain found in B-cell linker (BLNK) protein and SH2 domain-containing leukocyte protein of 76 kDa (SLP-76) | Back alignment and domain information |
|---|
| >gnl|CDD|199829 cd10341, SH2_N-SH2_PLC_gamma_like, N-terminal Src homology 2 (N-SH2) domain in Phospholipase C gamma | Back alignment and domain information |
|---|
| >gnl|CDD|198215 cd10352, SH2_a2chimerin_b2chimerin, Src homology 2 (SH2) domain found in alpha2-chimerin and beta2-chimerin proteins | Back alignment and domain information |
|---|
| >gnl|CDD|198210 cd10347, SH2_Nterm_shark_like, N-terminal Src homology 2 (SH2) domain found in SH2 domains, ANK, and kinase domain (shark) proteins | Back alignment and domain information |
|---|
| >gnl|CDD|181216 PRK08061, rpsN, 30S ribosomal protein S14; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|198190 cd09937, SH2_csk_like, Src homology 2 (SH2) domain found in Carboxyl-Terminal Src Kinase (Csk) | Back alignment and domain information |
|---|
| >gnl|CDD|198189 cd09935, SH2_ABL, Src homology 2 (SH2) domain found in Abelson murine lymphosarcoma virus (ABL) proteins | Back alignment and domain information |
|---|
| >gnl|CDD|198265 cd10402, SH2_C-SH2_Zap70, C-terminal Src homology 2 (SH2) domain found in Zeta-chain-associated protein kinase 70 (ZAP-70) | Back alignment and domain information |
|---|
| >gnl|CDD|198217 cd10354, SH2_Cterm_RasGAP, C-terminal Src homology 2 (SH2) domain found in Ras GTPase-activating protein 1 (GAP) | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 128 | |||
| PRK06911 | 100 | rpsN 30S ribosomal protein S14; Reviewed | 99.96 | |
| PRK08881 | 101 | rpsN 30S ribosomal protein S14; Reviewed | 99.96 | |
| CHL00074 | 100 | rps14 ribosomal protein S14 | 99.96 | |
| KOG1741|consensus | 103 | 99.93 | ||
| COG0199 | 61 | RpsN Ribosomal protein S14 [Translation, ribosomal | 99.91 | |
| PF00253 | 55 | Ribosomal_S14: Ribosomal protein S14p/S29e; InterP | 99.87 | |
| PRK08061 | 61 | rpsN 30S ribosomal protein S14; Reviewed | 99.85 | |
| KOG0197|consensus | 468 | 99.78 | ||
| KOG4278|consensus | 1157 | 99.73 | ||
| cd00173 | 94 | SH2 Src homology 2 domains; Signal transduction, i | 99.72 | |
| smart00252 | 84 | SH2 Src homology 2 domains. Src homology 2 domains | 99.7 | |
| PF00017 | 77 | SH2: SH2 domain; InterPro: IPR000980 The Src homol | 99.67 | |
| PRK05766 | 52 | rps14P 30S ribosomal protein S14P; Reviewed | 99.36 | |
| KOG1264|consensus | 1267 | 99.24 | ||
| KOG4792|consensus | 293 | 99.22 | ||
| KOG1264|consensus | 1267 | 99.12 | ||
| KOG4637|consensus | 464 | 99.12 | ||
| KOG4226|consensus | 379 | 99.09 | ||
| KOG0790|consensus | 600 | 99.07 | ||
| KOG4637|consensus | 464 | 98.93 | ||
| KOG0194|consensus | 474 | 98.79 | ||
| KOG0790|consensus | 600 | 98.77 | ||
| KOG2996|consensus | 865 | 98.67 | ||
| KOG1930|consensus | 483 | 98.66 | ||
| KOG3751|consensus | 622 | 98.41 | ||
| PTZ00218 | 54 | 40S ribosomal protein S29; Provisional | 98.38 | |
| KOG3601|consensus | 222 | 98.31 | ||
| PF14633 | 220 | SH2_2: SH2 domain; PDB: 3GXX_A 3GXW_B 3PJP_B 2XP1_ | 96.96 | |
| KOG3506|consensus | 56 | 94.69 | ||
| KOG1856|consensus | 1299 | 90.99 | ||
| KOG3697|consensus | 345 | 83.56 | ||
| TIGR01764 | 49 | excise DNA binding domain, excisionase family. An | 83.52 |
| >PRK06911 rpsN 30S ribosomal protein S14; Reviewed | Back alignment and domain information |
|---|
Probab=99.96 E-value=7.6e-31 Score=173.10 Aligned_cols=83 Identities=20% Similarity=0.358 Sum_probs=76.6
Q ss_pred eeEEeeeeecccccccccCCCHHHH-HHHHHhhcCCCCCCCcccCCcccccCCCCccccccCCCHHHHHHhhccCCCCce
Q psy9697 45 AYNIFIRKRDDNKIGLGTFKPNEVM-AAREDATNHPRDSHPCRTQPRCVITSRPRGVVLRWRLSRIMFRHLADYNKLSGV 123 (128)
Q Consensus 45 v~hy~I~~~~~k~i~~n~~L~~~~r-~~~~~l~~l~~~~~~~rl~nrC~~tgr~~g~~~~~~l~R~~fr~~~~~G~~~gv 123 (128)
|.-|..++..+++++.|+++|.++- ++++ |+++|+|++|||++|||+.||||+||+++|+|||++|||+|+.|+||||
T Consensus 17 ~~k~~~kR~~lK~i~~~~~l~~~~~~a~~k-L~~lPrnss~~R~rNRC~~TGR~Rgv~r~FgLsRi~~Rela~~G~lPGv 95 (100)
T PRK06911 17 VEKYRQRRNELKQLIKSSDDFQVIMESQAK-LAKLPVNSNPVRYVTRCKQCGRPHAVYRKFNLCRICLRQQLMVGNIPGG 95 (100)
T ss_pred HHHHHHHHHHHHHHHhcCCCCHHHHHHHHH-HHhCCCccCcchhhcccCCCCCCcccccccCchHHHHHHHHHcCCCCCe
Confidence 4456777788899999999999865 6677 9999999999999999999999999999999999999999999999999
Q ss_pred EeccC
Q psy9697 124 QRAMW 128 (128)
Q Consensus 124 ~k~~W 128 (128)
+||||
T Consensus 96 ~KaSW 100 (100)
T PRK06911 96 RKSSW 100 (100)
T ss_pred ecccC
Confidence 99999
|
|
| >PRK08881 rpsN 30S ribosomal protein S14; Reviewed | Back alignment and domain information |
|---|
| >CHL00074 rps14 ribosomal protein S14 | Back alignment and domain information |
|---|
| >KOG1741|consensus | Back alignment and domain information |
|---|
| >COG0199 RpsN Ribosomal protein S14 [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PF00253 Ribosomal_S14: Ribosomal protein S14p/S29e; InterPro: IPR001209 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms | Back alignment and domain information |
|---|
| >PRK08061 rpsN 30S ribosomal protein S14; Reviewed | Back alignment and domain information |
|---|
| >KOG0197|consensus | Back alignment and domain information |
|---|
| >KOG4278|consensus | Back alignment and domain information |
|---|
| >cd00173 SH2 Src homology 2 domains; Signal transduction, involved in recognition of phosphorylated tyrosine (pTyr) | Back alignment and domain information |
|---|
| >smart00252 SH2 Src homology 2 domains | Back alignment and domain information |
|---|
| >PF00017 SH2: SH2 domain; InterPro: IPR000980 The Src homology 2 (SH2) domain is a protein domain of about 100 amino-acid residues first identified as a conserved sequence region between the oncoproteins Src and Fps [] | Back alignment and domain information |
|---|
| >PRK05766 rps14P 30S ribosomal protein S14P; Reviewed | Back alignment and domain information |
|---|
| >KOG1264|consensus | Back alignment and domain information |
|---|
| >KOG4792|consensus | Back alignment and domain information |
|---|
| >KOG1264|consensus | Back alignment and domain information |
|---|
| >KOG4637|consensus | Back alignment and domain information |
|---|
| >KOG4226|consensus | Back alignment and domain information |
|---|
| >KOG0790|consensus | Back alignment and domain information |
|---|
| >KOG4637|consensus | Back alignment and domain information |
|---|
| >KOG0194|consensus | Back alignment and domain information |
|---|
| >KOG0790|consensus | Back alignment and domain information |
|---|
| >KOG2996|consensus | Back alignment and domain information |
|---|
| >KOG1930|consensus | Back alignment and domain information |
|---|
| >KOG3751|consensus | Back alignment and domain information |
|---|
| >PTZ00218 40S ribosomal protein S29; Provisional | Back alignment and domain information |
|---|
| >KOG3601|consensus | Back alignment and domain information |
|---|
| >PF14633 SH2_2: SH2 domain; PDB: 3GXX_A 3GXW_B 3PJP_B 2XP1_A | Back alignment and domain information |
|---|
| >KOG3506|consensus | Back alignment and domain information |
|---|
| >KOG1856|consensus | Back alignment and domain information |
|---|
| >KOG3697|consensus | Back alignment and domain information |
|---|
| >TIGR01764 excise DNA binding domain, excisionase family | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 128 | ||||
| 1p6g_N | 100 | Real Space Refined Coordinates Of The 30s Subunit F | 2e-05 | ||
| 1vs5_N | 101 | Crystal Structure Of The Bacterial Ribosome From Es | 2e-05 | ||
| 3fih_N | 96 | Ternary Complex-Bound E.Coli 70s Ribosome. This Ent | 2e-05 | ||
| 2gy9_N | 61 | Structure Of The 30s Subunit Of A Pre-Translocation | 4e-05 |
| >pdb|1P6G|N Chain N, Real Space Refined Coordinates Of The 30s Subunit Fitted Into The Low Resolution Cryo-Em Map Of The Ef-G.Gtp State Of E. Coli 70s Ribosome Length = 100 | Back alignment and structure |
|
| >pdb|1VS5|N Chain N, Crystal Structure Of The Bacterial Ribosome From Escherichia Coli In Complex With The Antibiotic Kasugamyin At 3.5a Resolution. This File Contains The 30s Subunit Of One 70s Ribosome. The Entire Crystal Structure Contains Two 70s Ribosomes And Is Described In Remark 400. Length = 101 | Back alignment and structure |
| >pdb|3FIH|N Chain N, Ternary Complex-Bound E.Coli 70s Ribosome. This Entry Consists Of The 30s Subunit, Trnas And The Ternary Complex. Length = 96 | Back alignment and structure |
| >pdb|2GY9|N Chain N, Structure Of The 30s Subunit Of A Pre-Translocational E. Coli Ribosome Obtained By Fitting Atomic Models For Rna And Protein Components Into Cryo-Em Map Emd-1056 Length = 61 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 128 | |||
| 3r8n_N | 100 | 30S ribosomal protein S14; protein biosynthesis, R | 3e-12 | |
| 2eo6_A | 141 | B-cell linker protein; SH2, cytoplasmic adapter pr | 5e-11 | |
| 3bbn_N | 100 | Ribosomal protein S14; small ribosomal subunit, sp | 7e-11 | |
| 2ozo_A | 613 | Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t | 5e-10 | |
| 2ozo_A | 613 | Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t | 2e-06 | |
| 2cs0_A | 119 | Hematopoietic SH2 domain containing; ALX, FLJ14886 | 7e-10 | |
