Psyllid ID: psy9761
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 420 | ||||||
| 193603748 | 545 | PREDICTED: abl interactor 2-like [Acyrth | 0.985 | 0.759 | 0.526 | 1e-117 | |
| 270001565 | 489 | hypothetical protein TcasGA2_TC000412 [T | 0.969 | 0.832 | 0.549 | 1e-112 | |
| 307174650 | 454 | Abl interactor 2 [Camponotus floridanus] | 0.959 | 0.887 | 0.541 | 1e-110 | |
| 307198735 | 456 | Abl interactor 2 [Harpegnathos saltator] | 0.961 | 0.885 | 0.542 | 1e-108 | |
| 322788161 | 452 | hypothetical protein SINV_04899 [Solenop | 0.952 | 0.884 | 0.540 | 1e-107 | |
| 332027704 | 452 | Abl interactor 2 [Acromyrmex echinatior] | 0.952 | 0.884 | 0.547 | 1e-106 | |
| 158298113 | 443 | AGAP001046-PA [Anopheles gambiae str. PE | 0.902 | 0.855 | 0.485 | 1e-100 | |
| 321460729 | 457 | hypothetical protein DAPPUDRAFT_308744 [ | 0.907 | 0.833 | 0.475 | 2e-98 | |
| 157272118 | 441 | hypothetical protein AaeL_AAEL014130 [Ae | 0.921 | 0.877 | 0.489 | 3e-95 | |
| 195446193 | 464 | GK10907 [Drosophila willistoni] gi|19416 | 0.902 | 0.816 | 0.464 | 2e-88 |
| >gi|193603748|ref|XP_001946649.1| PREDICTED: abl interactor 2-like [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
Score = 429 bits (1103), Expect = e-117, Method: Compositional matrix adjust.
Identities = 275/522 (52%), Positives = 312/522 (59%), Gaps = 108/522 (20%)
Query: 1 MAELASLLTTEIPEGRTSLLDSHSNLEKVAEYCEGNYFQADNKRMALEETKNYTTQSLAS 60
MAELA LL +IPEGR SL DSH NLE+VAEYCEGNYFQA+NKR+ALEETKNYTTQSLAS
Sbjct: 28 MAELAQLLQADIPEGRNSLTDSHVNLERVAEYCEGNYFQAENKRLALEETKNYTTQSLAS 87
Query: 61 VAYQINTLAYNFLQLLDLQTAQLEEMESQMNHIGQ-------------IGVLTANKTTNR 107
VAYQINTLAYNFLQLLDLQT QL EM+SQ+NHI Q IGVLTANKTTNR
Sbjct: 88 VAYQINTLAYNFLQLLDLQTVQLSEMDSQINHIAQNVMIHKEKVARREIGVLTANKTTNR 147
Query: 108 QYKIIAPANPEKPIKYVRKPIDLNALDDIGHGVRNAPRNKQR---TPSQSNICVVPGPPA 164
QYKIIAPANPEKPIKYVRKPID ALDDIGHGVRN PR ++ S ++ + PA
Sbjct: 148 QYKIIAPANPEKPIKYVRKPIDFTALDDIGHGVRNTPRMVRQPISNSSSASTNMSSVGPA 207
Query: 165 PTTKPPTPPSVIRSTGTL-KNSREYRTPPAVAPPQVPSHYAPNYPIGHPKRERGPGYGTL 223
PT KPPTPP+VIR+TG+L K SREYRTPPAVAPPQVPSHYAPNYP+GH +RE+GPGY TL
Sbjct: 208 PTIKPPTPPAVIRATGSLSKGSREYRTPPAVAPPQVPSHYAPNYPLGHVRREKGPGYNTL 267
Query: 224 P--------------QVGMVHPL-------------PPPPPEN----MPPHPQQQDPRSH 252
P +GMVHP+ PPP P M P D H
Sbjct: 268 PLHHTSSSSSIQQSPIIGMVHPMQQSEQPSSLNSMPPPPSPHTLNTRMGVGPDLLDHHLH 327
Query: 253 YGQFS-----LAQQQQQQAQLAHH---LQQQQMMSANMGNNPQMGNS-HMANN--PQPPN 301
FS QQ+ H+ + QQ N Q+ ++ H +N Q
Sbjct: 328 QAPFSSNTDHYRSNTSQQSSTDHYRSNISQQSSTDHYRSNTSQLSSTDHYRSNLSQQSST 387
Query: 302 AH--------PPPSQYQAGM------------MSQQPPPPPSMQQRSSSPPLPPPP---- 337
H PP Y++ + SQ P + Q SS + P
Sbjct: 388 DHYRSNIPQQPPTDHYRSNITQLTTTDHYRANTSQLPGILKNSSQYHSSSAVVTSPQQQH 447
Query: 338 --------TSAGQMDDHVNFGQPQAVRNGGIVPRDQDLPGWVPKNYIEK----------- 378
+DH FG A G IVP++ DLPGWVPKNY+EK
Sbjct: 448 TRQASASPPLPPPPEDH--FGHIAA---GPIVPQEPDLPGWVPKNYLEKVIAIYDYYADK 502
Query: 379 -DELSFQESAVIYVLKKNDDGWWEGVMDGITGLFPGNYVEPC 419
DELSFQE++VIYVLKKNDDGWWEGVMDGITGLFPGNYVE C
Sbjct: 503 DDELSFQENSVIYVLKKNDDGWWEGVMDGITGLFPGNYVEGC 544
|
Source: Acyrthosiphon pisum Species: Acyrthosiphon pisum Genus: Acyrthosiphon Family: Aphididae Order: Hemiptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|270001565|gb|EEZ98012.1| hypothetical protein TcasGA2_TC000412 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|307174650|gb|EFN65049.1| Abl interactor 2 [Camponotus floridanus] | Back alignment and taxonomy information |
|---|
| >gi|307198735|gb|EFN79538.1| Abl interactor 2 [Harpegnathos saltator] | Back alignment and taxonomy information |
|---|
| >gi|322788161|gb|EFZ13943.1| hypothetical protein SINV_04899 [Solenopsis invicta] | Back alignment and taxonomy information |
|---|
| >gi|332027704|gb|EGI67772.1| Abl interactor 2 [Acromyrmex echinatior] | Back alignment and taxonomy information |
|---|
| >gi|158298113|ref|XP_318274.4| AGAP001046-PA [Anopheles gambiae str. PEST] gi|157014487|gb|EAA13429.4| AGAP001046-PA [Anopheles gambiae str. PEST] | Back alignment and taxonomy information |
|---|
| >gi|321460729|gb|EFX71769.1| hypothetical protein DAPPUDRAFT_308744 [Daphnia pulex] | Back alignment and taxonomy information |
|---|
| >gi|157272118|ref|XP_001648084.1| hypothetical protein AaeL_AAEL014130 [Aedes aegypti] gi|108869371|gb|EAT33596.1| AAEL014130-PA [Aedes aegypti] | Back alignment and taxonomy information |
|---|
| >gi|195446193|ref|XP_002070670.1| GK10907 [Drosophila willistoni] gi|194166755|gb|EDW81656.1| GK10907 [Drosophila willistoni] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 420 | ||||||
| FB|FBgn0020510 | 473 | Abi "Abelson interacting prote | 0.354 | 0.315 | 0.654 | 3.4e-99 | |
| ZFIN|ZDB-GENE-060519-5 | 574 | abi2b "abl-interactor 2b" [Dan | 0.483 | 0.353 | 0.511 | 6.8e-72 | |
| ZFIN|ZDB-GENE-060929-192 | 475 | abi2a "abl-interactor 2a" [Dan | 0.469 | 0.414 | 0.515 | 7.6e-71 | |
| UNIPROTKB|Q9NYB9 | 513 | ABI2 "Abl interactor 2" [Homo | 0.483 | 0.395 | 0.506 | 3.2e-70 | |
| UNIPROTKB|J3KNB2 | 513 | ABI2 "Abl interactor 2" [Homo | 0.483 | 0.395 | 0.506 | 1.1e-69 | |
| UNIPROTKB|J9NZI9 | 513 | ABI2 "Uncharacterized protein" | 0.483 | 0.395 | 0.497 | 1.5e-68 | |
| UNIPROTKB|E2RMI3 | 508 | ABI1 "Uncharacterized protein" | 0.473 | 0.391 | 0.483 | 2.5e-68 | |
| UNIPROTKB|F1LUZ9 | 513 | Abi2 "Protein Abi2" [Rattus no | 0.483 | 0.395 | 0.488 | 1.1e-67 | |
| UNIPROTKB|E2RCE3 | 536 | ABI2 "Uncharacterized protein" | 0.469 | 0.367 | 0.488 | 2.8e-67 | |
| UNIPROTKB|E7EW77 | 480 | ABI2 "Abl interactor 2" [Homo | 0.483 | 0.422 | 0.506 | 4.2e-67 |
| FB|FBgn0020510 Abi "Abelson interacting protein" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 527 (190.6 bits), Expect = 3.4e-99, Sum P(3) = 3.4e-99
Identities = 106/162 (65%), Positives = 129/162 (79%)
Query: 1 MAELASLLTTEIPEGRTSLLDSHSNLEKVAEYCEGNYFQADNKRMALEETKNYTTQSLAS 60
M ELASL+ TEIP+GR SL DS++NLE+VA+YCE Y++ADNK+ ALE TKNYTTQSLAS
Sbjct: 13 MDELASLIRTEIPDGRQSLRDSYTNLERVADYCEDTYYRADNKKAALEATKNYTTQSLAS 72
Query: 61 VAYQINTLAYNFLQLLDLQTAQLEEMESQMNHIGQ-------------IGVLTANKTTNR 107
VAYQINTLAY+++QLL+LQ QL EMESQMNHI Q IGVLTANK ++R
Sbjct: 73 VAYQINTLAYSYMQLLELQAQQLGEMESQMNHIAQTVHIHKEKVARREIGVLTANKVSSR 132
Query: 108 QYKIIAPANPEKPIKYVRKPIDLNALDDIGHGVRNAPRNKQR 149
Q+KI+AP NPEKPIKYVRKPID + LD+IGHG+ +A ++ R
Sbjct: 133 QFKIVAPINPEKPIKYVRKPIDYSMLDEIGHGINSAQHSQVR 174
|
|
| ZFIN|ZDB-GENE-060519-5 abi2b "abl-interactor 2b" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-060929-192 abi2a "abl-interactor 2a" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9NYB9 ABI2 "Abl interactor 2" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|J3KNB2 ABI2 "Abl interactor 2" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|J9NZI9 ABI2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2RMI3 ABI1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1LUZ9 Abi2 "Protein Abi2" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2RCE3 ABI2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E7EW77 ABI2 "Abl interactor 2" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 420 | |||
