Psyllid ID: psy9706

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------4
MRRRHTLEEELKDLREENKKLKEESQNALQQLRRFTEWT
ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc
ccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc
MRRRHTLEEELKDLREENKKLKEESQNALQQLRRFTEWT
mrrrhtleeelkdlreenkklkeesqnalqqlrrftewt
MRRRHTLEEELKDLREENKKLKEESQNALQQLRRFTEWT
***************************************
********************************RRFT***
********EELKDLREENKKLKEESQNALQQLRRFTEWT
*******EEELKDLREENKKLKEESQNALQQLRRFT*WT
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooo
iiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRRxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxFTEWT
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query39 2.2.26 [Sep-21-2011]
Q80TE41722 Signal-induced proliferat yes N/A 0.897 0.020 0.514 0.0005
Q9P2F81722 Signal-induced proliferat yes N/A 0.897 0.020 0.514 0.0007
>sp|Q80TE4|SI1L2_MOUSE Signal-induced proliferation-associated 1-like protein 2 OS=Mus musculus GN=Sipa1l2 PE=1 SV=3 Back     alignment and function desciption
 Score = 43.1 bits (100), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 18/35 (51%), Positives = 27/35 (77%)

Query: 4    RHTLEEELKDLREENKKLKEESQNALQQLRRFTEW 38
            +  L+ E++ LR++N +L+EESQ A  QLR+FTEW
Sbjct: 1679 KAVLQAEVQHLRQDNMRLQEESQTATAQLRKFTEW 1713

Mus musculus (taxid: 10090)
>sp|Q9P2F8|SI1L2_HUMAN Signal-induced proliferation-associated 1-like protein 2 OS=Homo sapiens GN=SIPA1L2 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query39
91080517 1366 PREDICTED: similar to signal-induced pro 0.948 0.027 0.648 2e-05
242014376 1518 rap GTPase-activating protein, putative 0.948 0.024 0.675 2e-05
350409048 1567 PREDICTED: signal-induced proliferation- 0.948 0.023 0.621 0.0001
340713085 1594 PREDICTED: signal-induced proliferation- 0.948 0.023 0.621 0.0001
380011945 1514 PREDICTED: signal-induced proliferation- 0.948 0.024 0.621 0.0001
66506566 1571 PREDICTED: signal-induced proliferation- 0.948 0.023 0.621 0.0003
383861424 1531 PREDICTED: signal-induced proliferation- 0.948 0.024 0.567 0.0009
>gi|91080517|ref|XP_971794.1| PREDICTED: similar to signal-induced proliferation-associated protein 1 [Tribolium castaneum] gi|270005549|gb|EFA01997.1| hypothetical protein TcasGA2_TC007618 [Tribolium castaneum] Back     alignment and taxonomy information
 Score = 53.1 bits (126), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 24/37 (64%), Positives = 34/37 (91%)

Query: 2    RRRHTLEEELKDLREENKKLKEESQNALQQLRRFTEW 38
            RRR +LE E++ L+EENKKLK+++Q+A+QQLR+FTEW
Sbjct: 1322 RRRLSLENEVRRLKEENKKLKDQAQSAVQQLRKFTEW 1358