| 2iug_A | 120 | Phosphatidylinositol 3-kinase regulatory alpha sub | 1e-09 | |
| 2ecd_A | 119 | Tyrosine-protein kinase ABL2; SH2 domain, phosphot | 1e-09 | |
| 3k2m_A | 112 | Proto-oncogene tyrosine-protein kinase ABL1; engin | 1e-09 | |
| 3eaz_A | 106 | Tyrosine-protein kinase CSK; SH2, disulfide, oxidi | 1e-09 | |
| 3us4_A | 98 | Megakaryocyte-associated tyrosine-protein kinase; | 2e-09 | |
| 1ju5_A | 109 | CRK; CRK, SH2, SH3, adaptor protein, phosphopeptid | 2e-09 | |
| 3hhm_B | 373 | NISH2 P85alpha; PI3KCA, PI3K, PIK3R1, phosphatidil | 6e-09 | |
| 3hhm_B | 373 | NISH2 P85alpha; PI3KCA, PI3K, PIK3R1, phosphatidil | 1e-07 | |
| 2ysx_A | 119 | Signaling inositol polyphosphate phosphatase SHIP | 6e-09 | |
| 3pqz_A | 117 | Growth factor receptor-bound protein 7; SH2, binds | 7e-09 | |
| 1nrv_A | 105 | Growth factor receptor-bound protein 10; dimer, si | 8e-09 | |
| 1rja_A | 100 | Tyrosine-protein kinase 6; human protein tyrosine | 9e-09 | |
| 1h9o_A | 112 | Phosphatidylinositol 3-kinase; transferase/recepto | 1e-08 | |
| 3gqi_B | 226 | Phospholipase C-gamma-1; phosphorylated kinase, PY | 1e-08 | |
| 3gqi_B | 226 | Phospholipase C-gamma-1; phosphorylated kinase, PY | 2e-05 | |
| 2oq1_A | 254 | Tyrosine-protein kinase ZAP-70; tandem SH2 domains | 2e-08 | |
| 2oq1_A | 254 | Tyrosine-protein kinase ZAP-70; tandem SH2 domains | 1e-07 | |
| 2aug_A | 126 | Growth factor receptor-bound protein 14; phosphory | 2e-08 | |
| 2dly_A | 121 | FYN-related kinase; BRK family kinase, structural | 2e-08 | |
| 1d4t_A | 104 | T cell signal transduction molecule SAP; SH2 domai | 2e-08 | |
| 1r1p_A | 100 | GRB2-related adaptor protein 2; SH2, GADS, phospho | 3e-08 | |
| 2eob_A | 124 | 1-phosphatidylinositol-4,5-bisphosphate phosphodie | 4e-08 | |
| 2vqe_N | 61 | 30S ribosomal protein S14 type Z; tRNA-binding, rR | 4e-08 | |
| 2y3a_B | 302 | Phosphatidylinositol 3-kinase regulatory subunit; | 4e-08 | |
| 1jyr_A | 96 | Growth factor receptor-bound protein 2; receptor b | 5e-08 | |
| 1i3z_A | 103 | EWS/FLI1 activated transcript 2; SH2 domain phosph | 5e-08 | |
| 1a81_A | 254 | SYK kinase; complex (transferase-peptide), SYK, ki | 6e-08 | |
| 1a81_A | 254 | SYK kinase; complex (transferase-peptide), SYK, ki | 2e-07 | |
| 1opk_A | 495 | P150, C-ABL, proto-oncogene tyrosine-protein kinas | 6e-08 | |
| 2eo3_A | 111 | CRK-like protein; phosphorylation, repeat, SH2 dom | 8e-08 | |
| 1ka6_A | 128 | SH2 domain protein 1A; SH2 domain, protein-peptide | 8e-08 | |
| 3ov1_A | 117 | Growth factor receptor-bound protein 2; GRB2 SH2 d | 8e-08 | |
| 2dlz_A | 118 | Protein VAV-2; RHO family guanine nucleotide excha | 9e-08 | |
| 2gsb_A | 119 | RAS GTPase-activating protein 1; GAP, RAS P21 prot | 1e-07 | |
| 2hdv_A | 111 | SH2-B PH domain containing signaling mediator 1 ga | 3e-07 | |
| 2izv_A | 187 | Suppressor of cytokine signaling 4; signal transdu | 4e-07 | |
| 2crh_A | 138 | VAV proto-oncogene; oncoprotein, structural genomi | 6e-07 | |
| 3tkz_A | 109 | Tyrosine-protein phosphatase non-receptor type 11; | 8e-07 | |
| 2ekx_A | 110 | Cytoplasmic tyrosine-protein kinase BMX; SH2 domai | 9e-07 | |
| 2kno_A | 131 | Tensin-like C1 domain-containing phosphatase; SH2 | 1e-06 | |
| 2dm0_A | 125 | Tyrosine-protein kinase TXK; TEC family kinase, st | 1e-06 | |
| 2ge9_A | 125 | Tyrosine-protein kinase BTK; SH2 domain, structure | 2e-06 | |
| 2c9w_A | 169 | Suppressor of cytokine signaling 2; growth regulat | 2e-06 | |
| 3s9k_A | 118 | Tyrosine-protein kinase ITK/TSK; proline isomeriza | 2e-06 | |
| 3cbl_A | 377 | C-FES, proto-oncogene tyrosine-protein kinase FES/ | 2e-06 | |
| 2cia_A | 102 | Cytoplasmic protein NCK2; SH2-domain, SH3 domain, | 3e-06 | |
| 2vif_A | 141 | Suppressor of cytokine signalling 6; growth regula | 3e-06 | |
| 1lkk_A | 105 | Human P56 tyrosine kinase; complex (tyrosine kinas | 5e-06 | |
| 2bbu_A | 164 | Suppressor of cytokine signaling 3; SH2 domain, ex | 5e-06 | |
| 1wqu_A | 114 | C-FES, proto-oncogene tyrosine-protein kinase FES/ | 6e-06 | |
| 2hmh_A | 152 | Suppressor of cytokine signaling 3; SOCS3, GP130, | 6e-06 | |
| 2lqn_A | 303 | CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT | 8e-06 | |
| 2dx0_A | 138 | Phospholipase C, gamma 2; phosphoric diester hydro | 1e-05 | |
| 1aot_F | 106 | FYN protein-tyrosine kinase; SH2 domain, signal tr | 1e-05 | |
| 1mil_A | 104 | SHC adaptor protein; SH2 domain, phosphorylation, | 1e-05 | |
| 2dvj_A | 230 | V-CRK sarcoma virus CT10 oncogene homolog, isoform | 4e-05 | |
| 3maz_A | 125 | Signal-transducing adaptor protein 1; modular doma | 6e-05 | |
| 1k9a_A | 450 | Carboxyl-terminal SRC kinase; COOH-terminal SRC ki | 8e-05 | |
| 2kk6_A | 116 | Proto-oncogene tyrosine-protein kinase FER; method | 9e-05 | |
| 2eyz_A | 304 | V-CRK sarcoma virus CT10 oncogene homolog isoform | 1e-04 | |
| 1blj_A | 114 | P55 BLK protein tyrosine kinase; signal transducti | 2e-04 |
| >2eo6_A B-cell linker protein; SH2, cytoplasmic adapter protein, B-cell adapter containing SH2 domain protein; NMR {Mus musculus} Length = 141 | Back alignment and structure |
|---|
| >3bbn_N Ribosomal protein S14; small ribosomal subunit, spinach chloroplast ribosome, ribonucleoprotein particle, macromolecular complex; 9.40A {Spinacea oleracea} Length = 100 | Back alignment and structure |
|---|
| >2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} Length = 613 | Back alignment and structure |
|---|
| >2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} Length = 613 | Back alignment and structure |
|---|
| >2cs0_A Hematopoietic SH2 domain containing; ALX, FLJ14886, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.93.1.1 Length = 119 | Back alignment and structure |
|---|
| >2iug_A Phosphatidylinositol 3-kinase regulatory alpha subunit; transferase, polymorphism, UBL conjugation, phosphorylation, SH2, PI3K, SH2 domain; 1.89A {Homo sapiens} PDB: 2iuh_A* 2iui_A* 1fu5_A* 1fu6_A 1oo3_A 1oo4_A* 2pna_A 2pnb_A Length = 120 | Back alignment and structure |
|---|
| >2ecd_A Tyrosine-protein kinase ABL2; SH2 domain, phosphotyrosine binding domain, protein tyrosine kinase, signal transduction, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 119 | Back alignment and structure |
|---|
| >3k2m_A Proto-oncogene tyrosine-protein kinase ABL1; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 1.75A {Homo sapiens} PDB: 3uyo_A 3t04_A 1ab2_A Length = 112 | Back alignment and structure |
|---|
| >3eaz_A Tyrosine-protein kinase CSK; SH2, disulfide, oxidized reduced, ATP-binding, cell membrane, cytoplasm, membrane, nucleotide-binding, phosphoprotein; 1.31A {Homo sapiens} PDB: 3eac_A Length = 106 | Back alignment and structure |
|---|
| >3us4_A Megakaryocyte-associated tyrosine-protein kinase; SH2 domain, signaling protein, structural genomics, joint CE structural genomics, JCSG; 1.50A {Homo sapiens} PDB: 1jwo_A Length = 98 | Back alignment and structure |
|---|
| >1ju5_A CRK; CRK, SH2, SH3, adaptor protein, phosphopeptide, protein binding/transferase complex; HET: PTR; NMR {Homo sapiens} SCOP: d.93.1.1 Length = 109 | Back alignment and structure |
|---|
| >3hhm_B NISH2 P85alpha; PI3KCA, PI3K, PIK3R1, phosphatidilynositol 3,4,5- triphosphate, wortmannin, H1047R, ATP-binding, disease mutation, kinase; HET: KWT; 2.80A {Homo sapiens} PDB: 3hiz_B 2rd0_B 4a55_B* 3mtt_A Length = 373 | Back alignment and structure |
|---|
| >3hhm_B NISH2 P85alpha; PI3KCA, PI3K, PIK3R1, phosphatidilynositol 3,4,5- triphosphate, wortmannin, H1047R, ATP-binding, disease mutation, kinase; HET: KWT; 2.80A {Homo sapiens} PDB: 3hiz_B 2rd0_B 4a55_B* 3mtt_A Length = 373 | Back alignment and structure |
|---|
| >2ysx_A Signaling inositol polyphosphate phosphatase SHIP II; SH2 domain, phosphotyrosine binding domain, protein tyrosine kinase, signal transduction; NMR {Homo sapiens} Length = 119 | Back alignment and structure |
|---|
| >3pqz_A Growth factor receptor-bound protein 7; SH2, binds phosphotyrosine, tyrosine kinases, cytoplasmic, P binding; 2.41A {Homo sapiens} PDB: 1mw4_A* 2l4k_A* 2qms_A Length = 117 | Back alignment and structure |
|---|
| >1nrv_A Growth factor receptor-bound protein 10; dimer, signaling protein; 1.65A {Homo sapiens} SCOP: d.93.1.1 PDB: 3m7f_A Length = 105 | Back alignment and structure |
|---|
| >1rja_A Tyrosine-protein kinase 6; human protein tyrosine kinase-6 (PTK6/BRK), SRC homology 2(S domain, solution structure, backbone dynamics, transferase; NMR {Homo sapiens} SCOP: d.93.1.1 Length = 100 | Back alignment and structure |
|---|
| >1h9o_A Phosphatidylinositol 3-kinase; transferase/receptor, complex (phosphotransferase/receptor), phosphotransferase, SH2 domain; HET: PTR; 1.79A {Homo sapiens} SCOP: d.93.1.1 PDB: 1pic_A* 1bfi_A 1bfj_A 1qad_A Length = 112 | Back alignment and structure |
|---|
| >3gqi_B Phospholipase C-gamma-1; phosphorylated kinase, PY-recognition, tandem SH2 domains, A analog, ATP-binding, craniosynostosis, disease mutation; HET: PTR DVT ACP; 2.50A {Rattus norvegicus} PDB: 2fci_A* 2pld_A* 2ple_A* Length = 226 | Back alignment and structure |
|---|