| cd11826 | 52 | cd11826, SH3_Abi, Src homology 3 domain of Abl Int | 3e-25 | |
| cd11972 | 61 | cd11972, SH3_Abi2, Src homology 3 domain of Abl In | 7e-21 | |
| cd11971 | 59 | cd11971, SH3_Abi1, Src homology 3 domain of Abl In | 6e-20 | |
| pfam07815 | 79 | pfam07815, Abi_HHR, Abl-interactor HHR | 2e-18 | |
| smart00326 | 56 | smart00326, SH3, Src homology 3 domains | 6e-15 | |
| cd11877 | 53 | cd11877, SH3_PIX, Src Homology 3 domain of Pak Int | 4e-14 | |
| cd00174 | 51 | cd00174, SH3, Src Homology 3 domain superfamily | 2e-12 | |
| cd11827 | 53 | cd11827, SH3_MyoIe_If_like, Src homology 3 domain | 2e-12 | |
| cd11772 | 53 | cd11772, SH3_OSTF1, Src Homology 3 domain of metaz | 4e-12 | |
| cd11840 | 53 | cd11840, SH3_Intersectin_5, Fifth Src homology 3 d | 4e-12 | |
| cd11819 | 54 | cd11819, SH3_Cortactin_like, Src homology 3 domain | 1e-11 | |
| cd11873 | 53 | cd11873, SH3_CD2AP-like_1, First Src Homology 3 do | 3e-11 | |
| cd11762 | 57 | cd11762, SH3_FCHSD_2, Second Src Homology 3 domain | 4e-11 | |
| cd11823 | 53 | cd11823, SH3_Nostrin, Src homology 3 domain of Nit | 5e-11 | |
| cd11875 | 55 | cd11875, SH3_CD2AP-like_3, Third Src Homology 3 do | 6e-11 | |
| cd11996 | 54 | cd11996, SH3_Intersectin2_5, Fifth Src homology 3 | 7e-11 | |
| cd12060 | 58 | cd12060, SH3_alphaPIX, Src Homology 3 domain of al | 1e-10 | |
| cd12061 | 54 | cd12061, SH3_betaPIX, Src Homology 3 domain of bet | 2e-10 | |
| cd11950 | 53 | cd11950, SH3_GRAP2_C, C-terminal Src homology 3 do | 2e-10 | |
| cd11805 | 53 | cd11805, SH3_GRB2_like_C, C-terminal Src homology | 2e-10 | |
| cd11856 | 53 | cd11856, SH3_p47phox_like, Src homology 3 domains | 4e-10 | |
| pfam00018 | 47 | pfam00018, SH3_1, SH3 domain | 5e-10 | |
| cd11959 | 53 | cd11959, SH3_Cortactin, Src homology 3 domain of C | 5e-10 | |
| cd12142 | 55 | cd12142, SH3_D21-like, Src Homology 3 domain of SH | 6e-10 | |
| pfam09770 | 804 | pfam09770, PAT1, Topoisomerase II-associated prote | 8e-10 | |
| cd11874 | 53 | cd11874, SH3_CD2AP-like_2, Second Src Homology 3 d | 9e-10 | |
| cd11961 | 53 | cd11961, SH3_Abp1_fungi_C2, Second C-terminal Src | 2e-09 | |
| cd11766 | 53 | cd11766, SH3_Nck_2, Second Src Homology 3 domain o | 2e-09 | |
| pfam09770 | 804 | pfam09770, PAT1, Topoisomerase II-associated prote | 3e-09 | |
| cd11825 | 54 | cd11825, SH3_PLCgamma, Src homology 3 domain of Ph | 3e-09 | |
| pfam07653 | 53 | pfam07653, SH3_2, Variant SH3 domain | 3e-09 | |
| cd11901 | 55 | cd11901, SH3_Nck1_2, Second Src Homology 3 domain | 4e-09 | |
| cd12052 | 53 | cd12052, SH3_CIN85_1, First Src Homology 3 domain | 4e-09 | |
| cd11976 | 54 | cd11976, SH3_VAV1_2, C-terminal (or second) Src ho | 6e-09 | |
| cd12073 | 55 | cd12073, SH3_HS1, Src homology 3 domain of Hematop | 7e-09 | |
| cd12055 | 53 | cd12055, SH3_CIN85_2, Second Src Homology 3 domain | 7e-09 | |
| cd11780 | 55 | cd11780, SH3_Sorbs_3, Third (or C-terminal) Src Ho | 7e-09 | |
| cd11882 | 54 | cd11882, SH3_GRAF-like, Src Homology 3 domain of G | 8e-09 | |
| cd11843 | 53 | cd11843, SH3_PACSIN, Src homology 3 domain of Prot | 1e-08 | |
| cd11803 | 55 | cd11803, SH3_Endophilin_A, Src homology 3 domain o | 1e-08 | |
| cd11883 | 55 | cd11883, SH3_Sdc25, Src Homology 3 domain of Sdc25 | 1e-08 | |
| cd11824 | 53 | cd11824, SH3_PSTPIP1, Src homology 3 domain of Pro | 1e-08 | |
| cd11793 | 55 | cd11793, SH3_ephexin1_like, Src homology 3 domain | 2e-08 | |
| cd11842 | 55 | cd11842, SH3_Ysc84p_like, Src homology 3 domain of | 2e-08 | |
| cd11781 | 53 | cd11781, SH3_Sorbs_1, First Src Homology 3 domain | 2e-08 | |
| pfam09770 | 804 | pfam09770, PAT1, Topoisomerase II-associated prote | 3e-08 | |
| cd11991 | 52 | cd11991, SH3_Intersectin1_3, Third Src homology 3 | 3e-08 | |
| cd12056 | 57 | cd12056, SH3_CD2AP_3, Third Src Homology 3 domain | 3e-08 | |
| cd11841 | 54 | cd11841, SH3_SH3YL1_like, Src homology 3 domain of | 4e-08 | |
| cd11838 | 52 | cd11838, SH3_Intersectin_3, Third Src homology 3 d | 4e-08 | |
| cd11995 | 54 | cd11995, SH3_Intersectin1_5, Fifth Src homology 3 | 4e-08 | |
| cd11894 | 56 | cd11894, SH3_FCHSD2_2, Second Src Homology 3 domai | 5e-08 | |
| cd12059 | 58 | cd12059, SH3_MLK1-3, Src Homology 3 domain of Mixe | 6e-08 | |
| cd11789 | 55 | cd11789, SH3_Nebulin_family_C, C-terminal Src Homo | 7e-08 | |
| cd11821 | 53 | cd11821, SH3_ASAP, Src homology 3 domain of ArfGAP | 9e-08 | |
| cd12045 | 53 | cd12045, SH3_SKAP2, Src Homology 3 domain of Src K | 1e-07 | |
| cd11884 | 56 | cd11884, SH3_MYO15, Src Homology 3 domain of Myosi | 1e-07 | |
| cd11902 | 55 | cd11902, SH3_Nck2_2, Second Src Homology 3 domain | 1e-07 | |
| cd11830 | 54 | cd11830, SH3_VAV_2, C-terminal (or second) Src hom | 1e-07 | |
| cd11829 | 52 | cd11829, SH3_GAS7, Src homology 3 domain of Growth | 2e-07 | |
| cd11820 | 54 | cd11820, SH3_STAM, Src homology 3 domain of Signal | 2e-07 | |
| cd11949 | 53 | cd11949, SH3_GRB2_C, C-terminal Src homology 3 dom | 2e-07 | |
| cd11960 | 54 | cd11960, SH3_Abp1_eu, Src homology 3 domain of eum | 2e-07 | |
| cd12057 | 56 | cd12057, SH3_CIN85_3, Third Src Homology 3 domain | 2e-07 | |
| cd12054 | 55 | cd12054, SH3_CD2AP_2, Second Src Homology 3 domain | 2e-07 | |
| cd11963 | 57 | cd11963, SH3_STAM2, Src homology 3 domain of Signa | 2e-07 | |
| cd11785 | 55 | cd11785, SH3_SH3RF_C, C-terminal (Fourth) Src Homo | 3e-07 | |
| cd11786 | 53 | cd11786, SH3_SH3RF_1, First Src Homology 3 domain | 4e-07 | |
| cd11763 | 55 | cd11763, SH3_SNX9_like, Src Homology 3 domain of S | 4e-07 | |
| cd12044 | 53 | cd12044, SH3_SKAP1, Src Homology 3 domain of Src K | 4e-07 | |
| cd11970 | 60 | cd11970, SH3_PLCgamma1, Src homology 3 domain of P | 5e-07 | |
| cd12058 | 58 | cd12058, SH3_MLK4, Src Homology 3 domain of Mixed | 5e-07 | |
| cd11951 | 53 | cd11951, SH3_GRAP_C, C-terminal Src homology 3 dom | 9e-07 | |
| cd11969 | 55 | cd11969, SH3_PLCgamma2, Src homology 3 domain of P | 9e-07 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 1e-06 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 2e-06 | |
| cd11812 | 52 | cd11812, SH3_AHI-1, Src Homology 3 domain of Abels | 2e-06 | |
| cd12046 | 53 | cd12046, SH3_p67phox_C, C-terminal (or second) Src | 2e-06 | |
| cd11866 | 53 | cd11866, SH3_SKAP1-like, Src Homology 3 domain of | 3e-06 | |
| cd11917 | 61 | cd11917, SH3_Sorbs2_3, Third (or C-terminal) Src H | 3e-06 | |
| cd11783 | 55 | cd11783, SH3_SH3RF_3, Third Src Homology 3 domain | 3e-06 | |
| cd11787 | 53 | cd11787, SH3_SH3RF_2, Second Src Homology 3 domain | 3e-06 | |
| cd11816 | 51 | cd11816, SH3_Eve1_3, Third Src homology 3 domain o | 3e-06 | |
| cd11916 | 59 | cd11916, SH3_Sorbs1_3, Third (or C-terminal) Src H | 3e-06 | |
| cd12017 | 53 | cd12017, SH3_Tks_3, Third Src homology 3 domain of | 4e-06 | |
| cd11770 | 54 | cd11770, SH3_Nephrocystin, Src Homology 3 domain o | 4e-06 | |
| cd11920 | 55 | cd11920, SH3_Sorbs2_1, First Src Homology 3 domain | 4e-06 | |