Source: Tribolium castaneum

Species: Tribolium castaneum

Genus: Tribolium

Family: Tenebrionidae

Order: Coleoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|242014376|ref|XP_002427867.1| rap GTPase-activating protein, putative [Pediculus humanus corporis] gi|212512336|gb|EEB15129.1| rap GTPase-activating protein, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|350409048|ref|XP_003488592.1| PREDICTED: signal-induced proliferation-associated 1-like protein 2-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|340713085|ref|XP_003395080.1| PREDICTED: signal-induced proliferation-associated 1-like protein 2-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|380011945|ref|XP_003690052.1| PREDICTED: signal-induced proliferation-associated 1-like protein 1-like [Apis florea] Back     alignment and taxonomy information
>gi|66506566|ref|XP_392312.2| PREDICTED: signal-induced proliferation-associated 1-like protein 2-like [Apis mellifera] Back     alignment and taxonomy information
>gi|383861424|ref|XP_003706186.1| PREDICTED: signal-induced proliferation-associated 1-like protein 2-like [Megachile rotundata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query39
UNIPROTKB|E1BQZ31786 SIPA1L1 "Uncharacterized prote 0.820 0.017 0.562 0.00035
UNIPROTKB|F5GYF81257 SIPA1L1 "Signal-induced prolif 0.820 0.025 0.562 0.00049
UNIPROTKB|F1LS651323 Sipa1l1 "Signal-induced prolif 0.820 0.024 0.562 0.00052
UNIPROTKB|J3KP191782 SIPA1L1 "Signal-induced prolif 0.820 0.017 0.562 0.00072
UNIPROTKB|F1S3L71782 SIPA1L1 "Uncharacterized prote 0.820 0.017 0.562 0.00072
MGI|MGI:24436791782 Sipa1l1 "signal-induced prolif 0.820 0.017 0.562 0.00072
UNIPROTKB|F6UT091785 SIPA1L1 "Uncharacterized prote 0.820 0.017 0.562 0.00072
UNIPROTKB|O431661804 SIPA1L1 "Signal-induced prolif 0.820 0.017 0.562 0.00073
UNIPROTKB|E2QS961806 SIPA1L1 "Uncharacterized prote 0.820 0.017 0.562 0.00073
UNIPROTKB|F1MXV41808 SIPA1L1 "Uncharacterized prote 0.820 0.017 0.562 0.00073
UNIPROTKB|E1BQZ3 SIPA1L1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
 Score = 104 (41.7 bits), Expect = 0.00035, P = 0.00035
 Identities = 18/32 (56%), Positives = 28/32 (87%)

Query:     7 LEEELKDLREENKKLKEESQNALQQLRRFTEW 38
             L+ E++ LRE+N +L+EESQNA ++L++FTEW
Sbjct:  1747 LQAEVQHLREDNLRLQEESQNATEKLKKFTEW 1778
GO:0005096 "GTPase activator activity" evidence=IEA
GO:0032317 "regulation of Rap GTPase activity" evidence=IEA
GO:0046875 "ephrin receptor binding" evidence=IEA
GO:0048013 "ephrin receptor signaling pathway" evidence=IEA
GO:0050770 "regulation of axonogenesis" evidence=IEA
UNIPROTKB|F5GYF8 SIPA1L1 "Signal-induced proliferation-associated 1-like protein 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1LS65 Sipa1l1 "Signal-induced proliferation-associated 1-like protein 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|J3KP19 SIPA1L1 "Signal-induced proliferation-associated 1-like protein 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1S3L7 SIPA1L1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:2443679 Sipa1l1 "signal-induced proliferation-associated 1 like 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F6UT09 SIPA1L1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|O43166 SIPA1L1 "Signal-induced proliferation-associated 1-like protein 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E2QS96 SIPA1L1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1MXV4 SIPA1L1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q80TE4SI1L2_MOUSENo assigned EC number0.51420.89740.0203yesN/A
Q9P2F8SI1L2_HUMANNo assigned EC number0.51420.89740.0203yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query39
pfam11382 307 pfam11382, DUF3186, Protein of unknown function (D 7e-04
>gnl|CDD|221101 pfam11382, DUF3186, Protein of unknown function (DUF3186) Back     alignment and domain information 
 Score = 33.9 bits (78), Expect = 7e-04
 Identities = 11/28 (39%), Positives = 16/28 (57%)

Query: 5  HTLEEELKDLREENKKLKEESQNALQQL 32
            LE+E  DLR EN +L+ E +   +Q 
Sbjct: 35 SGLEDEFSDLRTENDRLRAEREALNEQA 62

