Diaphorina citri psyllid: psy9738


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130---
MAPEGGHHRKQYGPKVGYFGHWVSMAYLKMIEGEPPLIWNENPLRPHFLIPYLFILSCRQALYLIATNKKPEIKEKEKLSQIFQDFLDQCLEEEVETRASASLLLKHPFLKIARPLASLTPLIMAAKEAAKGH
ccccccccccccccccccccccHHHHHHHHHcccccccccccccccccccHHHHHHcHHHHHHHHcccccccccccccccHHHHHHHHHHHHHcccccccHHHHHcccccccccccccHHHHHHHHHHHHHcc
*APEGGHHRKQYGPKVGYFGHWVSMAYLKMIEGEPPLIWNENPLRPHFLIPYLFILSCRQALYLIATNKKPEIK*KEKLSQIFQDFLDQCLEEEVETRASASLLLKHPFLKIARPLASLTPLIMAAK******
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAPEGGHHRKQYGPKVGYFGHWVSMAYLKMIEGEPPLIWNENPLRPHFLIPYLFILSCRQALYLIATNKKPEIKEKEKLSQIFQDFLDQCLEEEVETRASASLLLKHPFLKIARPLASLTPLIMAAKEAAKGH

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Serine/threonine-protein kinase PAK 2 Serine/threonine protein kinase that plays a role in a variety of different signaling pathways including cytoskeleton regulation, cell motility, cell cycle progression, apoptosis or proliferation. Acts as downstream effector of the small GTPases CDC42 and RAC1. Activation by the binding of active CDC42 and RAC1 results in a conformational change and a subsequent autophosphorylation on several serine and/or threonine residues. Full-length PAK2 stimulates cell survival and cell growth. Phosphorylates MAPK4 and MAPK6 and activates the downstream target MAPKAPK5, a regulator of F-actin polymerization and cell migration. Phosphorylates JUN and plays an important role in EGF-induced cell proliferation. Phosphorylates many other substrates including histone H4 to promote assembly of H3.3 and H4 into nucleosomes, BAD, ribosomal protein S6, or MBP. Additionally, associates with ARHGEF7 and GIT1 to perform kinase-independent functions such as spindle orientation control during mitosis. On the other hand, apoptotic stimuli such as DNA damage lead to caspase-mediated cleavage of PAK2, generating PAK-2p34, an active p34 fragment that translocates to the nucleus and promotes cellular apoptosis involving the JNK signaling pathway. Caspase-activated PAK2 phosphorylates MKNK1 and reduces cellular translation.confidentQ8CIN4
Serine/threonine-protein kinase PAK 3 Serine/threonine protein kinase that plays a role in a variety of different signaling pathways including cytoskeleton regulation, cell migration, or cell cycle regulation. Plays a role in dendrite spine morphogenesis as well as synapse formation and plasticity. Acts as downstream effector of the small GTPases CDC42 and RAC1. Activation by the binding of active CDC42 and RAC1 results in a conformational change and a subsequent autophosphorylation on several serine and/or threonine residues. Phosphorylates MAPK4 and MAPK6 and activates the downstream target MAPKAPK5, a regulator of F-actin polymerization and cell migration. Additionally, phosphorylates TNNI3/troponin I to modulate calcium sensitivity and relaxation kinetics of thin myofilaments.confidentQ62829
Serine/threonine-protein kinase PAK 2 Serine/threonine protein kinase that plays a role in a variety of different signaling pathways including cytoskeleton regulation, cell motility, cell cycle progression, apoptosis or proliferation. Acts as downstream effector of the small GTPases CDC42 and RAC1. Activation by the binding of active CDC42 and RAC1 results in a conformational change and a subsequent autophosphorylation on several serine and/or threonine residues. Full-length PAK2 stimulates cell survival and cell growth. Phosphorylates MAPK4 and MAPK6 and activates the downstream target MAPKAPK5, a regulator of F-actin polymerization and cell migration. Phosphorylates JUN and plays an important role in