| cd11839 | 58 | cd11839, SH3_Intersectin_4, Fourth Src homology 3 | 4e-06 | |
| cd11964 | 55 | cd11964, SH3_STAM1, Src homology 3 domain of Signa | 5e-06 | |
| cd11876 | 58 | cd11876, SH3_MLK, Src Homology 3 domain of Mixed L | 5e-06 | |
| cd11889 | 53 | cd11889, SH3_Cyk3p-like, Src Homology 3 domain of | 6e-06 | |
| cd11791 | 59 | cd11791, SH3_UBASH3, Src homology 3 domain of Ubiq | 9e-06 | |
| cd11869 | 54 | cd11869, SH3_p40phox, Src Homology 3 domain of the | 9e-06 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 1e-05 | |
| cd11977 | 58 | cd11977, SH3_VAV2_2, C-terminal (or second) Src ho | 1e-05 | |
| cd11940 | 55 | cd11940, SH3_ARHGEF5_19, Src homology 3 domain of | 1e-05 | |
| cd12022 | 53 | cd12022, SH3_p47phox_2, Second or C-terminal Src h | 1e-05 | |
| cd12016 | 54 | cd12016, SH3_Tks_2, Second Src homology 3 domain o | 1e-05 | |
| cd11870 | 53 | cd11870, SH3_p67phox-like_C, C-terminal Src Homolo | 1e-05 | |
| cd11817 | 50 | cd11817, SH3_Eve1_4, Fourth Src homology 3 domain | 1e-05 | |
| cd11934 | 59 | cd11934, SH3_Lasp1_C, C-terminal Src Homology 3 do | 1e-05 | |
| cd11955 | 53 | cd11955, SH3_srGAP1-3, Src homology 3 domain of Sl | 1e-05 | |
| cd11778 | 51 | cd11778, SH3_Bzz1_2, Second Src Homology 3 domain | 1e-05 | |
| cd11813 | 53 | cd11813, SH3_SGSM3, Src Homology 3 domain of Small | 1e-05 | |
| cd11809 | 53 | cd11809, SH3_srGAP, Src homology 3 domain of Slit- | 1e-05 | |
| cd11782 | 53 | cd11782, SH3_Sorbs_2, Second Src Homology 3 domain | 2e-05 | |
| cd11828 | 53 | cd11828, SH3_ARHGEF9_like, Src homology 3 domain o | 2e-05 | |
| cd11804 | 52 | cd11804, SH3_GRB2_like_N, N-terminal Src homology | 2e-05 | |
| cd11771 | 60 | cd11771, SH3_Pex13p_fungal, Src Homology 3 domain | 2e-05 | |
| cd11986 | 53 | cd11986, SH3_Stac3_1, First C-terminal Src homolog | 2e-05 | |
| cd11796 | 51 | cd11796, SH3_DNMBP_N3, Third N-terminal Src homolo | 2e-05 | |
| cd11999 | 56 | cd11999, SH3_PACSIN_like, Src homology 3 domain of | 2e-05 | |
| cd11815 | 52 | cd11815, SH3_Eve1_2, Second Src homology 3 domain | 3e-05 | |
| cd11992 | 52 | cd11992, SH3_Intersectin2_3, Third Src homology 3 | 3e-05 | |
| cd11978 | 56 | cd11978, SH3_VAV3_2, C-terminal (or second) Src ho | 3e-05 | |
| cd11925 | 57 | cd11925, SH3_SH3RF3_3, Third Src Homology 3 domain | 3e-05 | |
| cd11836 | 55 | cd11836, SH3_Intersectin_1, First Src homology 3 d | 3e-05 | |
| cd11833 | 53 | cd11833, SH3_Stac_1, First C-terminal Src homology | 3e-05 | |
| cd12024 | 53 | cd12024, SH3_NoxO1_2, Second or C-terminal Src hom | 4e-05 | |
| cd11948 | 54 | cd11948, SH3_GRAP_N, N-terminal Src homology 3 dom | 5e-05 | |
| cd11931 | 55 | cd11931, SH3_SH3RF3_2, Second Src Homology 3 domai | 5e-05 | |
| cd11921 | 55 | cd11921, SH3_Vinexin_1, First Src Homology 3 domai | 5e-05 | |
| cd11806 | 53 | cd11806, SH3_PRMT2, Src homology 3 domain of Prote | 6e-05 | |
| cd11962 | 54 | cd11962, SH3_Abp1_fungi_C1, First C-terminal Src h | 7e-05 | |
| cd11998 | 56 | cd11998, SH3_PACSIN1-2, Src homology 3 domain of P | 9e-05 | |
| TIGR01628 | 562 | TIGR01628, PABP-1234, polyadenylate binding protei | 9e-05 | |
| cd12053 | 56 | cd12053, SH3_CD2AP_1, First Src Homology 3 domain | 9e-05 | |
| cd11895 | 58 | cd11895, SH3_FCHSD1_2, Second Src Homology 3 domai | 1e-04 | |
| cd11938 | 55 | cd11938, SH3_ARHGEF16_26, Src homology 3 domain of | 1e-04 | |
| cd11773 | 57 | cd11773, SH3_Sla1p_1, First Src Homology 3 domain | 1e-04 | |
| cd11918 | 58 | cd11918, SH3_Vinexin_3, Third (or C-terminal) Src | 1e-04 | |
| cd11933 | 58 | cd11933, SH3_Nebulin_C, C-terminal Src Homology 3 | 1e-04 | |
| cd11790 | 64 | cd11790, SH3_Amphiphysin, Src Homology 3 domain of | 1e-04 | |
| cd11818 | 50 | cd11818, SH3_Eve1_5, Fifth Src homology 3 domain o | 2e-04 | |
| cd11797 | 50 | cd11797, SH3_DNMBP_N4, Fourth N-terminal Src homol | 2e-04 | |
| cd11784 | 55 | cd11784, SH3_SH3RF2_3, Third Src Homology 3 domain | 2e-04 | |
| cd12015 | 53 | cd12015, SH3_Tks_1, First Src homology 3 domain of | 3e-04 | |
| cd11952 | 56 | cd11952, SH3_iASPP, Src Homology 3 (SH3) domain of | 3e-04 | |
| cd11837 | 53 | cd11837, SH3_Intersectin_2, Second Src homology 3 | 3e-04 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 3e-04 | |
| cd12013 | 61 | cd12013, SH3_RIM-BP_3, Third Src homology 3 domain | 3e-04 | |
| PRK10263 | 1355 | PRK10263, PRK10263, DNA translocase FtsK; Provisio | 4e-04 | |
| cd11926 | 55 | cd11926, SH3_SH3RF1_3, Third Src Homology 3 domain | 4e-04 | |
| cd11947 | 52 | cd11947, SH3_GRAP2_N, N-terminal Src homology 3 do | 4e-04 | |
| pfam03154 | 979 | pfam03154, Atrophin-1, Atrophin-1 family | 4e-04 | |
| cd11919 | 55 | cd11919, SH3_Sorbs1_1, First Src Homology 3 domain | 4e-04 | |
| cd11924 | 56 | cd11924, SH3_Vinexin_2, Second Src Homology 3 doma | 5e-04 | |
| PRK03427 | 333 | PRK03427, PRK03427, cell division protein ZipA; Pr | 5e-04 | |
| cd11927 | 54 | cd11927, SH3_SH3RF1_1, First Src Homology 3 domain | 5e-04 | |
| cd11871 | 54 | cd11871, SH3_p67phox_N, N-terminal (or first) Src | 5e-04 | |
| cd11930 | 55 | cd11930, SH3_SH3RF1_2, Second Src Homology 3 domai | 5e-04 | |
| cd11975 | 62 | cd11975, SH3_ARHGEF9, Src homology 3 domain of the | 6e-04 | |
| cd11844 | 56 | cd11844, SH3_CAS, Src homology 3 domain of CAS (Cr | 6e-04 | |
| cd12065 | 54 | cd12065, SH3_GRAF2, Src Homology 3 domain of GTPas | 6e-04 | |
| cd11935 | 58 | cd11935, SH3_Nebulette_C, C-terminal Src Homology | 0.001 | |
| cd11758 | 55 | cd11758, SH3_CRK_N, N-terminal Src Homology 3 doma | 0.001 | |
| cd11922 | 58 | cd11922, SH3_Sorbs1_2, Second Src Homology 3 domai | 0.001 | |
| cd11845 | 52 | cd11845, SH3_Src_like, Src homology 3 domain of Sr | 0.001 | |
| cd11807 | 57 | cd11807, SH3_ASPP, Src homology 3 domain of Apopto | 0.001 | |
| cd12000 | 57 | cd12000, SH3_CASS4, Src homology 3 domain of CAS ( | 0.001 | |
| cd11932 | 57 | cd11932, SH3_SH3RF2_2, Second Src Homology 3 domai | 0.001 | |
| PRK14954 | 620 | PRK14954, PRK14954, DNA polymerase III subunits ga | 0.001 | |
| cd11767 | 56 | cd11767, SH3_Nck_3, Third Src Homology 3 domain of | 0.001 | |
| cd11997 | 56 | cd11997, SH3_PACSIN3, Src homology 3 domain of Pro | 0.001 | |
| cd11858 | 55 | cd11858, SH3_Myosin-I_fungi, Src homology 3 domain | 0.001 | |
| cd12006 | 56 | cd12006, SH3_Fyn_Yrk, Src homology 3 domain of Fyn | 0.002 | |
| cd11896 | 55 | cd11896, SH3_SNX33, Src Homology 3 domain of Sorti | 0.002 | |
| cd11946 | 56 | cd11946, SH3_GRB2_N, N-terminal Src homology 3 dom | 0.002 | |
| cd11965 | 57 | cd11965, SH3_ASAP1, Src homology 3 domain of ArfGA | 0.002 | |
| cd11810 | 50 | cd11810, SH3_RUSC1_like, Src homology 3 domain of | 0.002 | |
| cd12076 | 54 | cd12076, SH3_Tks4_2, Second Src homology 3 domain | 0.002 | |
| cd11928 | 54 | cd11928, SH3_SH3RF3_1, First Src Homology 3 domain | 0.002 | |
| cd12064 | 56 | cd12064, SH3_GRAF, Src Homology 3 domain of GTPase | 0.002 | |
| PRK14086 | 617 | PRK14086, dnaA, chromosomal replication initiation | 0.002 | |