This bacterial family of proteins has no known function. Length = 307

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 39
PF10226 195 DUF2216: Uncharacterized conserved proteins (DUF22 93.89
PF1477560 NYD-SP28_assoc: Sperm tail C-terminal domain 92.69
PF06632 342 XRCC4: DNA double-strand break repair and V(D)J re 91.36
PF04880 166 NUDE_C: NUDE protein, C-terminal conserved region; 91.35
PRK10265101 chaperone-modulator protein CbpM; Provisional 91.2
PF0218345 HALZ: Homeobox associated leucine zipper; InterPro 88.18
smart0033865 BRLZ basic region leucin zipper. 87.67
PF0600572 DUF904: Protein of unknown function (DUF904); Inte 87.07
PF11382 308 DUF3186: Protein of unknown function (DUF3186); In 87.07
PF1088387 DUF2681: Protein of unknown function (DUF2681); In 86.4
PRK09413121 IS2 repressor TnpA; Reviewed 86.0
smart0034044 HALZ homeobox associated leucin zipper. 85.58
KOG4196|consensus135 85.32
PF09311 181 Rab5-bind: Rabaptin-like protein; InterPro: IPR015 85.18
PF0497780 DivIC: Septum formation initiator; InterPro: IPR00 84.91
COG307479 Uncharacterized protein conserved in bacteria [Fun 84.51
PF14645116 Chibby: Chibby family 83.89
PF1407748 WD40_alt: Alternative WD40 repeat motif 83.8
PF04880 166 NUDE_C: NUDE protein, C-terminal conserved region; 83.2
PRK14127109 cell division protein GpsB; Provisional 82.41
PF13942179 Lipoprotein_20: YfhG lipoprotein 82.28
PRK00888105 ftsB cell division protein FtsB; Reviewed 82.17
PRK00888105 ftsB cell division protein FtsB; Reviewed 82.09
PRK10722247 hypothetical protein; Provisional 81.62
PRK13922 276 rod shape-determining protein MreC; Provisional 81.16
PRK10884206 SH3 domain-containing protein; Provisional 80.15
>PF10226 DUF2216: Uncharacterized conserved proteins (DUF2216); InterPro: IPR019359 Proteins in this entry are found in Metazoa and contain a coiled-coil domain Back     alignment and domain information 
Probab=93.89  E-value=0.095  Score=35.03  Aligned_cols=22  Identities=36%  Similarity=0.585  Sum_probs=18.9

Q ss_pred             hHHHHHHHHHHHhHHHHHHHHH
Q psy9706           6 TLEEELKDLREENKKLKEESQN   27 (39)
Q Consensus         6 ~Lq~Ev~~LRe~N~RLqeESqs   27 (39)
                      ..-.||+.|++.|+|||++.+.
T Consensus        52 ~hl~EIR~LKe~NqkLqedNqE   73 (195)
T PF10226_consen   52 QHLNEIRGLKEVNQKLQEDNQE   73 (195)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHH
Confidence            4457999999999999999864