| >3gqi_B Phospholipase C-gamma-1; phosphorylated kinase, PY-recognition, tandem SH2 domains, A analog, ATP-binding, craniosynostosis, disease mutation; HET: PTR DVT ACP; 2.50A {Rattus norvegicus} PDB: 2fci_A* 2pld_A* 2ple_A* Length = 226 | Back alignment and structure |
|---|
| >2oq1_A Tyrosine-protein kinase ZAP-70; tandem SH2 domains, ZAP-70, tyrosine kinase, transferase; HET: PTR; 1.90A {Homo sapiens} SCOP: d.93.1.1 d.93.1.1 PDB: 1m61_A Length = 254 | Back alignment and structure |
|---|
| >2oq1_A Tyrosine-protein kinase ZAP-70; tandem SH2 domains, ZAP-70, tyrosine kinase, transferase; HET: PTR; 1.90A {Homo sapiens} SCOP: d.93.1.1 d.93.1.1 PDB: 1m61_A Length = 254 | Back alignment and structure |
|---|
| >2aug_A Growth factor receptor-bound protein 14; phosphorylation, SH2 domain, signaling protein; 2.30A {Homo sapiens} Length = 126 | Back alignment and structure |
|---|
| >2dly_A FYN-related kinase; BRK family kinase, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 121 | Back alignment and structure |
|---|
| >1d4t_A T cell signal transduction molecule SAP; SH2 domain, tyrosine kinase, signal transduction, peptide recognition, signaling protein; 1.10A {Homo sapiens} SCOP: d.93.1.1 PDB: 1d1z_A 1d4w_A* 1m27_A* Length = 104 | Back alignment and structure |
|---|
| >1r1p_A GRB2-related adaptor protein 2; SH2, GADS, phosphopeptide, peptide binding protein; HET: PTR; 1.80A {Mus musculus} SCOP: d.93.1.1 PDB: 1r1q_A* 1r1s_A* Length = 100 | Back alignment and structure |
|---|
| >2eob_A 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma 2; SH2, phosphoinositide phospholipase C, PLC-gamma-2, phospholipase C-gamma-2; NMR {Rattus norvegicus} Length = 124 | Back alignment and structure |
|---|
| >2vqe_N 30S ribosomal protein S14 type Z; tRNA-binding, rRNA-binding, metal-binding, zinc-finger, translation; HET: TM2 PAR; 2.5A {Thermus thermophilus} SCOP: g.39.1.7 PDB: 1gix_Q* 1hnw_N* 1hnx_N* 1hnz_N* 1hr0_N 1ibk_N* 1ibl_N* 1ibm_N 1jgo_Q* 1jgp_Q* 1jgq_Q* 1ml5_Q* 1xmo_N* 1xmq_N* 1xnq_N* 1xnr_N* 1yl4_Q 2b64_N* 2b9m_N* 2b9o_N* ... Length = 61 | Back alignment and structure |
|---|
| >2y3a_B Phosphatidylinositol 3-kinase regulatory subunit; transferase, phosphoinositide 3-kinase, RTK; HET: GD9; 3.30A {Mus musculus} Length = 302 | Back alignment and structure |
|---|
| >1jyr_A Growth factor receptor-bound protein 2; receptor binding, regulatory, inhibitor, signaling protein-I complex; HET: PTR; 1.55A {Homo sapiens} SCOP: d.93.1.1 PDB: 1jyq_A* 1jyu_A 1qg1_E* 1x0n_A* 2aob_A* 2aoa_A* 3n7y_A* 1tze_E* 1zfp_E* 3mxc_A* 3mxy_A* 1cj1_A* Length = 96 | Back alignment and structure |
|---|
| >1i3z_A EWS/FLI1 activated transcript 2; SH2 domain phosphotyrosine signal transduction lymphocyte, signaling protein; HET: PTR; 2.15A {Mus musculus} SCOP: d.93.1.1 Length = 103 | Back alignment and structure |
|---|
| >1a81_A SYK kinase; complex (transferase-peptide), SYK, kinase, SH2 domain; HET: PTR; 3.00A {Homo sapiens} SCOP: d.93.1.1 d.93.1.1 PDB: 1csy_A* 1csz_A* Length = 254 | Back alignment and structure |
|---|
| >1a81_A SYK kinase; complex (transferase-peptide), SYK, kinase, SH2 domain; HET: PTR; 3.00A {Homo sapiens} SCOP: d.93.1.1 d.93.1.1 PDB: 1csy_A* 1csz_A* Length = 254 | Back alignment and structure |
|---|
| >1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A Length = 495 | Back alignment and structure |
|---|
| >2eo3_A CRK-like protein; phosphorylation, repeat, SH2 domain, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 111 | Back alignment and structure |
|---|
| >1ka6_A SH2 domain protein 1A; SH2 domain, protein-peptide complex, immune system; HET: PTR; NMR {Homo sapiens} SCOP: d.93.1.1 PDB: 1ka7_A Length = 128 | Back alignment and structure |
|---|
| >3ov1_A Growth factor receptor-bound protein 2; GRB2 SH2 domain, phosphotyrosine binding, signaling protein, signaling protein-antagonist complex; HET: PTR; 1.60A {Homo sapiens} PDB: 3imj_A* 3in7_A* 3imd_A* 3kfj_A* 3n8m_A* 3in8_A* 3s8l_A* 3s8n_A* 3s8o_A* 2huy_A* 2h5k_A* 2huw_A* 2h46_E* 3c7i_A* 3n84_A* 1fhs_A 1bm2_A* 1bmb_A* 3ove_A* 1fyr_A* ... Length = 117 | Back alignment and structure |
|---|
| >2dlz_A Protein VAV-2; RHO family guanine nucleotide exchange factor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 118 | Back alignment and structure |
|---|
| >2gsb_A RAS GTPase-activating protein 1; GAP, RAS P21 protein activator, P120GAP, rasgap, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 119 | Back alignment and structure |
|---|
| >2hdv_A SH2-B PH domain containing signaling mediator 1 gamma isoform; adapter protein, signaling protein; 2.00A {Mus musculus} PDB: 2hdx_A* 1rpy_A 1rqq_C* Length = 111 | Back alignment and structure |
|---|
| >2izv_A Suppressor of cytokine signaling 4; signal transduction inhibitor, growth regulation, signal transduction, SH2 domain, nuclear protein; 2.55A {Homo sapiens} SCOP: a.271.1.1 d.93.1.1 Length = 187 | Back alignment and structure |
|---|
| >2crh_A VAV proto-oncogene; oncoprotein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2ror_A* 2lct_A* Length = 138 | Back alignment and structure |
|---|
| >3tkz_A Tyrosine-protein phosphatase non-receptor type 11; SH2 domain, protein protein interactions, PTR residues, HYDR peptide complex; HET: PTR; 1.80A {Homo sapiens} PDB: 3tl0_A* 1aya_A* 1ayb_A* 1ayc_A* 1ayd_A Length = 109 | Back alignment and structure |
|---|
| >2ekx_A Cytoplasmic tyrosine-protein kinase BMX; SH2 domain, phosphotyrosine binding domain, protein tyrosine kinase, signal transduction; NMR {Homo sapiens} Length = 110 | Back alignment and structure |
|---|
| >2kno_A Tensin-like C1 domain-containing phosphatase; SH2 domain, TENC1, solution structure, cell junctio membrane, hydrolase, membrane, metal-binding; NMR {Homo sapiens} PDB: 2l6k_A Length = 131 | Back alignment and structure |
|---|
| >2dm0_A Tyrosine-protein kinase TXK; TEC family kinase, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 125 | Back alignment and structure |
|---|
| >2ge9_A Tyrosine-protein kinase BTK; SH2 domain, structure, transferase; NMR {Homo sapiens} Length = 125 | Back alignment and structure |
|---|
| >2c9w_A Suppressor of cytokine signaling 2; growth regulation, SH2 domain, signal transduction inhibitor nuclear protein; 1.9A {Homo sapiens} SCOP: a.271.1.1 d.93.1.1 Length = 169 | Back alignment and structure |
|---|
| >3s9k_A Tyrosine-protein kinase ITK/TSK; proline isomerization, CIS proline, domain swapped dimer, SH transferase; HET: CIT; 2.35A {Mus musculus} PDB: 2etz_A* 2eu0_A* 1lui_A 1luk_A 1lum_A 1lun_A 2k79_B 2k7a_B Length = 118 | Back alignment and structure |
|---|
| >3cbl_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; V-FES, fujinami, avian sarcoma, viral, feline virus, SGC; HET: STU; 1.75A {Homo sapiens} PDB: 3bkb_A* 3cd3_A* 4e93_A* Length = 377 | Back alignment and structure |
|---|
| >2cia_A Cytoplasmic protein NCK2; SH2-domain, SH3 domain, phosphorylation, binding specificity; HET: PTR MPD; 1.45A {Homo sapiens} PDB: 1z3k_A 2ci9_A* 2ci8_A* Length = 102 | Back alignment and structure |
|---|
| >2vif_A Suppressor of cytokine signalling 6; growth regulation, signal transduction inhibitor, KIT regula phosphotyrosine, signaling protein; HET: PTR; 1.45A {Homo sapiens} Length = 141 | Back alignment and structure |
|---|
| >1lkk_A Human P56 tyrosine kinase; complex (tyrosine kinase/peptide); HET: PTR; 1.00A {Homo sapiens} SCOP: d.93.1.1 PDB: 1lcj_A* 1bhf_A* 1bhh_A 1lkl_A* 1bhh_B 1fbz_A* 1ijr_A* 1cwd_L* 1cwe_A* Length = 105 | Back alignment and structure |
|---|
| >2bbu_A Suppressor of cytokine signaling 3; SH2 domain, extended SH2 subdomain, PEST motif, protein complex, cytokine regulator; HET: PTR; NMR {Mus musculus} Length = 164 | Back alignment and structure |
|---|
| >1wqu_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; SH2 domain, feline sarcoma oncogene, structural genomics; NMR {Homo sapiens} PDB: 2dcr_A Length = 114 | Back alignment and structure |
|---|
| >2hmh_A Suppressor of cytokine signaling 3; SOCS3, GP130, PTyr, peptide complex, cytokine regulator; HET: PTR; 2.00A {Mus musculus} Length = 152 | Back alignment and structure |
|---|
| >2lqn_A CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT10 oncogene homolog (avian)- signaling protein; NMR {Homo sapiens} PDB: 2lqw_A* Length = 303 | Back alignment and structure |
|---|
| >2dx0_A Phospholipase C, gamma 2; phosphoric diester hydrolase, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.50A {Mus musculus} Length = 138 | Back alignment and structure |
|---|
| >1aot_F FYN protein-tyrosine kinase; SH2 domain, signal transduction, peptide complex, complex (proto-oncogene/early protein); HET: PTR; NMR {Homo sapiens} SCOP: d.93.1.1 PDB: 1aou_F* Length = 106 | Back alignment and structure |
|---|
| >1mil_A SHC adaptor protein; SH2 domain, phosphorylation, collagen, growth regulation, transforming protein, alternative initiation; 2.70A {Homo sapiens} SCOP: d.93.1.1 PDB: 1tce_A* Length = 104 | Back alignment and structure |
|---|