| COG5028 | 861 | COG5028, COG5028, Vesicle coat complex COPII, subu | 0.002 | |
| cd12020 | 57 | cd12020, SH3_Tks5_5, Fifth (C-terminal) Src homolo | 0.002 | |
| cd11851 | 62 | cd11851, SH3_RIM-BP, Src homology 3 domains of Rab | 0.002 | |
| cd11956 | 55 | cd11956, SH3_srGAP4, Src homology 3 domain of Slit | 0.003 | |
| pfam09606 | 768 | pfam09606, Med15, ARC105 or Med15 subunit of Media | 0.003 | |
| cd11954 | 57 | cd11954, SH3_ASPP1, Src Homology 3 domain of Apopt | 0.003 | |
| cd11990 | 52 | cd11990, SH3_Intersectin2_2, Second Src homology 3 | 0.003 | |
| cd11759 | 57 | cd11759, SH3_CRK_C, C-terminal Src Homology 3 doma | 0.004 | |
| cd12077 | 54 | cd12077, SH3_Tks5_2, Second Src homology 3 domain | 0.004 | |
| cd12001 | 68 | cd12001, SH3_BCAR1, Src homology 3 domain of the C | 0.004 | |
| cd11988 | 57 | cd11988, SH3_Intersectin2_1, First Src homology 3 | 0.004 | |
| cd11929 | 54 | cd11929, SH3_SH3RF2_1, First Src Homology 3 domain | 0.004 | |
| cd11966 | 56 | cd11966, SH3_ASAP2, Src homology 3 domain of ArfGA | 0.004 | |
| cd12018 | 56 | cd12018, SH3_Tks4_4, Fourth (C-terminal) Src homol | 0.004 |
| >gnl|CDD|212760 cd11826, SH3_Abi, Src homology 3 domain of Abl Interactor proteins | Back alignment and domain information |
|---|
Score = 97.0 bits (242), Expect = 3e-25
Identities = 31/39 (79%), Positives = 36/39 (92%)
Query: 379 DELSFQESAVIYVLKKNDDGWWEGVMDGITGLFPGNYVE 417
DELSFQE +IYV KKNDDGW+EGV++G+TGLFPGNYVE
Sbjct: 14 DELSFQEGDIIYVTKKNDDGWYEGVLNGVTGLFPGNYVE 52
|
Abl interactor (Abi) proteins are adaptor proteins serving as binding partners and substrates of Abl tyrosine kinases. They are involved in regulating actin cytoskeletal reorganization and play important roles in membrane-ruffling, endocytosis, cell motility, and cell migration. They localize to sites of actin polymerization in epithelial adherens junction and immune synapses, as well as to the leading edge of lamellipodia. Vertebrates contain two Abi proteins, Abi1 and Abi2. Abi1 displays a wide expression pattern while Abi2 is highly expressed in the eye and brain. Abi proteins contain a homeobox homology domain, a proline-rich region, and a SH3 domain. The SH3 domain of Abi binds to a PxxP motif in Abl. SH3 domains are protein interaction domains that bind to proline-rich ligands with moderate affinity and selectivity, preferentially to PxxP motifs. They play versatile and diverse roles in the cell including the regulation of enzymes, changing the subcellular localization of signaling pathway components, and mediating the formation of multiprotein complex assemblies. Length = 52 |
| >gnl|CDD|212905 cd11972, SH3_Abi2, Src homology 3 domain of Abl Interactor 2 | Back alignment and domain information |
|---|
| >gnl|CDD|212904 cd11971, SH3_Abi1, Src homology 3 domain of Abl Interactor 1 | Back alignment and domain information |
|---|
| >gnl|CDD|219593 pfam07815, Abi_HHR, Abl-interactor HHR | Back alignment and domain information |
|---|
| >gnl|CDD|214620 smart00326, SH3, Src homology 3 domains | Back alignment and domain information |
|---|
| >gnl|CDD|212810 cd11877, SH3_PIX, Src Homology 3 domain of Pak Interactive eXchange factors | Back alignment and domain information |
|---|
| >gnl|CDD|212690 cd00174, SH3, Src Homology 3 domain superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|212761 cd11827, SH3_MyoIe_If_like, Src homology 3 domain of Myosins Ie, If, and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212706 cd11772, SH3_OSTF1, Src Homology 3 domain of metazoan osteoclast stimulating factor 1 | Back alignment and domain information |
|---|
| >gnl|CDD|212774 cd11840, SH3_Intersectin_5, Fifth Src homology 3 domain (or SH3E) of Intersectin | Back alignment and domain information |
|---|
| >gnl|CDD|212753 cd11819, SH3_Cortactin_like, Src homology 3 domain of Cortactin and related proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212806 cd11873, SH3_CD2AP-like_1, First Src Homology 3 domain (SH3A) of CD2-associated protein and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212696 cd11762, SH3_FCHSD_2, Second Src Homology 3 domain of FCH and double SH3 domains proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212757 cd11823, SH3_Nostrin, Src homology 3 domain of Nitric Oxide Synthase TRaffic INducer | Back alignment and domain information |
|---|
| >gnl|CDD|212808 cd11875, SH3_CD2AP-like_3, Third Src Homology 3 domain (SH3C) of CD2-associated protein and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212929 cd11996, SH3_Intersectin2_5, Fifth Src homology 3 domain (or SH3E) of Intersectin-2 | Back alignment and domain information |
|---|
| >gnl|CDD|212993 cd12060, SH3_alphaPIX, Src Homology 3 domain of alpha-Pak Interactive eXchange factor | Back alignment and domain information |
|---|
| >gnl|CDD|212994 cd12061, SH3_betaPIX, Src Homology 3 domain of beta-Pak Interactive eXchange factor | Back alignment and domain information |
|---|
| >gnl|CDD|212883 cd11950, SH3_GRAP2_C, C-terminal Src homology 3 domain of GRB2-related adaptor protein 2 | Back alignment and domain information |
|---|
| >gnl|CDD|212739 cd11805, SH3_GRB2_like_C, C-terminal Src homology 3 domain of Growth factor receptor-bound protein 2 (GRB2) and related proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212790 cd11856, SH3_p47phox_like, Src homology 3 domains of the p47phox subunit of NADPH oxidase and similar domains | Back alignment and domain information |
|---|
| >gnl|CDD|215659 pfam00018, SH3_1, SH3 domain | Back alignment and domain information |
|---|
| >gnl|CDD|212892 cd11959, SH3_Cortactin, Src homology 3 domain of Cortactin | Back alignment and domain information |
|---|
| >gnl|CDD|213018 cd12142, SH3_D21-like, Src Homology 3 domain of SH3 domain-containing protein 21 (SH3D21) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|220392 pfam09770, PAT1, Topoisomerase II-associated protein PAT1 | Back alignment and domain information |
|---|
| >gnl|CDD|212807 cd11874, SH3_CD2AP-like_2, Second Src Homology 3 domain (SH3B) of CD2-associated protein and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212894 cd11961, SH3_Abp1_fungi_C2, Second C-terminal Src homology 3 domain of Fungal Actin-binding protein 1 | Back alignment and domain information |
|---|
| >gnl|CDD|212700 cd11766, SH3_Nck_2, Second Src Homology 3 domain of Nck adaptor proteins | Back alignment and domain information |
|---|
| >gnl|CDD|220392 pfam09770, PAT1, Topoisomerase II-associated protein PAT1 | Back alignment and domain information |
|---|
| >gnl|CDD|212759 cd11825, SH3_PLCgamma, Src homology 3 domain of Phospholipase C (PLC) gamma | Back alignment and domain information |
|---|
| >gnl|CDD|219499 pfam07653, SH3_2, Variant SH3 domain | Back alignment and domain information |
|---|
| >gnl|CDD|212834 cd11901, SH3_Nck1_2, Second Src Homology 3 domain of Nck1 adaptor protein | Back alignment and domain information |
|---|