Some annotation suggests it might be PKR, the Hepatitis delta antigen-interacting protein A, but this could not be confirmed.
>PF14775 NYD-SP28_assoc: Sperm tail C-terminal domain Back     alignment and domain information
>PF06632 XRCC4: DNA double-strand break repair and V(D)J recombination protein XRCC4; InterPro: IPR010585 This entry represents the DNA double-strand break repair and V(D)J recombination protein XRCC4, which is found in certain Metazoans, fungi and plants Back     alignment and domain information
>PF04880 NUDE_C: NUDE protein, C-terminal conserved region; InterPro: IPR006964 This domain represents the C-terminal conserved region of NUDE proteins Back     alignment and domain information
>PRK10265 chaperone-modulator protein CbpM; Provisional Back     alignment and domain information
>PF02183 HALZ: Homeobox associated leucine zipper; InterPro: IPR003106 This region is a plant specific leucine zipper that is always found associated with a homeobox [] Back     alignment and domain information
>smart00338 BRLZ basic region leucin zipper Back     alignment and domain information
>PF06005 DUF904: Protein of unknown function (DUF904); InterPro: IPR009252 Cell division protein ZapB is a non-essential, abundant cell division factor that is required for proper Z-ring formation Back     alignment and domain information
>PF11382 DUF3186: Protein of unknown function (DUF3186); InterPro: IPR021522 This bacterial family of proteins has no known function Back     alignment and domain information
>PF10883 DUF2681: Protein of unknown function (DUF2681); InterPro: IPR020274 This entry contains membrane proteins with no known function Back     alignment and domain information
>PRK09413 IS2 repressor TnpA; Reviewed Back     alignment and domain information
>smart00340 HALZ homeobox associated leucin zipper Back     alignment and domain information
>KOG4196|consensus Back     alignment and domain information
>PF09311 Rab5-bind: Rabaptin-like protein; InterPro: IPR015390 This domain is predominantly found in Rabaptin and allows for binding to the GTPase Rab5 Back     alignment and domain information
>PF04977 DivIC: Septum formation initiator; InterPro: IPR007060 DivIC, from the spore-forming, Gram-positive bacterium Bacillus subtilis, is necessary for both vegetative and sporulation septum formation [] Back     alignment and domain information
>COG3074 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF14645 Chibby: Chibby family Back     alignment and domain information
>PF14077 WD40_alt: Alternative WD40 repeat motif Back     alignment and domain information
>PF04880 NUDE_C: NUDE protein, C-terminal conserved region; InterPro: IPR006964 This domain represents the C-terminal conserved region of NUDE proteins Back     alignment and domain information
>PRK14127 cell division protein GpsB; Provisional Back     alignment and domain information
>PF13942 Lipoprotein_20: YfhG lipoprotein Back     alignment and domain information
>PRK00888 ftsB cell division protein FtsB; Reviewed Back     alignment and domain information
>PRK00888 ftsB cell division protein FtsB; Reviewed Back     alignment and domain information
>PRK10722 hypothetical protein; Provisional Back     alignment and domain information
>PRK13922 rod shape-determining protein MreC; Provisional Back     alignment and domain information
>PRK10884 SH3 domain-containing protein; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query39
3w03_C184 DNA repair protein XRCC4; coiled-coil, NHEJ, DSBS 95.83
3s9g_A104 Protein hexim1; cyclin T-binding domain (TBD), cyc 95.19
1ik9_A213 DNA repair protein XRCC4; DNA END joining, double- 92.85
2wt7_A63 Proto-oncogene protein C-FOS; transcription, trans 91.54
3i00_A120 HIP-I, huntingtin-interacting protein 1; transcrip 90.84
2w6b_A56 RHO guanine nucleotide exchange factor 7; X-RAY cr 90.45
3q4f_C186 DNA repair protein XRCC4; DSB repair, nuclear, rec 89.83
1t6f_A37 Geminin; coiled-coil, cell cycle; 1.47A {Synthetic 89.28
1dh3_A55 Transcription factor CREB; protein-DNA complex, tr 88.77
1gu4_A78 CAAT/enhancer binding protein beta; transcription/ 88.13
2aze_B106 Transcription factor E2F1; coiled coil, beta sandw 88.07
1deb_A54 APC protein, adenomatous polyposis coli protein; c 87.23
3l4f_A61 RHO guanine nucleotide exchange factor 7; coiled-c 87.04
1hjb_A87 Ccaat/enhancer binding protein beta; transcription 86.73
2dgc_A63 Protein (GCN4); basic domain, leucine zipper, DNA 85.03
2yy0_A53 C-MYC-binding protein; conserved hypothetical prot 84.78
1am9_A82 Srebp-1A, protein (sterol regulatory element bindi 83.54
1t2k_D61 Cyclic-AMP-dependent transcription factor ATF-2; p 82.5
3m91_A51 Proteasome-associated ATPase; coil COIL alpha heli 82.06
1jnm_A62 Proto-oncogene C-JUN; BZIP, protein-DNA complex, t 81.78
3ra3_B28 P2F; coiled coil domain, fiber, KIH interactions, 81.37
2jee_A81 YIIU; FTSZ, septum, coiled-coil, cell division, ce 81.13
1wlq_A83 Geminin; coiled-coil; 2.80A {Mus musculus} PDB: 2z 80.06
>3w03_C DNA repair protein XRCC4; coiled-coil, NHEJ, DSBS repair, KU70/80, DNA-PKCS, DNA ligas binding protein; HET: DNA; 8.49A {Homo sapiens} Back     alignment and structure
Probab=95.83  E-value=0.012  Score=37.30  Aligned_cols=30  Identities=13%  Similarity=0.272  Sum_probs=27.4