| >2dvj_A V-CRK sarcoma virus CT10 oncogene homolog, isoform A; SH3, SH2, signal transduction, adapter molecule, signaling protein; HET: PTR; NMR {Homo sapiens} PDB: 2eyy_A 2eyv_A 2eyw_A Length = 230 | Back alignment and structure |
|---|
| >3maz_A Signal-transducing adaptor protein 1; modular domain, phosphotyrosine, specificity, cytoplasm, phosphoprotein, SH2 domain, signaling protein; HET: PTR; 1.90A {Homo sapiens} Length = 125 | Back alignment and structure |
|---|
| >1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A Length = 450 | Back alignment and structure |
|---|
| >2kk6_A Proto-oncogene tyrosine-protein kinase FER; methods development, SH2, NESG, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein; NMR {Homo sapiens} Length = 116 | Back alignment and structure |
|---|
| >2eyz_A V-CRK sarcoma virus CT10 oncogene homolog isoform A; SH2, SH3, signaling protein; NMR {Homo sapiens} PDB: 2l3s_A 2l3p_A 2l3q_A 2ggr_A Length = 304 | Back alignment and structure |
|---|
| >1blj_A P55 BLK protein tyrosine kinase; signal transduction, transferase, phosphotransferase, phosphorylation; NMR {Mus musculus} SCOP: d.93.1.1 PDB: 1blk_A Length = 114 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 128 | |||
| 3r8n_N | 100 | 30S ribosomal protein S14; protein biosynthesis, R | 99.96 | |
| 3bbn_N | 100 | Ribosomal protein S14; small ribosomal subunit, sp | 99.95 | |
| 2vqe_N | 61 | 30S ribosomal protein S14 type Z; tRNA-binding, rR | 99.88 | |
| 3us4_A | 98 | Megakaryocyte-associated tyrosine-protein kinase; | 99.88 | |
| 3eaz_A | 106 | Tyrosine-protein kinase CSK; SH2, disulfide, oxidi | 99.87 | |
| 3maz_A | 125 | Signal-transducing adaptor protein 1; modular doma | 99.86 | |
| 3k2m_A | 112 | Proto-oncogene tyrosine-protein kinase ABL1; engin | 99.86 | |
| 1d4t_A | 104 | T cell signal transduction molecule SAP; SH2 domai | 99.86 | |
| 1i3z_A | 103 | EWS/FLI1 activated transcript 2; SH2 domain phosph | 99.85 | |
| 1rja_A | 100 | Tyrosine-protein kinase 6; human protein tyrosine | 99.84 | |
| 1lkk_A | 105 | Human P56 tyrosine kinase; complex (tyrosine kinas | 99.84 | |
| 2dly_A | 121 | FYN-related kinase; BRK family kinase, structural | 99.84 | |
| 2ecd_A | 119 | Tyrosine-protein kinase ABL2; SH2 domain, phosphot | 99.84 | |
| 1nrv_A | 105 | Growth factor receptor-bound protein 10; dimer, si | 99.84 | |
| 1ka6_A | 128 | SH2 domain protein 1A; SH2 domain, protein-peptide | 99.83 | |
| 3pqz_A | 117 | Growth factor receptor-bound protein 7; SH2, binds | 99.83 | |
| 2ysx_A | 119 | Signaling inositol polyphosphate phosphatase SHIP | 99.83 | |
| 2ekx_A | 110 | Cytoplasmic tyrosine-protein kinase BMX; SH2 domai | 99.83 | |
| 1aot_F | 106 | FYN protein-tyrosine kinase; SH2 domain, signal tr | 99.82 | |
| 3s9k_A | 118 | Tyrosine-protein kinase ITK/TSK; proline isomeriza | 99.82 | |
| 1h9o_A | 112 | Phosphatidylinositol 3-kinase; transferase/recepto | 99.82 | |
| 2dlz_A | 118 | Protein VAV-2; RHO family guanine nucleotide excha | 99.82 | |
| 1blj_A | 114 | P55 BLK protein tyrosine kinase; signal transducti | 99.82 | |
| 2eob_A | 124 | 1-phosphatidylinositol-4,5-bisphosphate phosphodie | 99.82 | |
| 2lnw_A | 122 | VAV-2, guanine nucleotide exchange factor VAV2; si | 99.82 | |
| 2gsb_A | 119 | RAS GTPase-activating protein 1; GAP, RAS P21 prot | 99.82 | |
| 3tkz_A | 109 | Tyrosine-protein phosphatase non-receptor type 11; | 99.82 | |
| 2aug_A | 126 | Growth factor receptor-bound protein 14; phosphory | 99.81 | |
| 2crh_A | 138 | VAV proto-oncogene; oncoprotein, structural genomi | 99.81 | |
| 2ge9_A | 125 | Tyrosine-protein kinase BTK; SH2 domain, structure | 99.81 | |
| 2dm0_A | 125 | Tyrosine-protein kinase TXK; TEC family kinase, st | 99.81 | |
| 2cs0_A | 119 | Hematopoietic SH2 domain containing; ALX, FLJ14886 | 99.81 | |
| 2kno_A | 131 | Tensin-like C1 domain-containing phosphatase; SH2 | 99.8 | |
| 2eo3_A | 111 | CRK-like protein; phosphorylation, repeat, SH2 dom | 99.8 | |
| 2iug_A | 120 | Phosphatidylinositol 3-kinase regulatory alpha sub | 99.8 | |
| 2eo6_A | 141 | B-cell linker protein; SH2, cytoplasmic adapter pr | 99.8 | |
| 2el8_A | 118 | Signal-transducing adaptor protein 2; SH2 domain, | 99.79 | |
| 1mil_A | 104 | SHC adaptor protein; SH2 domain, phosphorylation, | 99.79 | |
| 2dx0_A | 138 | Phospholipase C, gamma 2; phosphoric diester hydro | 99.79 | |
| 2kk6_A | 116 | Proto-oncogene tyrosine-protein kinase FER; method | 99.78 | |
| 1ju5_A | 109 | CRK; CRK, SH2, SH3, adaptor protein, phosphopeptid | 99.78 | |
| 2c9w_A | 169 | Suppressor of cytokine signaling 2; growth regulat | 99.78 | |
| 4d8k_A | 175 | Tyrosine-protein kinase LCK; protein kinases, SH2 | 99.77 | |
| 1jyr_A | 96 | Growth factor receptor-bound protein 2; receptor b | 99.77 | |
| 2vif_A | 141 | Suppressor of cytokine signalling 6; growth regula | 99.77 | |
| 2cia_A | 102 | Cytoplasmic protein NCK2; SH2-domain, SH3 domain, | 99.77 | |
| 1r1p_A | 100 | GRB2-related adaptor protein 2; SH2, GADS, phospho | 99.76 | |
| 3ov1_A | 117 | Growth factor receptor-bound protein 2; GRB2 SH2 d | 99.76 | |
| 1a81_A | 254 | SYK kinase; complex (transferase-peptide), SYK, ki | 99.75 | |
| 1wqu_A | 114 | C-FES, proto-oncogene tyrosine-protein kinase FES/ | 99.75 | |
| 2izv_A | 187 | Suppressor of cytokine signaling 4; signal transdu | 99.75 | |
| 2hdv_A | 111 | SH2-B PH domain containing signaling mediator 1 ga | 99.75 | |
| 2oq1_A | 254 | Tyrosine-protein kinase ZAP-70; tandem SH2 domains | 99.75 | |
| 2oq1_A | 254 | Tyrosine-protein kinase ZAP-70; tandem SH2 domains | 99.74 | |
| 4fbn_A | 246 | 1-phosphatidylinositol 4,5-bisphosphate phosphodi | 99.74 | |
| 1a81_A | 254 | SYK kinase; complex (transferase-peptide), SYK, ki | 99.74 | |
| 4fl3_A | 635 | Tyrosine-protein kinase SYK; transferase; HET: ANP | 99.73 | |
| 2hmh_A | 152 | Suppressor of cytokine signaling 3; SOCS3, GP130, | 99.73 | |
| 2bbu_A | 164 | Suppressor of cytokine signaling 3; SH2 domain, ex | 99.73 | |
| 2ozo_A | 613 | Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t | 99.72 | |
| 4fbn_A | 246 | 1-phosphatidylinositol 4,5-bisphosphate phosphodi | 99.72 | |
| 2y3a_B | 302 | Phosphatidylinositol 3-kinase regulatory subunit; | 99.71 | |
| 1opk_A | 495 | P150, C-ABL, proto-oncogene tyrosine-protein kinas | 99.71 | |
| 4fl3_A | 635 | Tyrosine-protein kinase SYK; transferase; HET: ANP | 99.71 | |
| 2dvj_A | 230 | V-CRK sarcoma virus CT10 oncogene homolog, isoform | 99.71 | |
| 3hhm_B | 373 | NISH2 P85alpha; PI3KCA, PI3K, PIK3R1, phosphatidil | 99.7 | |
| 3qwx_X | 174 | Cell death abnormality protein 2; cell engulfment, | 99.69 | |
| 2eyz_A | 304 | V-CRK sarcoma virus CT10 oncogene homolog isoform | 99.68 | |
| 1fmk_A | 452 | C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros | 99.66 | |
| 2b3o_A | 532 | Tyrosine-protein phosphatase, non-receptor type 6; | 99.66 | |
| 2ozo_A | 613 | Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t | 99.65 | |
| 3ps5_A | 595 | Tyrosine-protein phosphatase non-receptor type 6; | 99.64 | |
| 2h8h_A | 535 | Proto-oncogene tyrosine-protein kinase SRC; SRC ki | 99.63 | |
| 1k9a_A | 450 | Carboxyl-terminal SRC kinase; COOH-terminal SRC ki | 99.63 | |
| 3qwy_A | 308 | Cell death abnormality protein 2; cell engulfment, | 99.63 | |
| 1qcf_A | 454 | Haematopoetic cell kinase (HCK); tyrosine kinase-i | 99.63 | |
| 2lqn_A | 303 | CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT | 99.43 | |
| 3ps5_A | 595 | Tyrosine-protein phosphatase non-receptor type 6; | 99.58 | |
| 2shp_A | 525 | SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin | 99.58 | |
| 3cbl_A | 377 | C-FES, proto-oncogene tyrosine-protein kinase FES/ | 99.58 | |
| 2cr4_A | 126 | 3BP-2, SH3 domain-binding protein 2; structural ge | 99.53 | |
| 2shp_A | 525 | SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin | 99.51 | |
| 2b3o_A | 532 | Tyrosine-protein phosphatase, non-receptor type 6; | 99.5 | |
| 3cxl_A | 463 | N-chimerin; SH2, RHO-GAP, structural genomics cons | 99.48 | |
| 3hhm_B | 373 | NISH2 P85alpha; PI3KCA, PI3K, PIK3R1, phosphatidil | 99.43 | |
| 1gri_A | 217 | Growth factor bound protein 2; SH2, SH3, signal tr | 99.34 | |
| 2xzm_N | 55 | RPS29E; ribosome, translation; 3.93A {Tetrahymena | 99.19 | |
| 2xp1_A | 178 | SPT6; transcription, IWS1, histone chaperone, mRNA | 99.02 | |
| 3j20_P | 56 | 30S ribosomal protein S14P type Z; archaea, archae | 98.95 | |
| 3iz6_N | 56 | 40S ribosomal protein S29 (S14P); eukaryotic ribos | 98.85 | |
| 3u5c_d | 56 | S36, YS29, 40S ribosomal protein S29-A; translatio | 98.78 | |
| 1uur_A | 473 | Stata protein, STAT protein; transcription activat | 98.09 | |
| 3or8_A | 197 | Transcription elongation factor SPT6; SH2, CTD bin | 97.69 | |
| 1y1u_A | 585 | Signal transducer and activator of transcription; | 97.07 | |
| 1yvl_A | 683 | Signal transducer and activator of transcription 1 | 96.49 | |
| 2xp1_A | 178 | SPT6; transcription, IWS1, histone chaperone, mRNA | 96.06 | |
| 1bg1_A | 596 | Protein (transcription factor STAT3B); protein-DNA | 95.83 | |
| 1bf5_A | 575 | Signal transducer and activator of transcription 1 | 95.72 | |
| 3bux_B | 329 | E3 ubiquitin-protein ligase CBL; TKB, signal trans | 94.97 | |