| >gnl|CDD|212985 cd12052, SH3_CIN85_1, First Src Homology 3 domain (SH3A) of Cbl-interacting protein of 85 kDa | Back alignment and domain information |
|---|
| >gnl|CDD|212909 cd11976, SH3_VAV1_2, C-terminal (or second) Src homology 3 domain of VAV1 protein | Back alignment and domain information |
|---|
| >gnl|CDD|213006 cd12073, SH3_HS1, Src homology 3 domain of Hematopoietic lineage cell-specific protein 1 | Back alignment and domain information |
|---|
| >gnl|CDD|212988 cd12055, SH3_CIN85_2, Second Src Homology 3 domain (SH3B) of Cbl-interacting protein of 85 kDa | Back alignment and domain information |
|---|
| >gnl|CDD|212714 cd11780, SH3_Sorbs_3, Third (or C-terminal) Src Homology 3 domain of Sorbin and SH3 domain containing (Sorbs) proteins and similar domains | Back alignment and domain information |
|---|
| >gnl|CDD|212815 cd11882, SH3_GRAF-like, Src Homology 3 domain of GTPase Regulator Associated with Focal adhesion kinase and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212777 cd11843, SH3_PACSIN, Src homology 3 domain of Protein kinase C and Casein kinase Substrate in Neurons (PACSIN) proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212737 cd11803, SH3_Endophilin_A, Src homology 3 domain of Endophilin-A | Back alignment and domain information |
|---|
| >gnl|CDD|212816 cd11883, SH3_Sdc25, Src Homology 3 domain of Sdc25/Cdc25 guanine nucleotide exchange factors | Back alignment and domain information |
|---|
| >gnl|CDD|212758 cd11824, SH3_PSTPIP1, Src homology 3 domain of Proline-Serine-Threonine Phosphatase-Interacting Protein 1 | Back alignment and domain information |
|---|
| >gnl|CDD|212727 cd11793, SH3_ephexin1_like, Src homology 3 domain of ephexin-1-like SH3 domain containing Rho guanine nucleotide exchange factors | Back alignment and domain information |
|---|
| >gnl|CDD|212776 cd11842, SH3_Ysc84p_like, Src homology 3 domain of Ysc84p and similar fungal proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212715 cd11781, SH3_Sorbs_1, First Src Homology 3 domain of Sorbin and SH3 domain containing (Sorbs) proteins and similar domains | Back alignment and domain information |
|---|
| >gnl|CDD|220392 pfam09770, PAT1, Topoisomerase II-associated protein PAT1 | Back alignment and domain information |
|---|
| >gnl|CDD|212924 cd11991, SH3_Intersectin1_3, Third Src homology 3 domain (or SH3C) of Intersectin-1 | Back alignment and domain information |
|---|
| >gnl|CDD|212989 cd12056, SH3_CD2AP_3, Third Src Homology 3 domain (SH3C) of CD2-associated protein | Back alignment and domain information |
|---|
| >gnl|CDD|212775 cd11841, SH3_SH3YL1_like, Src homology 3 domain of SH3 domain containing Ysc84-like 1 (SH3YL1) protein | Back alignment and domain information |
|---|
| >gnl|CDD|212772 cd11838, SH3_Intersectin_3, Third Src homology 3 domain (or SH3C) of Intersectin | Back alignment and domain information |
|---|
| >gnl|CDD|212928 cd11995, SH3_Intersectin1_5, Fifth Src homology 3 domain (or SH3E) of Intersectin-1 | Back alignment and domain information |
|---|
| >gnl|CDD|212827 cd11894, SH3_FCHSD2_2, Second Src Homology 3 domain of FCH and double SH3 domains protein 2 | Back alignment and domain information |
|---|
| >gnl|CDD|212992 cd12059, SH3_MLK1-3, Src Homology 3 domain of Mixed Lineage Kinases 1, 2, and 3 | Back alignment and domain information |
|---|
| >gnl|CDD|212723 cd11789, SH3_Nebulin_family_C, C-terminal Src Homology 3 domain of the Nebulin family of proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212755 cd11821, SH3_ASAP, Src homology 3 domain of ArfGAP with SH3 domain, ankyrin repeat and PH domain containing proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212978 cd12045, SH3_SKAP2, Src Homology 3 domain of Src Kinase-Associated Phosphoprotein 2 | Back alignment and domain information |
|---|
| >gnl|CDD|212817 cd11884, SH3_MYO15, Src Homology 3 domain of Myosin XV | Back alignment and domain information |
|---|
| >gnl|CDD|212835 cd11902, SH3_Nck2_2, Second Src Homology 3 domain of Nck2 adaptor protein | Back alignment and domain information |
|---|
| >gnl|CDD|212764 cd11830, SH3_VAV_2, C-terminal (or second) Src homology 3 domain of VAV proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212763 cd11829, SH3_GAS7, Src homology 3 domain of Growth Arrest Specific protein 7 | Back alignment and domain information |
|---|
| >gnl|CDD|212754 cd11820, SH3_STAM, Src homology 3 domain of Signal Transducing Adaptor Molecules | Back alignment and domain information |
|---|
| >gnl|CDD|212882 cd11949, SH3_GRB2_C, C-terminal Src homology 3 domain of Growth factor receptor-bound protein 2 | Back alignment and domain information |
|---|
| >gnl|CDD|212893 cd11960, SH3_Abp1_eu, Src homology 3 domain of eumetazoan Actin-binding protein 1 | Back alignment and domain information |
|---|
| >gnl|CDD|212990 cd12057, SH3_CIN85_3, Third Src Homology 3 domain (SH3C) of Cbl-interacting protein of 85 kDa | Back alignment and domain information |
|---|
| >gnl|CDD|212987 cd12054, SH3_CD2AP_2, Second Src Homology 3 domain (SH3B) of CD2-associated protein | Back alignment and domain information |
|---|
| >gnl|CDD|212896 cd11963, SH3_STAM2, Src homology 3 domain of Signal Transducing Adaptor Molecule 2 | Back alignment and domain information |
|---|
| >gnl|CDD|212719 cd11785, SH3_SH3RF_C, C-terminal (Fourth) Src Homology 3 domain of SH3 domain containing ring finger 1 (SH3RF1), SH3RF3, and similar domains | Back alignment and domain information |
|---|
| >gnl|CDD|212720 cd11786, SH3_SH3RF_1, First Src Homology 3 domain of SH3 domain containing ring finger proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212697 cd11763, SH3_SNX9_like, Src Homology 3 domain of Sorting Nexin 9 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212977 cd12044, SH3_SKAP1, Src Homology 3 domain of Src Kinase-Associated Phosphoprotein 1 | Back alignment and domain information |
|---|
| >gnl|CDD|212903 cd11970, SH3_PLCgamma1, Src homology 3 domain of Phospholipase C (PLC) gamma 1 | Back alignment and domain information |
|---|
| >gnl|CDD|212991 cd12058, SH3_MLK4, Src Homology 3 domain of Mixed Lineage Kinase 4 | Back alignment and domain information |
|---|
| >gnl|CDD|212884 cd11951, SH3_GRAP_C, C-terminal Src homology 3 domain of GRB2-related adaptor protein | Back alignment and domain information |
|---|
| >gnl|CDD|212902 cd11969, SH3_PLCgamma2, Src homology 3 domain of Phospholipase C (PLC) gamma 2 | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|212746 cd11812, SH3_AHI-1, Src Homology 3 domain of Abelson helper integration site-1 (AHI-1) | Back alignment and domain information |
|---|
| >gnl|CDD|212979 cd12046, SH3_p67phox_C, C-terminal (or second) Src Homology 3 domain of the p67phox subunit of NADPH oxidase | Back alignment and domain information |
|---|