Q ss_pred             hhHHHHHHHHHHHhHHHHHHHHHHHHHHHH
Q psy9706           5 HTLEEELKDLREENKKLKEESQNALQQLRR   34 (39)
Q Consensus         5 ~~Lq~Ev~~LRe~N~RLqeESqsA~~qLrk   34 (39)
                      ..|++++.+|.++|.||+.|-+.+-+||.|
T Consensus       155 ~~L~~~n~~LqkeNeRL~~E~n~~l~qlEk  184 (184)
T 3w03_C          155 AENQAKNEHLQKENERLLRDWNDVQGRFEK  184 (184)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHC
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHhcC
Confidence            579999999999999999999999998864
>3s9g_A Protein hexim1; cyclin T-binding domain (TBD), cyclin T1/P-TEFB/7SK snRNA, N transcription; 2.10A {Homo sapiens} PDB: 2gd7_A Back     alignment and structure
>1ik9_A DNA repair protein XRCC4; DNA END joining, double-strand break repair, V(D)J recombination, protein-protein complex, coiled coil; HET: DNA; 2.30A {Homo sapiens} SCOP: b.59.1.1 h.1.11.1 PDB: 3ii6_A* 1fu1_A* 3rwr_A* Back     alignment and structure
>2wt7_A Proto-oncogene protein C-FOS; transcription, transcription regulation, nucleus, activator, repressor, DNA-binding, phosphoprotein, differentiation; 2.30A {Mus musculus} PDB: 1fos_E* 1a02_F* 1s9k_D Back     alignment and structure
>3i00_A HIP-I, huntingtin-interacting protein 1; transcription; 2.30A {Homo sapiens} PDB: 2qa7_A Back     alignment and structure
>2w6b_A RHO guanine nucleotide exchange factor 7; X-RAY crystallography, phosphoprotein, guanine-nucleotide releasing factor, GIT, PAK, PIX, COOL; 2.80A {Rattus norvegicus} Back     alignment and structure
>3q4f_C DNA repair protein XRCC4; DSB repair, nuclear, recombination-recombination complex, DN protein-protein binding complex; HET: DNA; 5.50A {Homo sapiens} Back     alignment and structure
>1t6f_A Geminin; coiled-coil, cell cycle; 1.47A {Synthetic} SCOP: h.1.28.1 Back     alignment and structure
>1dh3_A Transcription factor CREB; protein-DNA complex, transcription/DNA complex; HET: DNA; 3.00A {Mus musculus} SCOP: h.1.3.1 Back     alignment and structure
>1gu4_A CAAT/enhancer binding protein beta; transcription/DNA, protein-DNA complex, transcription factor, BZIP, C/EBP; 1.80A {Homo sapiens} SCOP: h.1.3.1 PDB: 1gtw_A 1gu5_A 1h88_A 1h8a_A 1io4_A 2e43_A* 2e42_A* 1h89_A 1ci6_B 1nwq_A Back     alignment and structure
>2aze_B Transcription factor E2F1; coiled coil, beta sandwich, cell cycle, transcription; 2.55A {Homo sapiens} SCOP: e.63.1.2 Back     alignment and structure
>1deb_A APC protein, adenomatous polyposis coli protein; coiled coil, tumor suppressor, structural protein; 2.40A {Homo sapiens} SCOP: h.1.18.1 Back     alignment and structure
>3l4f_A RHO guanine nucleotide exchange factor 7; coiled-coil, PDZ, guanine-nucleotide releasing factor, phosphoprotein, SH3 domain; 2.80A {Rattus norvegicus} Back     alignment and structure
>1hjb_A Ccaat/enhancer binding protein beta; transcription/DNA, protein-DNA complex; HET: DNA; 3.0A {Homo sapiens} SCOP: h.1.3.1 Back     alignment and structure
>2dgc_A Protein (GCN4); basic domain, leucine zipper, DNA binding, eukaryotic regulatory protein, transcription/DNA complex; HET: DNA; 2.20A {Saccharomyces cerevisiae} SCOP: h.1.3.1 PDB: 1dgc_A* 1ld4_E 1ysa_C* 3p8m_D Back     alignment and structure
