Diaphorina citri psyllid: psy9761

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420
MAELASLLTTEIPEGRTSLLDSHSNLEKVAEYCEGNYFQADNKRMALEETKNYTTQSLASVAYQINTLAYNFLQLLDLQTAQLEEMESQMNHIGQIGVLTANKTTNRQYKIIAPANPEKPIKYVRKPIDLNALDDIGHGVRNAPRNKQRTPSQSNICVVPGPPAPTTKPPTPPSVIRSTGTLKNSREYRTPPAVAPPQVPSHYAPNYPIGHPKRERGPGYGTLPQVGMVHPLPPPPPENMPPHPQQQDPRSHYGQFSLAQQQQQQAQLAHHLQQQQMMSANMGNNPQMGNSHMANNPQPPNAHPPPSQYQAGMMSQQPPPPPSMQQRSSSPPLPPPPTSAGQMDDHVNFGQPQAVRNGGIVPRDQDLPGWVPKNYIEKDELSFQESAVIYVLKKNDDGWWEGVMDGITGLFPGNYVEPCV
cHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEECcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEccccCEEEECccCEEECccccccccc
*AELASLLTTEIPEGRTSLLDSHSNLEKVAEYCEGNYFQADNKRMALEETKNYTTQSLASVAYQINTLAYNFLQLLDLQTAQLEEMESQMNHIGQIGVLTANKTTNRQYKIIAPANPEKPIKYVRKPIDLNALDDIGH****************************************************************************************************************************************************************************************************************************GIVPRDQDLPGWVPKNYIEKDELSFQESAVIYVLKKNDDGWWEGVMDGITGLFPGNYVEPCV
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAELASLLTTEIPEGRTSLLDSHSNLEKVAEYCEGNYFQADNKRMALEETKNYTTQSLASVAYQINTLAYNFLQLLDLQTAQLEEMESQMNHIGQIGVLTANKTTNRQYKIIAPANPEKPIKYVRKPIDLNALDDIGHGVRNAPRNKQRTPSQSNICVVPGPPAPTTKPPTPPSVIRSTGTLKNSREYRTPPAVAPPQVPSHYAPNYPIGHPKRERGPGYGTLPQVGMVHPLPPPPPENMPPHPQQQDPRSHYGQFSLAQQQQQQAQLAHHLQQQQMMSANMGNNPQMGNSHMANNPQPPNAHPPPSQYQAGMMSQQPPPPPSMQQRSSSPPLPPPPTSAGQMDDHVNFGQPQAVRNGGIVPRDQDLPGWVPKNYIEKDELSFQESAVIYVLKKNDDGWWEGVMDGITGLFPGNYVEPCV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Abl interactor 2 May act in regulation of cell growth and transformation by interacting with nonreceptor tyrosine kinases ABL1 and/or ABL2. Part of the WAVE complex that regulates lamellipodia formation. The WAVE complex regulates actin filament reorganization via its interaction with the Arp2/3 complex. Regulates ABL1/c-Abl-mediated phosphorylation of MENA.confidentQ9NYB9

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0030175 [CC]filopodiumprobableGO:0005575, GO:0042995, GO:0044464, GO:0005623
GO:0018108 [BP]peptidyl-tyrosine phosphorylationprobableGO:0044267, GO:0006468, GO:0044260, GO:0044238, GO:0019538, GO:0016310, GO:0009987, GO:0018212, GO:0043412, GO:0006464, GO:0043170, GO:0071704, GO:0006796, GO:0036211, GO:0008150, GO:0018193, GO:0008152, GO:0006793, GO:0044237
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0030027 [CC]lamellipodiumprobableGO:0005575, GO:0042995, GO:0044464, GO:0031252, GO:0005623
GO:0006928 [BP]cellular component movementprobableGO:0008150, GO:0009987, GO:0044763, GO:0044699
GO:0043005 [CC]neuron projectionprobableGO:0005575, GO:0097458, GO:0042995, GO:0044464, GO:0005623

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3P8C, chain F
Confidence level:very confident
Coverage over the Query: 1-142
View the alignment between query and template
View the model in PyMOL
Template: 1GRI, chain A
Confidence level:very confident
Coverage over the Query: 369-419
View the alignment between query and template
View the model in PyMOL
Template: 1M2V, chain B
Confidence level:probable
Coverage over the Query: 263-276
View the alignment between query and template
View the model in PyMOL
Template: 1M2V, chain B
Confidence level:probable
Coverage over the Query: 263-276
View the alignment between query and template
View the model in PyMOL