| 3op0_A | 323 | Signal transduction protein CBL-C; structural geno | 94.21 | |
| 3psi_A | 1219 | Transcription elongation factor SPT6; nucleus; 3.3 | 92.58 | |
| 3or8_A | 197 | Transcription elongation factor SPT6; SH2, CTD bin | 89.34 |
| >3bbn_N Ribosomal protein S14; small ribosomal subunit, spinach chloroplast ribosome, ribonucleoprotein particle, macromolecular complex; 9.40A {Spinacea oleracea} | Back alignment and structure |
|---|
| >2vqe_N 30S ribosomal protein S14 type Z; tRNA-binding, rRNA-binding, metal-binding, zinc-finger, translation; HET: TM2 PAR; 2.5A {Thermus thermophilus} SCOP: g.39.1.7 PDB: 1gix_Q* 1hnw_N* 1hnx_N* 1hnz_N* 1hr0_N 1ibk_N* 1ibl_N* 1ibm_N 1jgo_Q* 1jgp_Q* 1jgq_Q* 1ml5_Q* 1xmo_N* 1xmq_N* 1xnq_N* 1xnr_N* 1yl4_Q 2b64_N* 2b9m_N* 2b9o_N* ... | Back alignment and structure |
|---|
| >3us4_A Megakaryocyte-associated tyrosine-protein kinase; SH2 domain, signaling protein, structural genomics, joint CE structural genomics, JCSG; 1.50A {Homo sapiens} SCOP: d.93.1.1 PDB: 1jwo_A | Back alignment and structure |
|---|
| >3eaz_A Tyrosine-protein kinase CSK; SH2, disulfide, oxidized reduced, ATP-binding, cell membrane, cytoplasm, membrane, nucleotide-binding, phosphoprotein; 1.31A {Homo sapiens} PDB: 3eac_A | Back alignment and structure |
|---|
| >3maz_A Signal-transducing adaptor protein 1; modular domain, phosphotyrosine, specificity, cytoplasm, phosphoprotein, SH2 domain, signaling protein; HET: PTR; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >3k2m_A Proto-oncogene tyrosine-protein kinase ABL1; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 1.75A {Homo sapiens} PDB: 3uyo_A 3t04_A 1ab2_A | Back alignment and structure |
|---|
| >1d4t_A T cell signal transduction molecule SAP; SH2 domain, tyrosine kinase, signal transduction, peptide recognition, signaling protein; 1.10A {Homo sapiens} SCOP: d.93.1.1 PDB: 1d1z_A 1d4w_A* 1m27_A* | Back alignment and structure |
|---|
| >1i3z_A EWS/FLI1 activated transcript 2; SH2 domain phosphotyrosine signal transduction lymphocyte, signaling protein; HET: PTR; 2.15A {Mus musculus} SCOP: d.93.1.1 | Back alignment and structure |
|---|
| >1rja_A Tyrosine-protein kinase 6; human protein tyrosine kinase-6 (PTK6/BRK), SRC homology 2(S domain, solution structure, backbone dynamics, transferase; NMR {Homo sapiens} SCOP: d.93.1.1 | Back alignment and structure |
|---|
| >1lkk_A Human P56 tyrosine kinase; complex (tyrosine kinase/peptide); HET: PTR; 1.00A {Homo sapiens} SCOP: d.93.1.1 PDB: 1lcj_A* 1bhf_A* 1bhh_A 1lkl_A* 1bhh_B 1fbz_A* 1ijr_A* 1cwd_L* 1cwe_A* | Back alignment and structure |
|---|
| >2dly_A FYN-related kinase; BRK family kinase, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2ecd_A Tyrosine-protein kinase ABL2; SH2 domain, phosphotyrosine binding domain, protein tyrosine kinase, signal transduction, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1nrv_A Growth factor receptor-bound protein 10; dimer, signaling protein; 1.65A {Homo sapiens} SCOP: d.93.1.1 PDB: 3m7f_A | Back alignment and structure |
|---|
| >1ka6_A SH2 domain protein 1A; SH2 domain, protein-peptide complex, immune system; HET: PTR; NMR {Homo sapiens} SCOP: d.93.1.1 PDB: 1ka7_A | Back alignment and structure |
|---|
| >3pqz_A Growth factor receptor-bound protein 7; SH2, binds phosphotyrosine, tyrosine kinases, cytoplasmic, P binding; 2.41A {Homo sapiens} PDB: 1mw4_A* 2l4k_A* 2qms_A | Back alignment and structure |
|---|
| >2ysx_A Signaling inositol polyphosphate phosphatase SHIP II; SH2 domain, phosphotyrosine binding domain, protein tyrosine kinase, signal transduction; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ekx_A Cytoplasmic tyrosine-protein kinase BMX; SH2 domain, phosphotyrosine binding domain, protein tyrosine kinase, signal transduction; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1aot_F FYN protein-tyrosine kinase; SH2 domain, signal transduction, peptide complex, complex (proto-oncogene/early protein); HET: PTR; NMR {Homo sapiens} SCOP: d.93.1.1 PDB: 1aou_F* | Back alignment and structure |
|---|
| >3s9k_A Tyrosine-protein kinase ITK/TSK; proline isomerization, CIS proline, domain swapped dimer, SH transferase; HET: CIT; 2.35A {Mus musculus} PDB: 2etz_A* 2eu0_A* 1lui_A 1luk_A 1lum_A 1lun_A 2k79_B 2k7a_B | Back alignment and structure |
|---|
| >1h9o_A Phosphatidylinositol 3-kinase; transferase/receptor, complex (phosphotransferase/receptor), phosphotransferase, SH2 domain; HET: PTR; 1.79A {Homo sapiens} SCOP: d.93.1.1 PDB: 1pic_A* 1bfi_A 1bfj_A 1qad_A | Back alignment and structure |
|---|
| >2dlz_A Protein VAV-2; RHO family guanine nucleotide exchange factor, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1blj_A P55 BLK protein tyrosine kinase; signal transduction, transferase, phosphotransferase, phosphorylation; NMR {Mus musculus} SCOP: d.93.1.1 PDB: 1blk_A | Back alignment and structure |
|---|
| >2eob_A 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma 2; SH2, phosphoinositide phospholipase C, PLC-gamma-2, phospholipase C-gamma-2; NMR {Rattus norvegicus} | Back alignment and structure |
|---|
| >2lnw_A VAV-2, guanine nucleotide exchange factor VAV2; signaling protein; HET: PTR; NMR {Homo sapiens} PDB: 2lnx_A | Back alignment and structure |
|---|
| >2gsb_A RAS GTPase-activating protein 1; GAP, RAS P21 protein activator, P120GAP, rasgap, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3tkz_A Tyrosine-protein phosphatase non-receptor type 11; SH2 domain, protein protein interactions, PTR residues, HYDR peptide complex; HET: PTR; 1.80A {Homo sapiens} PDB: 3tl0_A* 1aya_A* 1ayb_A* 1ayc_A* 1ayd_A | Back alignment and structure |
|---|
| >2aug_A Growth factor receptor-bound protein 14; phosphorylation, SH2 domain, signaling protein; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >2crh_A VAV proto-oncogene; oncoprotein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2ror_A* 2lct_A* | Back alignment and structure |
|---|
| >2ge9_A Tyrosine-protein kinase BTK; SH2 domain, structure, transferase; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dm0_A Tyrosine-protein kinase TXK; TEC family kinase, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cs0_A Hematopoietic SH2 domain containing; ALX, FLJ14886, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.93.1.1 | Back alignment and structure |
|---|
| >2kno_A Tensin-like C1 domain-containing phosphatase; SH2 domain, TENC1, solution structure, cell junctio membrane, hydrolase, membrane, metal-binding; NMR {Homo sapiens} PDB: 2l6k_A | Back alignment and structure |
|---|
| >2eo3_A CRK-like protein; phosphorylation, repeat, SH2 domain, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2iug_A Phosphatidylinositol 3-kinase regulatory alpha subunit; transferase, polymorphism, UBL conjugation, phosphorylation, SH2, PI3K, SH2 domain; 1.89A {Homo sapiens} PDB: 2iuh_A* 2iui_A* 1fu5_A* 1fu6_A 1oo3_A 1oo4_A* 2pna_A 2pnb_A | Back alignment and structure |
|---|
| >2eo6_A B-cell linker protein; SH2, cytoplasmic adapter protein, B-cell adapter containing SH2 domain protein; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2el8_A Signal-transducing adaptor protein 2; SH2 domain, phosphotyrosine binding domain, protein tyrosine kinase, signal transduction, structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1mil_A SHC adaptor protein; SH2 domain, phosphorylation, collagen, growth regulation, transforming protein, alternative initiation; 2.70A {Homo sapiens} SCOP: d.93.1.1 PDB: 1tce_A* | Back alignment and structure |
|---|
| >2dx0_A Phospholipase C, gamma 2; phosphoric diester hydrolase, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >2kk6_A Proto-oncogene tyrosine-protein kinase FER; methods development, SH2, NESG, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1ju5_A CRK; CRK, SH2, SH3, adaptor protein, phosphopeptide, protein binding/transferase complex; HET: PTR; NMR {Homo sapiens} SCOP: d.93.1.1 | Back alignment and structure |
|---|
| >2c9w_A Suppressor of cytokine signaling 2; growth regulation, SH2 domain, signal transduction inhibitor nuclear protein; 1.9A {Homo sapiens} SCOP: a.271.1.1 d.93.1.1 | Back alignment and structure |
|---|
| >4d8k_A Tyrosine-protein kinase LCK; protein kinases, SH2 domain, SH3 domain, structural genomics center for structural genomics, JCSG; 2.36A {Homo sapiens} PDB: 1lck_A* 1x27_A* | Back alignment and structure |
|---|
| >1jyr_A Growth factor receptor-bound protein 2; receptor binding, regulatory, inhibitor, signaling protein-I complex; HET: PTR; 1.55A {Homo sapiens} SCOP: d.93.1.1 PDB: 1jyq_A* 1jyu_A 1qg1_E* 1x0n_A* 2aob_A* 2aoa_A* 3n7y_A* 1tze_E* 1zfp_E* 3mxc_A* 3mxy_A* 1cj1_A* | Back alignment and structure |
|---|
| >2vif_A Suppressor of cytokine signalling 6; growth regulation, signal transduction inhibitor, KIT regula phosphotyrosine, signaling protein; HET: PTR; 1.45A {Homo sapiens} | Back alignment and structure |
|---|
| >2cia_A Cytoplasmic protein NCK2; SH2-domain, SH3 domain, phosphorylation, binding specificity; HET: PTR MPD; 1.45A {Homo sapiens} PDB: 1z3k_A 2ci9_A* 2ci8_A* | Back alignment and structure |
|---|
| >1r1p_A GRB2-related adaptor protein 2; SH2, GADS, phosphopeptide, peptide binding protein; HET: PTR; 1.80A {Mus musculus} SCOP: d.93.1.1 PDB: 1r1q_A* 1r1s_A* | Back alignment and structure |
|---|
| >3ov1_A Growth factor receptor-bound protein 2; GRB2 SH2 domain, phosphotyrosine binding, signaling protein, signaling protein-antagonist complex; HET: PTR; 1.60A {Homo sapiens} SCOP: d.93.1.1 PDB: 3imj_A* 3in7_A* 3imd_A* 3kfj_A* 3n8m_A* 3in8_A* 3s8l_A* 3s8n_A* 3s8o_A* 2huy_A* 2h5k_A* 2huw_A* 2h46_E* 3c7i_A* 3n84_A* 1fhs_A 1bm2_A* 1bmb_A* 3ove_A* 1fyr_A* ... | Back alignment and structure |
|---|
| >1a81_A SYK kinase; complex (transferase-peptide), SYK, kinase, SH2 domain; HET: PTR; 3.00A {Homo sapiens} SCOP: d.93.1.1 d.93.1.1 PDB: 1csy_A* 1csz_A* | Back alignment and structure |
|---|
| >1wqu_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; SH2 domain, feline sarcoma oncogene, structural genomics; NMR {Homo sapiens} PDB: 2dcr_A | Back alignment and structure |
|---|
| >2izv_A Suppressor of cytokine signaling 4; signal transduction inhibitor, growth regulation, signal transduction, SH2 domain, nuclear protein; 2.55A {Homo sapiens} SCOP: a.271.1.1 d.93.1.1 | Back alignment and structure |
|---|
| >2hdv_A SH2-B PH domain containing signaling mediator 1 gamma isoform; adapter protein, signaling protein; 2.00A {Mus musculus} PDB: 2hdx_A* 1rpy_A 1rqq_C* | Back alignment and structure |
|---|
| >2oq1_A Tyrosine-protein kinase ZAP-70; tandem SH2 domains, ZAP-70, tyrosine kinase, transferase; HET: PTR; 1.90A {Homo sapiens} SCOP: d.93.1.1 d.93.1.1 PDB: 1m61_A | Back alignment and structure |
|---|
| >2oq1_A Tyrosine-protein kinase ZAP-70; tandem SH2 domains, ZAP-70, tyrosine kinase, transferase; HET: PTR; 1.90A {Homo sapiens} SCOP: d.93.1.1 d.93.1.1 PDB: 1m61_A | Back alignment and structure |
|---|
| >4fbn_A 1-phosphatidylinositol 4,5-bisphosphate phosphodi gamma-1; SH2 domain, plcgamma specific array, interaction domain, FIB growth factor receptor 1; 2.40A {Homo sapiens} PDB: 4ey0_A* 3gqi_B* 2fci_A* 2pld_A* 2ple_A* | Back alignment and structure |
|---|
| >1a81_A SYK kinase; complex (transferase-peptide), SYK, kinase, SH2 domain; HET: PTR; 3.00A {Homo sapiens} SCOP: d.93.1.1 d.93.1.1 PDB: 1csy_A* 1csz_A* | Back alignment and structure |
|---|
| >4fl3_A Tyrosine-protein kinase SYK; transferase; HET: ANP; 1.90A {Homo sapiens} PDB: 4fl2_A* 1a81_A* 1csy_A* 1csz_A* | Back alignment and structure |
|---|
| >2hmh_A Suppressor of cytokine signaling 3; SOCS3, GP130, PTyr, peptide complex, cytokine regulator; HET: PTR; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >2bbu_A Suppressor of cytokine signaling 3; SH2 domain, extended SH2 subdomain, PEST motif, protein complex, cytokine regulator; HET: PTR; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >4fbn_A 1-phosphatidylinositol 4,5-bisphosphate phosphodi gamma-1; SH2 domain, plcgamma specific array, interaction domain, FIB growth factor receptor 1; 2.40A {Homo sapiens} PDB: 4ey0_A* 3gqi_B* 2fci_A* 2pld_A* 2ple_A* | Back alignment and structure |
|---|
| >2y3a_B Phosphatidylinositol 3-kinase regulatory subunit; transferase, phosphoinositide 3-kinase, RTK; HET: GD9; 3.30A {Mus musculus} | Back alignment and structure |
|---|
| >1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A | Back alignment and structure |
|---|
| >4fl3_A Tyrosine-protein kinase SYK; transferase; HET: ANP; 1.90A {Homo sapiens} PDB: 4fl2_A* 1a81_A* 1csy_A* 1csz_A* | Back alignment and structure |
|---|
| >2dvj_A V-CRK sarcoma virus CT10 oncogene homolog, isoform A; SH3, SH2, signal transduction, adapter molecule, signaling protein; HET: PTR; NMR {Homo sapiens} PDB: 2eyy_A 2eyv_A 2eyw_A | Back alignment and structure |
|---|
| >3hhm_B NISH2 P85alpha; PI3KCA, PI3K, PIK3R1, phosphatidilynositol 3,4,5- triphosphate, wortmannin, H1047R, ATP-binding, disease mutation, kinase; HET: KWT; 2.80A {Homo sapiens} PDB: 3hiz_B 2rd0_B 4a55_B* 3mtt_A | Back alignment and structure |
|---|
| >3qwx_X Cell death abnormality protein 2; cell engulfment, signaling protein; 2.01A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >2eyz_A V-CRK sarcoma virus CT10 oncogene homolog isoform A; SH2, SH3, signaling protein; NMR {Homo sapiens} PDB: 2l3s_A 2l3p_A 2l3q_A 2ggr_A | Back alignment and structure |
|---|
| >1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... | Back alignment and structure |
|---|
| >2b3o_A Tyrosine-protein phosphatase, non-receptor type 6; protein tyrosine phosphatase, SHP-1, signaling, hydrolase; 2.80A {Homo sapiens} PDB: 1x6c_A 2rmx_A* 2yu7_A* | Back alignment and structure |
|---|
| >2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3ps5_A Tyrosine-protein phosphatase non-receptor type 6; SH2, PTP, hydrolase, signaling protein; 3.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 | Back alignment and structure |
|---|
| >1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A | Back alignment and structure |
|---|
| >3qwy_A Cell death abnormality protein 2; cell engulfment, signaling protein; 2.52A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B | Back alignment and structure |
|---|
| >2lqn_A CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT10 oncogene homolog (avian)- signaling protein; NMR {Homo sapiens} PDB: 2lqw_A* | Back alignment and structure |
|---|
| >3ps5_A Tyrosine-protein phosphatase non-receptor type 6; SH2, PTP, hydrolase, signaling protein; 3.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2shp_A SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin signaling, SH2 protein; HET: CAT; 2.00A {Homo sapiens} SCOP: c.45.1.2 d.93.1.1 d.93.1.1 | Back alignment and structure |
|---|
| >3cbl_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; V-FES, fujinami, avian sarcoma, viral, feline virus, SGC; HET: STU; 1.75A {Homo sapiens} PDB: 3bkb_A* 3cd3_A* 4e93_A* | Back alignment and structure |
|---|
| >2cr4_A 3BP-2, SH3 domain-binding protein 2; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2shp_A SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin signaling, SH2 protein; HET: CAT; 2.00A {Homo sapiens} SCOP: c.45.1.2 d.93.1.1 d.93.1.1 | Back alignment and structure |
|---|
| >2b3o_A Tyrosine-protein phosphatase, non-receptor type 6; protein tyrosine phosphatase, SHP-1, signaling, hydrolase; 2.80A {Homo sapiens} PDB: 1x6c_A 2rmx_A* 2yu7_A* | Back alignment and structure |
|---|
| >3cxl_A N-chimerin; SH2, RHO-GAP, structural genomics consortium, SGC, gtpas activation, metal-binding, phorbol-ester binding, SH2 domai finger; 2.60A {Homo sapiens} PDB: 1xa6_A | Back alignment and structure |
|---|
| >3hhm_B NISH2 P85alpha; PI3KCA, PI3K, PIK3R1, phosphatidilynositol 3,4,5- triphosphate, wortmannin, H1047R, ATP-binding, disease mutation, kinase; HET: KWT; 2.80A {Homo sapiens} PDB: 3hiz_B 2rd0_B 4a55_B* 3mtt_A | Back alignment and structure |
|---|
| >1gri_A Growth factor bound protein 2; SH2, SH3, signal transduction adaptor; 3.10A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 d.93.1.1 PDB: 1aze_A 2a37_A 2azv_A 2a36_A 2azs_A | Back alignment and structure |
|---|
| >2xzm_N RPS29E; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_N | Back alignment and structure |
|---|
| >2xp1_A SPT6; transcription, IWS1, histone chaperone, mRNA export; 2.20A {Antonospora locustae} | Back alignment and structure |
|---|
| >3j20_P 30S ribosomal protein S14P type Z; archaea, archaeal, KINK-turn, protein synthe ribosome; 6.60A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >3iz6_N 40S ribosomal protein S29 (S14P); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} PDB: 2zkq_n | Back alignment and structure |
|---|
| >3u5c_d S36, YS29, 40S ribosomal protein S29-A; translation, ribosome, ribosomal, ribosomal R ribosomal protein, eukaryotic ribosome, RNA-protein C; 3.00A {Saccharomyces cerevisiae} PDB: 3izb_N 3o30_S 3o2z_S 3u5g_d 3jyv_N* 1s1h_N | Back alignment and structure |
|---|
| >1uur_A Stata protein, STAT protein; transcription activator, SH2, signal transduction, transducer, transcription factor; HET: PTR; 2.7A {Dictyostelium discoideum} SCOP: a.47.1.1 b.2.5.5 d.93.1.1 PDB: 1uus_A* | Back alignment and structure |
|---|
| >1y1u_A Signal transducer and activator of transcription; STAT, DNA-binding, SH2 domain, transcription REGU signaling protein; 3.21A {Mus musculus} | Back alignment and structure |
|---|
| >1yvl_A Signal transducer and activator of transcription 1-alpha/beta; signaling protein; HET: PTR; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2xp1_A SPT6; transcription, IWS1, histone chaperone, mRNA export; 2.20A {Antonospora locustae} | Back alignment and structure |
|---|
| >1bg1_A Protein (transcription factor STAT3B); protein-DNA complex, cytokine activation, complex (transcription factor/DNA), transcription/DNA complex; HET: DNA PTR; 2.25A {Mus musculus} SCOP: a.47.1.1 b.2.5.5 d.93.1.1 PDB: 3cwg_A | Back alignment and structure |
|---|
| >1bf5_A Signal transducer and activator of transcription 1-alpha/beta; complex (SH2 domain/DNA), SH2 domain, transcription factor; HET: DNA PTR; 2.90A {Homo sapiens} SCOP: a.47.1.1 b.2.5.5 d.93.1.1 | Back alignment and structure |
|---|
| >3bux_B E3 ubiquitin-protein ligase CBL; TKB, signal transduction, proto-oncogene, complex, ATP-binding, glycoprotein, kinase, membrane, nucleotide-binding; HET: PTR; 1.35A {Homo sapiens} SCOP: a.39.1.7 a.48.1.1 d.93.1.1 PDB: 1yvh_A* 3bun_B* 3buo_B* 3bum_B* 3buw_B* 3ob1_B* 3ob2_B* 3plf_B* 2cbl_A* 1b47_A 3pfv_A* | Back alignment and structure |
|---|
| >3op0_A Signal transduction protein CBL-C; structural genomics, structural genomics consortium, SGC, SI transduction protein, SH3-binding protein; HET: PTR; 2.52A {Homo sapiens} | Back alignment and structure |
|---|
| >3psi_A Transcription elongation factor SPT6; nucleus; 3.30A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 128 | ||||
| d2qaln1 | 100 | g.39.1.7 (N:1-100) Ribosomal protein S14 {Escheric | 1e-14 | |
| d2uubn1 | 60 | g.39.1.7 (N:2-61) Ribosomal protein S14 {Thermus t | 2e-13 | |
| d1qada_ | 107 | d.93.1.1 (A:) Phosphatidylinositol 3-kinase, p85-a | 1e-08 | |
| d2eyva1 | 109 | d.93.1.1 (A:12-120) Crk proto-oncogen {Human (Homo | 4e-08 | |
| d2cs0a1 | 106 | d.93.1.1 (A:8-113) Hematopoietic SH2 domain contai | 1e-07 | |
| d1fu6a_ | 111 | d.93.1.1 (A:) Phosphatidylinositol 3-kinase, p85-a | 2e-07 | |
| d1bg1a3 | 141 | d.93.1.1 (A:576-716) STAT3b {Mouse (Mus musculus) | 2e-07 | |
| d2izva2 | 112 | d.93.1.1 (A:274-385) Suppressor of cytokine signal | 3e-07 | |
| d1nrva_ | 105 | d.93.1.1 (A:) Growth factor receptor-bound protein | 3e-07 | |
| d1r1qa_ | 97 | d.93.1.1 (A:) GRB2-related adaptor protein 2 (MONA | 3e-07 | |
| d1jwoa_ | 97 | d.93.1.1 (A:) Csk homologous kinase Chk {Human (Ho | 5e-07 | |
| d2oq1a2 | 124 | d.93.1.1 (A:135-258) Tyrosine-protein kinase zap-7 | 6e-07 | |
| d2c9wa2 | 103 | d.93.1.1 (A:32-134) Suppressor of cytokine signali | 6e-07 | |
| d2shpa2 | 109 | d.93.1.1 (A:2-110) Tyrosine phoshatase shp-2 {Huma | 9e-07 | |
| d1rpya_ | 86 | d.93.1.1 (A:) Adaptor protein Aps {Rat (Rattus nor | 2e-06 | |
| d1xa6a2 | 141 | d.93.1.1 (A:21-161) Beta-chimaerin, N-terminal dom | 3e-06 | |
| d1k9aa2 | 101 | d.93.1.1 (A:77-177) Carboxyl-terminal src kinase ( | 3e-06 | |
| d1opka2 | 101 | d.93.1.1 (A:140-240) Abl tyrosine kinase {Mouse (M | 3e-06 | |
| d1i3za_ | 103 | d.93.1.1 (A:) Ews/fli1 activated transcript 2, Eat | 3e-06 | |
| d1d4ta_ | 104 | d.93.1.1 (A:) The Xlp protein Sap {Human (Homo sap | 3e-06 | |
| d1jyra_ | 96 | d.93.1.1 (A:) Growth factor receptor-bound protein | 4e-06 | |
| d1a81a2 | 125 | d.93.1.1 (A:138-262) Syk tyrosine kinase {Human (H | 4e-06 | |
| d1luia_ | 108 | d.93.1.1 (A:) Itk/tsk protein tyrosine kinase {Mou | 5e-06 | |
| d2qmsa1 | 113 | d.93.1.1 (A:420-532) Growth factor receptor-bound | 1e-05 | |
| d2fcia1 | 105 | d.93.1.1 (A:1-105) Phospholipase C-gamma-1 {Cow (B | 1e-05 | |
| d2shpa3 | 108 | d.93.1.1 (A:111-218) Tyrosine phoshatase shp-2 {Hu | 4e-05 | |
| d2oq1a1 | 130 | d.93.1.1 (A:5-134) Tyrosine-protein kinase zap-70 | 1e-04 | |
| d1uura3 | 131 | d.93.1.1 (A:577-707) STAT homologue {Dictyostelium | 2e-04 | |
| d1lkka_ | 105 | d.93.1.1 (A:) p56-lck tyrosine kinase {Human (Homo | 2e-04 | |
| d1g83a2 | 104 | d.93.1.1 (A:142-245) Tyrosine kinase Fyn {Human (H | 7e-04 | |
| d1blja_ | 114 | d.93.1.1 (A:) P55 Blk protein tyrosine kinase {Mou | 0.001 | |
| d1mila_ | 104 | d.93.1.1 (A:) Shc adaptor protein {Human (Homo sap | 0.001 | |
| d1a81a1 | 129 | d.93.1.1 (A:9-137) Syk tyrosine kinase {Human (Hom | 0.001 | |
| d1qcfa2 | 103 | d.93.1.1 (A:146-248) Hemopoetic cell kinase Hck {H | 0.002 | |
| d1o48a_ | 106 | d.93.1.1 (A:) c-src tyrosine kinase {Human (Homo s | 0.002 |
| >d2qaln1 g.39.1.7 (N:1-100) Ribosomal protein S14 {Escherichia coli [TaxId: 562]} Length = 100 | Back information, alignment and structure |
|---|
class: Small proteins fold: Glucocorticoid receptor-like (DNA-binding domain) superfamily: Glucocorticoid receptor-like (DNA-binding domain) family: Ribosomal protein S14 domain: Ribosomal protein S14 species: Escherichia coli [TaxId: 562]
Score = 62.9 bits (153), Expect = 1e-14
Identities = 22/62 (35%), Positives = 32/62 (51%)
Query: 67 EVMAAREDATNHPRDSHPCRTQPRCVITSRPRGVVLRWRLSRIMFRHLADYNKLSGVQRA 126
+ A PRDS P R + RC T RP G + ++ LSRI R A ++ G+++A
Sbjct: 39 DRWNAVLKLQTLPRDSSPSRQRNRCRQTGRPHGFLRKFGLSRIKVREAAMRGEIPGLKKA 98
Query: 127 MW 128
W
Sbjct: 99 SW 100
|
| >d2uubn1 g.39.1.7 (N:2-61) Ribosomal protein S14 {Thermus thermophilus [TaxId: 274]} Length = 60 | Back information, alignment and structure |
|---|
| >d1qada_ d.93.1.1 (A:) Phosphatidylinositol 3-kinase, p85-alpha subunit {Cow (Bos taurus) [TaxId: 9913]} Length = 107 | Back information, alignment and structure |
|---|
| >d2eyva1 d.93.1.1 (A:12-120) Crk proto-oncogen {Human (Homo sapiens) [TaxId: 9606]} Length = 109 | Back information, alignment and structure |
|---|
| >d2cs0a1 d.93.1.1 (A:8-113) Hematopoietic SH2 domain containing protein HSH2D {Human (Homo sapiens) [TaxId: 9606]} Length = 106 | Back information, alignment and structure |
|---|
| >d1fu6a_ d.93.1.1 (A:) Phosphatidylinositol 3-kinase, p85-alpha subunit {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 111 | Back information, alignment and structure |
|---|
| >d1bg1a3 d.93.1.1 (A:576-716) STAT3b {Mouse (Mus musculus) [TaxId: 10090]} Length = 141 | Back information, alignment and structure |
|---|
| >d2izva2 d.93.1.1 (A:274-385) Suppressor of cytokine signaling 4, SOCS-4 {Human (Homo sapiens) [TaxId: 9606]} Length = 112 | Back information, alignment and structure |
|---|
| >d1nrva_ d.93.1.1 (A:) Growth factor receptor-bound protein 10, GRB10 {Human (Homo sapiens) [TaxId: 9606]} Length = 105 | Back information, alignment and structure |
|---|
| >d1r1qa_ d.93.1.1 (A:) GRB2-related adaptor protein 2 (MONA, GRID) {Mouse (Mus musculus) [TaxId: 10090]} Length = 97 | Back information, alignment and structure |
|---|
| >d1jwoa_ d.93.1.1 (A:) Csk homologous kinase Chk {Human (Homo sapiens) [TaxId: 9606]} Length = 97 | Back information, alignment and structure |
|---|
| >d2oq1a2 d.93.1.1 (A:135-258) Tyrosine-protein kinase zap-70 {Human (Homo sapiens) [TaxId: 9606]} Length = 124 | Back information, alignment and structure |
|---|
| >d2c9wa2 d.93.1.1 (A:32-134) Suppressor of cytokine signaling 2, SOCS-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 | Back information, alignment and structure |
|---|
| >d2shpa2 d.93.1.1 (A:2-110) Tyrosine phoshatase shp-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 109 | Back information, alignment and structure |
|---|
| >d1rpya_ d.93.1.1 (A:) Adaptor protein Aps {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 86 | Back information, alignment and structure |
|---|
| >d1xa6a2 d.93.1.1 (A:21-161) Beta-chimaerin, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 141 | Back information, alignment and structure |
|---|
| >d1k9aa2 d.93.1.1 (A:77-177) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Length = 101 | Back information, alignment and structure |
|---|
| >d1opka2 d.93.1.1 (A:140-240) Abl tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Length = 101 | Back information, alignment and structure |
|---|
| >d1i3za_ d.93.1.1 (A:) Ews/fli1 activated transcript 2, Eat2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 103 | Back information, alignment and structure |
|---|
| >d1d4ta_ d.93.1.1 (A:) The Xlp protein Sap {Human (Homo sapiens) [TaxId: 9606]} Length = 104 | Back information, alignment and structure |
|---|
| >d1jyra_ d.93.1.1 (A:) Growth factor receptor-bound protein 2 (GRB2) {Human (Homo sapiens) [TaxId: 9606]} Length = 96 | Back information, alignment and structure |
|---|
| >d1a81a2 d.93.1.1 (A:138-262) Syk tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 125 | Back information, alignment and structure |
|---|
| >d1luia_ d.93.1.1 (A:) Itk/tsk protein tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Length = 108 | Back information, alignment and structure |
|---|
| >d2qmsa1 d.93.1.1 (A:420-532) Growth factor receptor-bound protein 7 {Human (Homo sapiens) [TaxId: 9606]} Length = 113 | Back information, alignment and structure |
|---|
| >d2fcia1 d.93.1.1 (A:1-105) Phospholipase C-gamma-1 {Cow (Bos taurus) [TaxId: 9913]} Length = 105 | Back information, alignment and structure |
|---|
| >d2shpa3 d.93.1.1 (A:111-218) Tyrosine phoshatase shp-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 108 | Back information, alignment and structure |
|---|
| >d2oq1a1 d.93.1.1 (A:5-134) Tyrosine-protein kinase zap-70 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 | Back information, alignment and structure |
|---|
| >d1uura3 d.93.1.1 (A:577-707) STAT homologue {Dictyostelium discoideum [TaxId: 44689]} Length = 131 | Back information, alignment and structure |
|---|
| >d1lkka_ d.93.1.1 (A:) p56-lck tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 105 | Back information, alignment and structure |
|---|