>2yy0_A C-MYC-binding protein; conserved hypothetical protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.40A {Homo sapiens} Back     alignment and structure
>1am9_A Srebp-1A, protein (sterol regulatory element binding protein 1A); basic-helix-loop- helix-leucine zipper, transcription factor; HET: DNA; 2.30A {Homo sapiens} SCOP: a.38.1.1 PDB: 1ukl_C Back     alignment and structure
>1t2k_D Cyclic-AMP-dependent transcription factor ATF-2; protein DNA complex, transcription/DNA complex; 3.00A {Homo sapiens} SCOP: h.1.3.1 Back     alignment and structure
>3m91_A Proteasome-associated ATPase; coil COIL alpha helix, ATP-binding, chaperone, nucleotide-BI proteasome, S-nitrosylation; 1.80A {Mycobacterium tuberculosis} PDB: 3m9h_A Back     alignment and structure
>1jnm_A Proto-oncogene C-JUN; BZIP, protein-DNA complex, transcription/DNA complex; 2.20A {Homo sapiens} SCOP: h.1.3.1 PDB: 1fos_F 2h7h_A 1t2k_C 1a02_J* 1s9k_E 1jun_A Back     alignment and structure
>3ra3_B P2F; coiled coil domain, fiber, KIH interactions, synthetic biolo helical reconstruction, de novo protein; HET: PHI; 2.31A {Synthetic} Back     alignment and structure
>2jee_A YIIU; FTSZ, septum, coiled-coil, cell division, cell cycle, hypothetical protein; 2.8A {Escherichia coli} Back     alignment and structure
>1wlq_A Geminin; coiled-coil; 2.80A {Mus musculus} PDB: 2zxx_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query39
d2azeb1101 Transcription factor E2F1 {Human (Homo sapiens) [T 92.91
d2jn6a189 Uncharacterized protein Cgl2762 {Corynebacterium g 86.4
d1uklc_61 SREBP-2 {Human (Homo sapiens) [TaxId: 9606]} 85.35
d1io1a_ 395 Phase 1 flagellin {Salmonella typhimurium [TaxId: 83.13
>d2azeb1 e.63.1.2 (B:201-301) Transcription factor E2F1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Multi-domain proteins (alpha and beta)
fold: E2F-DP heterodimerization region
superfamily: E2F-DP heterodimerization region
family: E2F dimerization segment
domain: Transcription factor E2F1
species: Human (Homo sapiens) [TaxId: 9606]

Probab=92.91  E-value=0.16  Score=27.81  Aligned_cols=34  Identities=26%  Similarity=0.396  Sum_probs=31.5

Q ss_pred             HhhHHHHHHHHHHHhHHHHHHHHHHHHHHHHhhh
Q psy9706           4 RHTLEEELKDLREENKKLKEESQNALQQLRRFTE   37 (39)
Q Consensus         4 r~~Lq~Ev~~LRe~N~RLqeESqsA~~qLrkfte   37 (39)
                      -..|++|+.+|.+.-++|-+-.....++|+.+|+
T Consensus         3 ~~~L~~El~~L~~~E~~LD~li~~~~~~L~~lte   36 (101)
T d2azeb1           3 LEGLTQDLRQLQESEQQLDHLMNICTTQLRLLSE   36 (101)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             hHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhh
Confidence            3579999999999999999999999999999985
>d2jn6a1 a.4.1.19 (A:1-89) Uncharacterized protein Cgl2762 {Corynebacterium glutamicum [TaxId: 1718]} Back     information, alignment and structure
>d1uklc_ a.38.1.1 (C:) SREBP-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1io1a_ e.32.1.1 (A:) Phase 1 flagellin {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure