Diaphorina citri psyllid: psy9706


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------4
MRRRHTLEEELKDLREENKKLKEESQNALQQLRRFTEWT
ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc
********************************RRFT***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRRxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxFTEWT

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Signal-induced proliferation-associated 1-like protein 2 confidentQ80TE4
Signal-induced proliferation-associated 1-like protein 2 confidentQ9P2F8

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0043234 [CC]protein complexprobableGO:0005575, GO:0032991
GO:0061001 [BP]regulation of dendritic spine morphogenesisprobableGO:0022604, GO:0044707, GO:0010975, GO:0022603, GO:0030154, GO:0051128, GO:0050789, GO:0044699, GO:0050767, GO:0048869, GO:0060284, GO:0031344, GO:0045664, GO:0060998, GO:0010769, GO:0065007, GO:0032502, GO:0032501, GO:0050793, GO:0009987, GO:0050794, GO:0045595, GO:0008150, GO:0051239, GO:0022008, GO:0048699, GO:0007399, GO:0050773, GO:0048856, GO:0044763, GO:0051960, GO:2000026, GO:0048814, GO:0007275, GO:0048731
GO:0043025 [CC]neuronal cell bodyprobableGO:0005575, GO:0097458, GO:0044297, GO:0005623, GO:0044464
GO:0051015 [MF]actin filament bindingprobableGO:0003779, GO:0003674, GO:0005488, GO:0005515, GO:0008092
GO:0014069 [CC]postsynaptic densityprobableGO:0030425, GO:0043229, GO:0043228, GO:0044430, GO:0044327, GO:0043226, GO:0005856, GO:0044446, GO:0044309, GO:0097458, GO:0044456, GO:0043005, GO:0042995, GO:0043197, GO:0043232, GO:0044463, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424, GO:0044422, GO:0045202
GO:0050770 [BP]regulation of axonogenesisprobableGO:0022604, GO:0010975, GO:0022603, GO:0030154, GO:0051128, GO:0050789, GO:0044699, GO:0050767, GO:0048869, GO:0060284, GO:0031344, GO:0045664, GO:0010769, GO:0065007, GO:0032502, GO:0032501, GO:0050793, GO:0009987, GO:0050794, GO:0045595, GO:0008150, GO:0051239, GO:0022008, GO:0048699, GO:0044707, GO:0007399, GO:0048856, GO:0044763, GO:0051960, GO:2000026, GO:0007275, GO:0048731
GO:0032861 [BP]activation of Rap GTPase activityprobableGO:0009894, GO:0019220, GO:0080090, GO:0019222, GO:0046578, GO:0023051, GO:0010646, GO:0043087, GO:0050789, GO:0043085, GO:0032318, GO:0043547, GO:0051345, GO:0009966, GO:0031323, GO:0032317, GO:0030811, GO:0008150, GO:0065007, GO:0044093, GO:0065009, GO:0051056, GO:0033121, GO:0033124, GO:0019219, GO:0048583, GO:0050790, GO:0050794, GO:0032854, GO:0032856, GO:0032487, GO:0051171, GO:0009118, GO:0051336, GO:0051174, GO:1900542, GO:0032320, GO:0031329, GO:0006140
GO:0031532 [BP]actin cytoskeleton reorganizationprobableGO:0006996, GO:0007010, GO:0030029, GO:0071840, GO:0009987, GO:0030036, GO:0044763, GO:0016043, GO:0008150, GO:0044699

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2W6B, chain A
Confidence level:confident
Coverage over the Query: 6-34
View the alignment between query and template
View the model in PyMOL