| >d1g83a2 d.93.1.1 (A:142-245) Tyrosine kinase Fyn {Human (Homo sapiens) [TaxId: 9606]} Length = 104 | Back information, alignment and structure |
|---|
| >d1blja_ d.93.1.1 (A:) P55 Blk protein tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Length = 114 | Back information, alignment and structure |
|---|
| >d1mila_ d.93.1.1 (A:) Shc adaptor protein {Human (Homo sapiens) [TaxId: 9606]} Length = 104 | Back information, alignment and structure |
|---|
| >d1a81a1 d.93.1.1 (A:9-137) Syk tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 129 | Back information, alignment and structure |
|---|
| >d1qcfa2 d.93.1.1 (A:146-248) Hemopoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]} Length = 103 | Back information, alignment and structure |
|---|
| >d1o48a_ d.93.1.1 (A:) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 106 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 128 | |||
| d2qaln1 | 100 | Ribosomal protein S14 {Escherichia coli [TaxId: 56 | 99.97 | |
| d1k9aa2 | 101 | Carboxyl-terminal src kinase (csk) {Human (Homo sa | 99.91 | |
| d1jwoa_ | 97 | Csk homologous kinase Chk {Human (Homo sapiens) [T | 99.9 | |
| d2uubn1 | 60 | Ribosomal protein S14 {Thermus thermophilus [TaxId | 99.9 | |
| d1i3za_ | 103 | Ews/fli1 activated transcript 2, Eat2 {Mouse (Mus | 99.89 | |
| d1a81a1 | 129 | Syk tyrosine kinase {Human (Homo sapiens) [TaxId: | 99.88 | |
| d2oq1a2 | 124 | Tyrosine-protein kinase zap-70 {Human (Homo sapien | 99.87 | |
| d1nrva_ | 105 | Growth factor receptor-bound protein 10, GRB10 {Hu | 99.87 | |
| d1a81a2 | 125 | Syk tyrosine kinase {Human (Homo sapiens) [TaxId: | 99.87 | |
| d2oq1a1 | 130 | Tyrosine-protein kinase zap-70 {Human (Homo sapien | 99.87 | |
| d1opka2 | 101 | Abl tyrosine kinase {Mouse (Mus musculus) [TaxId: | 99.86 | |
| d1rjaa_ | 100 | Tyrosine-protein kinase 6 (Breast tumor kinase, Br | 99.86 | |
| d1d4ta_ | 104 | The Xlp protein Sap {Human (Homo sapiens) [TaxId: | 99.86 | |
| d1qcfa2 | 103 | Hemopoetic cell kinase Hck {Human (Homo sapiens) [ | 99.85 | |
| d2qmsa1 | 113 | Growth factor receptor-bound protein 7 {Human (Hom | 99.85 | |
| d2fcia1 | 105 | Phospholipase C-gamma-1 {Cow (Bos taurus) [TaxId: | 99.84 | |
| d1lkka_ | 105 | p56-lck tyrosine kinase {Human (Homo sapiens) [Tax | 99.84 | |
| d1jyra_ | 96 | Growth factor receptor-bound protein 2 (GRB2) {Hum | 99.83 | |
| d2shpa2 | 109 | Tyrosine phoshatase shp-2 {Human (Homo sapiens) [T | 99.83 | |
| d1luia_ | 108 | Itk/tsk protein tyrosine kinase {Mouse (Mus muscul | 99.83 | |
| d1blja_ | 114 | P55 Blk protein tyrosine kinase {Mouse (Mus muscul | 99.82 | |
| d1o48a_ | 106 | c-src tyrosine kinase {Human (Homo sapiens) [TaxId | 99.81 | |
| d1g83a2 | 104 | Tyrosine kinase Fyn {Human (Homo sapiens) [TaxId: | 99.8 | |
| d1mila_ | 104 | Shc adaptor protein {Human (Homo sapiens) [TaxId: | 99.79 | |
| d2izva2 | 112 | Suppressor of cytokine signaling 4, SOCS-4 {Human | 99.78 | |
| d2eyva1 | 109 | Crk proto-oncogen {Human (Homo sapiens) [TaxId: 96 | 99.78 | |
| d1qada_ | 107 | Phosphatidylinositol 3-kinase, p85-alpha subunit { | 99.77 | |
| d1fu6a_ | 111 | Phosphatidylinositol 3-kinase, p85-alpha subunit { | 99.76 | |
| d1r1qa_ | 97 | GRB2-related adaptor protein 2 (MONA, GRID) {Mouse | 99.75 | |
| d1rpya_ | 86 | Adaptor protein Aps {Rat (Rattus norvegicus) [TaxI | 99.75 | |
| d2shpa3 | 108 | Tyrosine phoshatase shp-2 {Human (Homo sapiens) [T | 99.74 | |
| d2cs0a1 | 106 | Hematopoietic SH2 domain containing protein HSH2D | 99.73 | |
| d2c9wa2 | 103 | Suppressor of cytokine signaling 2, SOCS-2 {Human | 99.72 | |
| d1xa6a2 | 141 | Beta-chimaerin, N-terminal domain {Human (Homo sap | 99.68 | |
| d1uura3 | 131 | STAT homologue {Dictyostelium discoideum [TaxId: 4 | 99.44 | |
| d1bg1a3 | 141 | STAT3b {Mouse (Mus musculus) [TaxId: 10090]} | 99.01 | |
| d1bf5a3 | 142 | STAT-1 {Human (Homo sapiens) [TaxId: 9606]} | 97.11 |
| >d2qaln1 g.39.1.7 (N:1-100) Ribosomal protein S14 {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
class: Small proteins fold: Glucocorticoid receptor-like (DNA-binding domain) superfamily: Glucocorticoid receptor-like (DNA-binding domain) family: Ribosomal protein S14 domain: Ribosomal protein S14 species: Escherichia coli [TaxId: 562]
Probab=99.97 E-value=9.4e-32 Score=175.19 Aligned_cols=84 Identities=31% Similarity=0.477 Sum_probs=74.0
Q ss_pred eeEEeeeeecccccccccCCCHHHH-HHHHHhhcCCCCCCCcccCCcccccCCCCccccccCCCHHHHHHhhccCCCCce
Q psy9697 45 AYNIFIRKRDDNKIGLGTFKPNEVM-AAREDATNHPRDSHPCRTQPRCVITSRPRGVVLRWRLSRIMFRHLADYNKLSGV 123 (128)
Q Consensus 45 v~hy~I~~~~~k~i~~n~~L~~~~r-~~~~~l~~l~~~~~~~rl~nrC~~tgr~~g~~~~~~l~R~~fr~~~~~G~~~gv 123 (128)
|..|..++..+++++.|.++|.+++ ....+|+++|+|++||+++|||+.||||+||+++|+|||++||++|+.|+||||
T Consensus 16 ~~ky~~kR~~Lk~i~~n~~l~~e~r~~a~~kL~~LPrnss~tRirnRC~~TGR~Rg~~r~f~lsRi~fR~la~~G~lpGv 95 (100)
T d2qaln1 16 ADKYFAKRAELKAIISDVNASDEDRWNAVLKLQTLPRDSSPSRQRNRCRQTGRPHGFLRKFGLSRIKVREAAMRGEIPGL 95 (100)
T ss_dssp HHHTGGGTGGGTTTTTSSCC----CCHHHHHHTTTTSTTCSTTCCCCCSSSCCSSSCBTTTTBCHHHHHHHHHHTCSTTC
T ss_pred HHHHHHHHHHHHHHHhCCCCCHHHHHHHHHHHhcCCccchhHHHHhhhccCCCcceeeccccchHHHHHHHHHcCCCCCe
Confidence 4557788889999999999999999 444449999999999999999999999999999999999999999999999999
Q ss_pred EeccC
Q psy9697 124 QRAMW 128 (128)
Q Consensus 124 ~k~~W 128 (128)
+||||
T Consensus 96 ~KaSW 100 (100)
T d2qaln1 96 KKASW 100 (100)
T ss_dssp EECCC
T ss_pred eccCC
Confidence 99999
|
| >d1k9aa2 d.93.1.1 (A:77-177) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jwoa_ d.93.1.1 (A:) Csk homologous kinase Chk {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2uubn1 g.39.1.7 (N:2-61) Ribosomal protein S14 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1i3za_ d.93.1.1 (A:) Ews/fli1 activated transcript 2, Eat2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1a81a1 d.93.1.1 (A:9-137) Syk tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2oq1a2 d.93.1.1 (A:135-258) Tyrosine-protein kinase zap-70 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nrva_ d.93.1.1 (A:) Growth factor receptor-bound protein 10, GRB10 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a81a2 d.93.1.1 (A:138-262) Syk tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2oq1a1 d.93.1.1 (A:5-134) Tyrosine-protein kinase zap-70 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1opka2 d.93.1.1 (A:140-240) Abl tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1rjaa_ d.93.1.1 (A:) Tyrosine-protein kinase 6 (Breast tumor kinase, Brk) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1d4ta_ d.93.1.1 (A:) The Xlp protein Sap {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qcfa2 d.93.1.1 (A:146-248) Hemopoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2qmsa1 d.93.1.1 (A:420-532) Growth factor receptor-bound protein 7 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fcia1 d.93.1.1 (A:1-105) Phospholipase C-gamma-1 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1lkka_ d.93.1.1 (A:) p56-lck tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jyra_ d.93.1.1 (A:) Growth factor receptor-bound protein 2 (GRB2) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2shpa2 d.93.1.1 (A:2-110) Tyrosine phoshatase shp-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1luia_ d.93.1.1 (A:) Itk/tsk protein tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1blja_ d.93.1.1 (A:) P55 Blk protein tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1o48a_ d.93.1.1 (A:) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g83a2 d.93.1.1 (A:142-245) Tyrosine kinase Fyn {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mila_ d.93.1.1 (A:) Shc adaptor protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2izva2 d.93.1.1 (A:274-385) Suppressor of cytokine signaling 4, SOCS-4 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2eyva1 d.93.1.1 (A:12-120) Crk proto-oncogen {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qada_ d.93.1.1 (A:) Phosphatidylinositol 3-kinase, p85-alpha subunit {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1fu6a_ d.93.1.1 (A:) Phosphatidylinositol 3-kinase, p85-alpha subunit {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1r1qa_ d.93.1.1 (A:) GRB2-related adaptor protein 2 (MONA, GRID) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1rpya_ d.93.1.1 (A:) Adaptor protein Aps {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2shpa3 d.93.1.1 (A:111-218) Tyrosine phoshatase shp-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cs0a1 d.93.1.1 (A:8-113) Hematopoietic SH2 domain containing protein HSH2D {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2c9wa2 d.93.1.1 (A:32-134) Suppressor of cytokine signaling 2, SOCS-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xa6a2 d.93.1.1 (A:21-161) Beta-chimaerin, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uura3 d.93.1.1 (A:577-707) STAT homologue {Dictyostelium discoideum [TaxId: 44689]} | Back information, alignment and structure |
|---|
| >d1bg1a3 d.93.1.1 (A:576-716) STAT3b {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1bf5a3 d.93.1.1 (A:569-710) STAT-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|