EGF-induced cell proliferation. Phosphorylates many other substrates including histone H4 to promote assembly of H3.3 and H4 into nucleosomes, BAD, ribosomal protein S6, or MBP. Additionally, associates with ARHGEF7 and GIT1 to perform kinase-independent functions such as spindle orientation control during mitosis. On the other hand, apoptotic stimuli such as DNA damage lead to caspase-mediated cleavage of PAK2, generating PAK-2p34, an active p34 fragment that translocates to the nucleus and promotes cellular apoptosis involving the JNK signaling pathway. Caspase-activated PAK2 phosphorylates MKNK1 and reduces cellular translation.confidentQ29502

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0007409 [BP]axonogenesisprobableGO:0032502, GO:0044707, GO:0030030, GO:0030154, GO:0048468, GO:0031175, GO:0009653, GO:0007275, GO:0044699, GO:0000904, GO:0000902, GO:0048869, GO:0016043, GO:0032989, GO:0071840, GO:0048666, GO:0048667, GO:0032501, GO:0030182, GO:0009987, GO:0044767, GO:0044763, GO:0048731, GO:0022008, GO:0032990, GO:0048699, GO:0048858, GO:0007399, GO:0048856, GO:0048812, GO:0008150
GO:0016358 [BP]dendrite developmentprobableGO:0048666, GO:0030030, GO:0030154, GO:0048468, GO:0031175, GO:0007275, GO:0071840, GO:0048869, GO:0016043, GO:0008150, GO:0044699, GO:0032502, GO:0032501, GO:0030182, GO:0009987, GO:0044767, GO:0044763, GO:0022008, GO:0048699, GO:0044707, GO:0007399, GO:0048856, GO:0048731
GO:0000165 [BP]MAPK cascadeprobableGO:0044700, GO:0051716, GO:0007243, GO:0050896, GO:0009987, GO:0050794, GO:0008150, GO:0065007, GO:0044763, GO:0007165, GO:0023052, GO:0007154, GO:0035556, GO:0050789, GO:0044699
GO:0046330 [BP]positive regulation of JNK cascadeprobableGO:0048584, GO:0048583, GO:0023056, GO:0023051, GO:0046328, GO:0010647, GO:0010646, GO:0010627, GO:0050789, GO:0043408, GO:0009966, GO:0009967, GO:0065007, GO:0048518, GO:0010740, GO:0070302, GO:0070304, GO:0050794, GO:0043410, GO:0008150, GO:0032874, GO:0032872, GO:0080134, GO:0080135, GO:0048522
GO:0030296 [MF]protein tyrosine kinase activator activityprobableGO:0019207, GO:0019887, GO:0030234, GO:0019209, GO:0003674, GO:0008047, GO:0030295
GO:0009605 [BP]response to external stimulusprobableGO:0050896, GO:0008150
GO:0000287 [MF]magnesium ion bindingprobableGO:0043169, GO:0046872, GO:0003674, GO:0005488, GO:0043167
GO:0016328 [CC]lateral plasma membraneprobableGO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459
GO:0006974 [BP]response to DNA damage stimulusprobableGO:0051716, GO:0050896, GO:0009987, GO:0006950, GO:0044763, GO:0033554, GO:0008150, GO:0044699
GO:0018105 [BP]peptidyl-serine phosphorylationprobableGO:0044267, GO:0006468, GO:0018209, GO:0044260, GO:0044238, GO:0019538, GO:0016310, GO:0009987, GO:0043412, GO:0006464, GO:0043170, GO:0071704, GO:0006796, GO:0036211, GO:0008150, GO:0018193, GO:0008152, GO:0006793, GO:0044237
GO:0030036 [BP]actin cytoskeleton organizationprobableGO:0006996, GO:0007010, GO:0030029, GO:0009987, GO:0016043, GO:0044763, GO:0071840, GO:0008150, GO:0044699
GO:0001726 [CC]ruffleprobableGO:0005575, GO:0042995, GO:0044464, GO:0031252, GO:0005623
GO:2001238 [BP]positive regulation of extrinsic apoptotic signaling pathwayprobableGO:2001235, GO:2001236, GO:0010941, GO:2001233, GO:0009966, GO:0009967, GO:0048584, GO:0048583, GO:0050794, GO:0023056, GO:0043067, GO:0065007, GO:0023051, GO:0048518, GO:0008150, GO:0010647, GO:0010646, GO:0042981, GO:0050789, GO:0048522
GO:0043066 [BP]negative regulation of apoptotic processprobableGO:0043069, GO:0050794, GO:0008150, GO:0043067, GO:0065007, GO:0060548, GO:0048519, GO:0010941, GO:0042981, GO:0050789, GO:0048523
GO:0030833 [BP]regulation of actin filament polymerizationprobableGO:0033043, GO:0051128, GO:0008064, GO:0050789, GO:0044699, GO:0030832, GO:0051493, GO:0016043, GO:0090066, GO:0065007, GO:0071840, GO:0065008, GO:0032271, GO:0032970, GO:0009987, GO:0050794, GO:0044763, GO:0032956, GO:0043254, GO:0044087, GO:0008150, GO:0032535
GO:2000026 [BP]regulation of multicellular organismal developmentprobableGO:0050793, GO:0008150, GO:0065007, GO:0050789, GO:0051239
GO:0033148 [BP]positive regulation of intracellular estrogen receptor signaling pathwayprobableGO:0033145, GO:0033146, GO:0033143, GO:0009966, GO:0009967, GO:0048584, GO:0048583, GO:0050794, GO:0023056, GO:0065007, GO:0023051, GO:0048518, GO:0008150, GO:0010647, GO:0010646, GO:0050789, GO:0048522
GO:0043234 [CC]protein complexprobableGO:0005575, GO:0032991
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0004702 [MF]receptor signaling protein serine/threonine kinase activityprobableGO:0004674, GO:0016773, GO:0005057, GO:0003824, GO:0016301, GO:0060089, GO:0016740, GO:0003674, GO:0004871, GO:0004672, GO:0016772
GO:0004708 [MF]MAP kinase kinase activityprobableGO:0016773, GO:0016772, GO:0016301, GO:0003824, GO:0016740, GO:0004712, GO:0004672, GO:0003674
GO:0005925 [CC]focal adhesionprobableGO:0070161, GO:0005575, GO:0005912, GO:0005924, GO:0030054, GO:0030055
GO:0044430 [CC]cytoskeletal partprobableGO:0005856, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0043228, GO:0044424, GO:0043226, GO:0044422
GO:0061098 [BP]positive regulation of protein tyrosine kinase activityprobableGO:0019220, GO:0009893, GO:0019222, GO:0033674, GO:0031325, GO:0031323, GO:0061097, GO:0045860, GO:0050789, GO:0043085, GO:0080090, GO:0051347, GO:0010604, GO:0010562, GO:0043549, GO:0051246, GO:0051247, GO:0032270, GO:0044093, GO:0031399, GO:0048518, GO:0065007, GO:0065009, GO:0050790, GO:0045937, GO:0060255, GO:0045859, GO:0050794, GO:0051174, GO:0008150, GO:0042325, GO:0042327, GO:0032268, GO:0050731, GO:0050730, GO:0031401, GO:0051338, GO:0001932, GO:0001934, GO:0048522
GO:0033138 [BP]positive regulation of peptidyl-serine phosphorylationprobableGO:0019220, GO:0009893, GO:0019222, GO:0033135, GO:0031325, GO:0031323, GO:0050789, GO:0080090, GO:0010604, GO:0010562, GO:0051246, GO:0051247, GO:0032270, GO:0031399, GO:0048518, GO:0065007, GO:0045937, GO:0060255, GO:0050794, GO:0051174, GO:0008150, GO:0042325, GO:0042327, GO:0032268, GO:0031401, GO:0001932, GO:0001934, GO:0048522
GO:0014704 [CC]intercalated discprobableGO:0005575, GO:0044291, GO:0030054, GO:0005911
GO:0019901 [MF]protein kinase bindingprobableGO:0019900, GO:0003674, GO:0005515, GO:0019899, GO:0005488
GO:0005524 [MF]ATP bindingprobableGO:0043168, GO:0003674, GO:0005488, GO:0030554, GO:0035639, GO:0097159, GO:1901363, GO:0043167, GO:0036094, GO:0032553, GO:0032559, GO:0001883, GO:0032549, GO:0032555, GO:0017076, GO:0000166, GO:0032550, GO:1901265, GO:0001882
GO:0046777 [BP]protein autophosphorylationprobableGO:0044267, GO:0006468, GO:0044260, GO:0044238, GO:0019538, GO:0016310, GO:0009987, GO:0043412, GO:0006464, GO:0043170, GO:0071704, GO:0006796, GO:0036211, GO:0008150, GO:0044237, GO:0008152, GO:0006793
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0005739 [CC]mitochondrionprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0042803 [MF]protein homodimerization activityprobableGO:0046983, GO:0003674, GO:0005515, GO:0042802, GO:0005488
GO:0032153 [CC]cell division siteprobableGO:0005575, GO:0044464, GO:0005623
GO:2001271 [BP]negative regulation of cysteine-type endopeptidase activity involved in execution phase of apoptosisprobableGO:0019222, GO:0007569, GO:0010941, GO:0042981, GO:0043086, GO:0044699, GO:0051346, GO:2000116, GO:2000117, GO:0050789, GO:0043067, GO:0010466, GO:0065007, GO:0044092, GO:0043281, GO:0065009, GO:1900117, GO:0010259, GO:0009987, GO:0052547, GO:0052548, GO:0006915, GO:0050794, GO:0012501, GO:0044763, GO:0010951, GO:0051336, GO:0050790, GO:2001270, GO:0043154, GO:0008150
GO:0043507 [BP]positive regulation of JUN kinase activityprobableGO:0080135, GO:0019220, GO:0009893, GO:0019222, GO:0033674, GO:0031325, GO:0048584, GO:0048583, GO:0023056, GO:0043406, GO:0043405, GO:0051174, GO:0046328, GO:0043506, GO:0071902, GO:0010647, GO:0071900, GO:0010627, GO:0050789, GO:0043085, GO:0043408, GO:0010646, GO:0051347, GO:0010604, GO:0009966, GO:0009967, GO:0010562, GO:0043549, GO:0051246, GO:0051247, GO:0023051, GO:0060255, GO:0032270, GO:0044093, GO:0031399, GO:0048518, GO:0065007, GO:0065009, GO:0010740, GO:0050790, GO:0045937, GO:0070302, GO:0031323, GO:0045859, GO:0080090, GO:0050794, GO:0032872, GO:0032268, GO:0008150, GO:0042325, GO:0043410, GO:0042327, GO:0001932, GO:0080134, GO:0031401, GO:0051338, GO:0045860, GO:0001934, GO:0048522
GO:0030426 [CC]growth coneprobableGO:0030427, GO:0044463, GO:0044464, GO:0005623, GO:0005575, GO:0097458, GO:0043005, GO:0042995
GO:0030425 [CC]dendriteprobableGO:0044464, GO:0005623, GO:0005575, GO:0097458, GO:0043005, GO:0042995
GO:0005794 [CC]Golgi apparatusprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0030018 [CC]Z discprobableGO:0005737, GO:0005575, GO:0043229, GO:0043232, GO:0044464, GO:0031674, GO:0005623, GO:0005622, GO:0030016, GO:0030017, GO:0044444, GO:0043228, GO:0043292, GO:0044424, GO:0043226, GO:0044422, GO:0044449
GO:0001666 [BP]response to hypoxiaprobableGO:0009628, GO:0036293, GO:0050896, GO:0006950, GO:0008150, GO:0070482
GO:0031965 [CC]nuclear membraneprobableGO:0005575, GO:0005635, GO:0031090, GO:0005634, GO:0016020, GO:0044464, GO:0031967, GO:0031975, GO:0044446, GO:0043229, GO:0044428, GO:0012505, GO:0044424, GO:0005623, GO:0005622, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0051020 [MF]GTPase bindingprobableGO:0003674, GO:0005515, GO:0019899, GO:0005488
GO:0000187 [BP]activation of MAPK activityprobableGO:0019220, GO:0009893, GO:0019222, GO:0033674, GO:0031325, GO:0048584, GO:0048583, GO:0032147, GO:0023056, GO:0043406, GO:0043405, GO:0023051, GO:0071902, GO:0010647, GO:0071900, GO:0010627, GO:0050789, GO:0043085, GO:0043408, GO:0010646, GO:0051347, GO:0010604, GO:0009966, GO:0009967, GO:0010562, GO:0043549, GO:0051246, GO:0051247, GO:0032270, GO:0044093, GO:0031399, GO:0048518, GO:0065007, GO:0065009, GO:0010740, GO:0050790, GO:0045937, GO:0060255, GO:0031323, GO:0045859, GO:0080090, GO:0050794, GO:0043410, GO:0032268, GO:0008150, GO:0042325, GO:0051174, GO:0042327, GO:0045860, GO:0031401, GO:0051338, GO:0001932, GO:0001934, GO:0048522
GO:0032869 [BP]cellular response to insulin stimulusprobableGO:0070887, GO:0032868, GO:0044699, GO:0009719, GO:0051716, GO:0071375, GO:0071417, GO:0071310, GO:0071495, GO:0009987, GO:0032870, GO:0044763, GO:0010243, GO:0042221, GO:0043434, GO:0010033, GO:1901700, GO:1901701, GO:0009725, GO:0050896, GO:1901699, GO:1901652, GO:1901653, GO:0008150, GO:1901698
GO:0007155 [BP]cell adhesionprobableGO:0008150, GO:0009987, GO:0022610, GO:0044763, GO:0044699
GO:0022604 [BP]regulation of cell morphogenesisprobableGO:0022603, GO:0050793, GO:0050794, GO:0065007, GO:0008150, GO:0051128, GO:0050789

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3FXZ, chain A
Confidence level:very confident
Coverage over the Query: 1-45,61-130
View the alignment between query and template
View the model in PyMOL