| >gnl|CDD|212800 cd11866, SH3_SKAP1-like, Src Homology 3 domain of Src Kinase-Associated Phosphoprotein 1 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212850 cd11917, SH3_Sorbs2_3, Third (or C-terminal) Src Homology 3 domain of Sorbin and SH3 domain containing 2 (Sorbs2), also called Arg-binding protein 2 (ArgBP2) | Back alignment and domain information |
|---|
| >gnl|CDD|212717 cd11783, SH3_SH3RF_3, Third Src Homology 3 domain of SH3 domain containing ring finger 1 (SH3RF1), SH3RF3, and similar domains | Back alignment and domain information |
|---|
| >gnl|CDD|212721 cd11787, SH3_SH3RF_2, Second Src Homology 3 domain of SH3 domain containing ring finger proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212750 cd11816, SH3_Eve1_3, Third Src homology 3 domain of ADAM-binding protein Eve-1 | Back alignment and domain information |
|---|
| >gnl|CDD|212849 cd11916, SH3_Sorbs1_3, Third (or C-terminal) Src Homology 3 domain of Sorbin and SH3 domain containing 1 (Sorbs1), also called ponsin | Back alignment and domain information |
|---|
| >gnl|CDD|212950 cd12017, SH3_Tks_3, Third Src homology 3 domain of Tyrosine kinase substrate (Tks) proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212704 cd11770, SH3_Nephrocystin, Src Homology 3 domain of Nephrocystin (or Nephrocystin-1) | Back alignment and domain information |
|---|
| >gnl|CDD|212853 cd11920, SH3_Sorbs2_1, First Src Homology 3 domain of Sorbin and SH3 domain containing 2 (Sorbs2), also called Arg-binding protein 2 (ArgBP2) | Back alignment and domain information |
|---|
| >gnl|CDD|212773 cd11839, SH3_Intersectin_4, Fourth Src homology 3 domain (or SH3D) of Intersectin | Back alignment and domain information |
|---|
| >gnl|CDD|212897 cd11964, SH3_STAM1, Src homology 3 domain of Signal Transducing Adaptor Molecule 1 | Back alignment and domain information |
|---|
| >gnl|CDD|212809 cd11876, SH3_MLK, Src Homology 3 domain of Mixed Lineage Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|212822 cd11889, SH3_Cyk3p-like, Src Homology 3 domain of Cytokinesis protein 3 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212725 cd11791, SH3_UBASH3, Src homology 3 domain of Ubiquitin-associated and SH3 domain-containing proteins, also called TULA (T cell Ubiquitin LigAnd) family of proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212802 cd11869, SH3_p40phox, Src Homology 3 domain of the p40phox subunit of NADPH oxidase | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|212910 cd11977, SH3_VAV2_2, C-terminal (or second) Src homology 3 domain of VAV2 protein | Back alignment and domain information |
|---|
| >gnl|CDD|212873 cd11940, SH3_ARHGEF5_19, Src homology 3 domain of the Rho guanine nucleotide exchange factors ARHGEF5 and ARHGEF19 | Back alignment and domain information |
|---|
| >gnl|CDD|212955 cd12022, SH3_p47phox_2, Second or C-terminal Src homology 3 domain of the p47phox subunit of NADPH oxidase, also called Neutrophil Cytosolic Factor 1 | Back alignment and domain information |
|---|
| >gnl|CDD|212949 cd12016, SH3_Tks_2, Second Src homology 3 domain of Tyrosine kinase substrate (Tks) proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212803 cd11870, SH3_p67phox-like_C, C-terminal Src Homology 3 domain of the p67phox subunit of NADPH oxidase and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212751 cd11817, SH3_Eve1_4, Fourth Src homology 3 domain of ADAM-binding protein Eve-1 | Back alignment and domain information |
|---|
| >gnl|CDD|212867 cd11934, SH3_Lasp1_C, C-terminal Src Homology 3 domain of LIM and SH3 domain protein 1 | Back alignment and domain information |
|---|
| >gnl|CDD|212888 cd11955, SH3_srGAP1-3, Src homology 3 domain of Slit-Robo GTPase Activating Proteins 1, 2, and 3 | Back alignment and domain information |
|---|
| >gnl|CDD|212712 cd11778, SH3_Bzz1_2, Second Src Homology 3 domain of Bzz1 and similar domains | Back alignment and domain information |
|---|
| >gnl|CDD|212747 cd11813, SH3_SGSM3, Src Homology 3 domain of Small G protein Signaling Modulator 3 | Back alignment and domain information |
|---|
| >gnl|CDD|212743 cd11809, SH3_srGAP, Src homology 3 domain of Slit-Robo GTPase Activating Proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212716 cd11782, SH3_Sorbs_2, Second Src Homology 3 domain of Sorbin and SH3 domain containing (Sorbs) proteins and similar domains | Back alignment and domain information |
|---|
| >gnl|CDD|212762 cd11828, SH3_ARHGEF9_like, Src homology 3 domain of ARHGEF9-like Rho guanine nucleotide exchange factors | Back alignment and domain information |
|---|
| >gnl|CDD|212738 cd11804, SH3_GRB2_like_N, N-terminal Src homology 3 domain of Growth factor receptor-bound protein 2 (GRB2) and related proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212705 cd11771, SH3_Pex13p_fungal, Src Homology 3 domain of fungal peroxisomal membrane protein Pex13p | Back alignment and domain information |
|---|
| >gnl|CDD|212919 cd11986, SH3_Stac3_1, First C-terminal Src homology 3 domain of SH3 and cysteine-rich domain-containing protein 3 (Stac3) | Back alignment and domain information |
|---|
| >gnl|CDD|212730 cd11796, SH3_DNMBP_N3, Third N-terminal Src homology 3 domain of Dynamin Binding Protein, also called Tuba | Back alignment and domain information |
|---|
| >gnl|CDD|212932 cd11999, SH3_PACSIN_like, Src homology 3 domain of an unknown subfamily of proteins with similarity to Protein kinase C and Casein kinase Substrate in Neurons (PACSIN) proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212749 cd11815, SH3_Eve1_2, Second Src homology 3 domain of ADAM-binding protein Eve-1 | Back alignment and domain information |
|---|
| >gnl|CDD|212925 cd11992, SH3_Intersectin2_3, Third Src homology 3 domain (or SH3C) of Intersectin-2 | Back alignment and domain information |
|---|
| >gnl|CDD|212911 cd11978, SH3_VAV3_2, C-terminal (or second) Src homology 3 domain of VAV3 protein | Back alignment and domain information |
|---|
| >gnl|CDD|212858 cd11925, SH3_SH3RF3_3, Third Src Homology 3 domain of SH3 domain containing ring finger 3, an E3 ubiquitin-protein ligase | Back alignment and domain information |
|---|
| >gnl|CDD|212770 cd11836, SH3_Intersectin_1, First Src homology 3 domain (or SH3A) of Intersectin | Back alignment and domain information |
|---|
| >gnl|CDD|212767 cd11833, SH3_Stac_1, First C-terminal Src homology 3 domain of SH3 and cysteine-rich domain-containing (Stac) proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212957 cd12024, SH3_NoxO1_2, Second or C-terminal Src homology 3 domain of NADPH oxidase (Nox) Organizing protein 1 | Back alignment and domain information |
|---|
| >gnl|CDD|212881 cd11948, SH3_GRAP_N, N-terminal Src homology 3 domain of GRB2-related adaptor protein | Back alignment and domain information |
|---|
| >gnl|CDD|212864 cd11931, SH3_SH3RF3_2, Second Src Homology 3 domain of SH3 domain containing ring finger 3, an E3 ubiquitin-protein ligase | Back alignment and domain information |
|---|
| >gnl|CDD|212854 cd11921, SH3_Vinexin_1, First Src Homology 3 domain of Vinexin, also called Sorbin and SH3 domain containing 3 (Sorbs3) | Back alignment and domain information |
|---|
| >gnl|CDD|212740 cd11806, SH3_PRMT2, Src homology 3 domain of Protein arginine N-methyltransferase 2 | Back alignment and domain information |
|---|
| >gnl|CDD|212895 cd11962, SH3_Abp1_fungi_C1, First C-terminal Src homology 3 domain of Fungal Actin-binding protein 1 | Back alignment and domain information |
|---|
| >gnl|CDD|212931 cd11998, SH3_PACSIN1-2, Src homology 3 domain of Protein kinase C and Casein kinase Substrate in Neurons 1 (PACSIN1) and PACSIN 2 | Back alignment and domain information |
|---|
| >gnl|CDD|130689 TIGR01628, PABP-1234, polyadenylate binding protein, human types 1, 2, 3, 4 family | Back alignment and domain information |
|---|
| >gnl|CDD|212986 cd12053, SH3_CD2AP_1, First Src Homology 3 domain (SH3A) of CD2-associated protein | Back alignment and domain information |
|---|
| >gnl|CDD|212828 cd11895, SH3_FCHSD1_2, Second Src Homology 3 domain of FCH and double SH3 domains protein 1 | Back alignment and domain information |
|---|
| >gnl|CDD|212871 cd11938, SH3_ARHGEF16_26, Src homology 3 domain of the Rho guanine nucleotide exchange factors ARHGEF16 and ARHGEF26 | Back alignment and domain information |
|---|
| >gnl|CDD|212707 cd11773, SH3_Sla1p_1, First Src Homology 3 domain of the fungal endocytic adaptor protein Sla1p | Back alignment and domain information |
|---|
| >gnl|CDD|212851 cd11918, SH3_Vinexin_3, Third (or C-terminal) Src Homology 3 domain of Vinexin, also called Sorbin and SH3 domain containing 3 (Sorbs3) | Back alignment and domain information |
|---|
| >gnl|CDD|212866 cd11933, SH3_Nebulin_C, C-terminal Src Homology 3 domain of Nebulin | Back alignment and domain information |
|---|
| >gnl|CDD|212724 cd11790, SH3_Amphiphysin, Src Homology 3 domain of Amphiphysin and related domains | Back alignment and domain information |
|---|
| >gnl|CDD|212752 cd11818, SH3_Eve1_5, Fifth Src homology 3 domain of ADAM-binding protein Eve-1 | Back alignment and domain information |
|---|
| >gnl|CDD|212731 cd11797, SH3_DNMBP_N4, Fourth N-terminal Src homology 3 domain of Dynamin Binding Protein, also called Tuba | Back alignment and domain information |
|---|
| >gnl|CDD|212718 cd11784, SH3_SH3RF2_3, Third Src Homology 3 domain of SH3 domain containing ring finger 2 | Back alignment and domain information |
|---|
| >gnl|CDD|212948 cd12015, SH3_Tks_1, First Src homology 3 domain of Tyrosine kinase substrate (Tks) proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212885 cd11952, SH3_iASPP, Src Homology 3 (SH3) domain of Inhibitor of ASPP protein (iASPP) | Back alignment and domain information |
|---|
| >gnl|CDD|212771 cd11837, SH3_Intersectin_2, Second Src homology 3 domain (or SH3B) of Intersectin | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|212946 cd12013, SH3_RIM-BP_3, Third Src homology 3 domain of Rab3-interacting molecules (RIMs) binding proteins | Back alignment and domain information |
|---|
| >gnl|CDD|236669 PRK10263, PRK10263, DNA translocase FtsK; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|212859 cd11926, SH3_SH3RF1_3, Third Src Homology 3 domain of SH3 domain containing ring finger 1, an E3 ubiquitin-protein ligase | Back alignment and domain information |
|---|
| >gnl|CDD|212880 cd11947, SH3_GRAP2_N, N-terminal Src homology 3 domain of GRB2-related adaptor protein 2 | Back alignment and domain information |
|---|
| >gnl|CDD|217393 pfam03154, Atrophin-1, Atrophin-1 family | Back alignment and domain information |
|---|
| >gnl|CDD|212852 cd11919, SH3_Sorbs1_1, First Src Homology 3 domain of Sorbin and SH3 domain containing 1 (Sorbs1), also called ponsin | Back alignment and domain information |
|---|
| >gnl|CDD|212857 cd11924, SH3_Vinexin_2, Second Src Homology 3 domain of Vinexin, also called Sorbin and SH3 domain containing 3 (Sorbs3) | Back alignment and domain information |
|---|
| >gnl|CDD|235124 PRK03427, PRK03427, cell division protein ZipA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|212860 cd11927, SH3_SH3RF1_1, First Src Homology 3 domain of SH3 domain containing ring finger protein 1, an E3 ubiquitin-protein ligase | Back alignment and domain information |
|---|
| >gnl|CDD|212804 cd11871, SH3_p67phox_N, N-terminal (or first) Src Homology 3 domain of the p67phox subunit of NADPH oxidase | Back alignment and domain information |
|---|
| >gnl|CDD|212863 cd11930, SH3_SH3RF1_2, Second Src Homology 3 domain of SH3 domain containing ring finger protein 1, an E3 ubiquitin-protein ligase | Back alignment and domain information |
|---|
| >gnl|CDD|212908 cd11975, SH3_ARHGEF9, Src homology 3 domain of the Rho guanine nucleotide exchange factor ARHGEF9 | Back alignment and domain information |
|---|
| >gnl|CDD|212778 cd11844, SH3_CAS, Src homology 3 domain of CAS (Crk-Associated Substrate) scaffolding proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212998 cd12065, SH3_GRAF2, Src Homology 3 domain of GTPase Regulator Associated with Focal adhesion kinase 2 | Back alignment and domain information |
|---|
| >gnl|CDD|212868 cd11935, SH3_Nebulette_C, C-terminal Src Homology 3 domain of Nebulette and LIM-nebulette (or Lasp2) | Back alignment and domain information |
|---|
| >gnl|CDD|212692 cd11758, SH3_CRK_N, N-terminal Src Homology 3 domain of Ct10 Regulator of Kinase adaptor proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212855 cd11922, SH3_Sorbs1_2, Second Src Homology 3 domain of Sorbin and SH3 domain containing 1 (Sorbs1), also called ponsin | Back alignment and domain information |
|---|
| >gnl|CDD|212779 cd11845, SH3_Src_like, Src homology 3 domain of Src kinase-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|212741 cd11807, SH3_ASPP, Src homology 3 domain of Apoptosis Stimulating of p53 proteins (ASPP) | Back alignment and domain information |
|---|
| >gnl|CDD|212933 cd12000, SH3_CASS4, Src homology 3 domain of CAS (Crk-Associated Substrate) scaffolding protein family member 4 | Back alignment and domain information |
|---|
| >gnl|CDD|212865 cd11932, SH3_SH3RF2_2, Second Src Homology 3 domain of SH3 domain containing ring finger 2 | Back alignment and domain information |
|---|
| >gnl|CDD|184918 PRK14954, PRK14954, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|212701 cd11767, SH3_Nck_3, Third Src Homology 3 domain of Nck adaptor proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212930 cd11997, SH3_PACSIN3, Src homology 3 domain of Protein kinase C and Casein kinase Substrate in Neurons 3 (PACSIN3) | Back alignment and domain information |
|---|
| >gnl|CDD|212792 cd11858, SH3_Myosin-I_fungi, Src homology 3 domain of Type I fungal Myosins | Back alignment and domain information |
|---|
| >gnl|CDD|212939 cd12006, SH3_Fyn_Yrk, Src homology 3 domain of Fyn and Yrk Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|212829 cd11896, SH3_SNX33, Src Homology 3 domain of Sorting Nexin 33 | Back alignment and domain information |
|---|
| >gnl|CDD|212879 cd11946, SH3_GRB2_N, N-terminal Src homology 3 domain of Growth factor receptor-bound protein 2 | Back alignment and domain information |
|---|
| >gnl|CDD|212898 cd11965, SH3_ASAP1, Src homology 3 domain of ArfGAP with SH3 domain, ankyrin repeat and PH domain containing protein 1 | Back alignment and domain information |
|---|
| >gnl|CDD|212744 cd11810, SH3_RUSC1_like, Src homology 3 domain of RUN and SH3 domain-containing proteins 1 and 2 | Back alignment and domain information |
|---|
| >gnl|CDD|213009 cd12076, SH3_Tks4_2, Second Src homology 3 domain of Tyrosine kinase substrate with four SH3 domains | Back alignment and domain information |
|---|
| >gnl|CDD|212861 cd11928, SH3_SH3RF3_1, First Src Homology 3 domain of SH3 domain containing ring finger 3, an E3 ubiquitin-protein ligase | Back alignment and domain information |
|---|
| >gnl|CDD|212997 cd12064, SH3_GRAF, Src Homology 3 domain of GTPase Regulator Associated with Focal adhesion kinase | Back alignment and domain information |
|---|
| >gnl|CDD|237605 PRK14086, dnaA, chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|227361 COG5028, COG5028, Vesicle coat complex COPII, subunit SEC24/subunit SFB2/subunit SFB3 [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >gnl|CDD|212953 cd12020, SH3_Tks5_5, Fifth (C-terminal) Src homology 3 domain of Tyrosine kinase substrate with five SH3 domains | Back alignment and domain information |
|---|
| >gnl|CDD|212785 cd11851, SH3_RIM-BP, Src homology 3 domains of Rab3-interacting molecules (RIMs) binding proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212889 cd11956, SH3_srGAP4, Src homology 3 domain of Slit-Robo GTPase Activating Protein 4 | Back alignment and domain information |
|---|
| >gnl|CDD|220309 pfam09606, Med15, ARC105 or Med15 subunit of Mediator complex non-fungal | Back alignment and domain information |
|---|
| >gnl|CDD|212887 cd11954, SH3_ASPP1, Src Homology 3 domain of Apoptosis Stimulating of p53 protein 1 | Back alignment and domain information |
|---|
| >gnl|CDD|212923 cd11990, SH3_Intersectin2_2, Second Src homology 3 domain (or SH3B) of Intersectin-2 | Back alignment and domain information |
|---|
| >gnl|CDD|212693 cd11759, SH3_CRK_C, C-terminal Src Homology 3 domain of Ct10 Regulator of Kinase adaptor proteins | Back alignment and domain information |
|---|
| >gnl|CDD|213010 cd12077, SH3_Tks5_2, Second Src homology 3 domain of Tyrosine kinase substrate with five SH3 domains | Back alignment and domain information |
|---|
| >gnl|CDD|212934 cd12001, SH3_BCAR1, Src homology 3 domain of the CAS (Crk-Associated Substrate) scaffolding protein family member, Breast Cancer Anti-estrogen Resistance 1 | Back alignment and domain information |
|---|
| >gnl|CDD|212921 cd11988, SH3_Intersectin2_1, First Src homology 3 domain (or SH3A) of Intersectin-2 | Back alignment and domain information |
|---|
| >gnl|CDD|212862 cd11929, SH3_SH3RF2_1, First Src Homology 3 domain of SH3 domain containing ring finger 2 | Back alignment and domain information |
|---|
| >gnl|CDD|212899 cd11966, SH3_ASAP2, Src homology 3 domain of ArfGAP with SH3 domain, ankyrin repeat and PH domain containing protein 2 | Back alignment and domain information |
|---|
| >gnl|CDD|212951 cd12018, SH3_Tks4_4, Fourth (C-terminal) Src homology 3 domain of Tyrosine kinase substrate with four SH3 domains | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 420 | |||
| KOG2546|consensus | 483 | 100.0 | ||
| PF07815 | 79 | Abi_HHR: Abl-interactor HHR; InterPro: IPR012849 T | 99.84 | |
| PF14604 | 49 | SH3_9: Variant SH3 domain; PDB: 2CRE_A 2E5K_A 2CT3 | 99.3 | |
| KOG2070|consensus | 661 | 99.24 | ||
| KOG0162|consensus | 1106 | 99.16 | ||
| PF07653 | 55 | SH3_2: Variant SH3 domain; InterPro: IPR011511 SH3 | 99.13 | |
| KOG4226|consensus | 379 | 99.05 | ||
| smart00326 | 58 | SH3 Src homology 3 domains. Src homology 3 (SH3) d | 98.85 | |
| KOG2199|consensus | 462 | 98.84 | ||
| PF00018 | 48 | SH3_1: SH3 domain; InterPro: IPR001452 SH3 (src Ho | 98.8 | |
| KOG1029|consensus | 1118 | 98.78 | ||
| KOG1118|consensus | 366 | 98.77 | ||
| KOG2996|consensus | 865 | 98.75 | ||
| cd00174 | 54 | SH3 Src homology 3 domains; SH3 domains bind to pr | 98.74 | |
| KOG4225|consensus | 489 | 98.67 | ||
| KOG4225|consensus | 489 | 98.62 | ||
| KOG4348|consensus | 627 | 98.55 | ||
| KOG4348|consensus | 627 | 98.55 | ||
| KOG2856|consensus | 472 | 98.51 | ||
| KOG1264|consensus | 1267 | 98.38 | ||
| KOG4792|consensus | 293 | 98.18 | ||
| KOG1029|consensus | 1118 | 98.18 | ||
| KOG4226|consensus | 379 | 98.0 | ||
| KOG3655|consensus | 484 | 97.93 | ||
| KOG1924|consensus | 1102 | 97.89 | ||
| KOG1843|consensus | 473 | 97.82 | ||
| KOG3523|consensus | 695 | 97.75 | ||
| KOG4792|consensus | 293 | 97.73 | ||
| KOG0515|consensus | 752 | 97.63 | ||
| KOG3875|consensus | 362 | 97.57 | ||
| KOG3601|consensus | 222 | 97.53 | ||
| KOG1702|consensus | 264 | 97.48 | ||
| KOG3632|consensus | 1335 | 97.45 | ||
| KOG2222|consensus | 848 | 97.19 | ||
| KOG4773|consensus | 386 | 96.83 | ||
| KOG1451|consensus | 812 | 96.75 | ||
| KOG1924|consensus | 1102 | 96.67 | ||
| KOG4278|consensus | 1157 | 96.62 | ||
| KOG2546|consensus | 483 | 96.19 | ||
| KOG3771|consensus | 460 | 95.94 | ||
| KOG3775|consensus | 482 | 95.81 | ||
| KOG4575|consensus | 874 | 95.75 | ||
| KOG4429|consensus | 421 | 95.43 | ||
| KOG0609|consensus | 542 | 95.37 | ||
| KOG3632|consensus | 1335 | 94.52 | ||
| KOG0197|consensus | 468 | 94.51 | ||
| PF08239 | 55 | SH3_3: Bacterial SH3 domain; InterPro: IPR013247 S | 94.35 | |
| KOG3557|consensus | 721 | 92.96 | ||
| smart00287 | 63 | SH3b Bacterial SH3 domain homologues. | 92.39 | |
| PF14603 | 89 | hSH3: Helically-extended SH3 domain; PDB: 1RI9_A. | 91.37 | |
| KOG0199|consensus | 1039 | 91.09 | ||
| PF06347 | 55 | SH3_4: Bacterial SH3 domain; InterPro: IPR010466 S | 89.04 | |
| KOG3725|consensus | 375 | 88.59 | ||
| PRK10884 | 206 | SH3 domain-containing protein; Provisional | 88.35 | |
| KOG3812|consensus | 475 | 86.63 | ||
| cd00193 | 60 | t_SNARE Soluble NSF (N-ethylmaleimide-sensitive fu | 86.44 | |
| smart00743 | 61 | Agenet Tudor-like domain present in plant sequence | 84.92 | |
| smart00397 | 66 | t_SNARE Helical region found in SNAREs. All alpha- | 84.41 | |
| KOG3565|consensus | 640 | 80.29 |
| >KOG2546|consensus | Back alignment and domain information |
|---|
Probab=100.00 E-value=4.4e-88 Score=677.70 Aligned_cols=391 Identities=47% Similarity=0.712 Sum_probs=307.2
Q ss_pred ChHHHHHHhhcchhhHHHHHHhHHhHHHHHHHHhhhccCCchhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q psy9761 1 MAELASLLTTEIPEGRTSLLDSHSNLEKVAEYCEGNYFQADNKRMALEETKNYTTQSLASVAYQINTLAYNFLQLLDLQT 80 (420)
Q Consensus 1 m~el~~~~~~~ip~~r~~L~~~~~nL~~vA~YCe~nY~~~~dk~~aleetk~y~~qsLasVayqIn~lA~~ll~lLd~Q~ 80 (420)
|+||++|||+|||++|++|+++|.||.+||||||+||+|+.||++||||||+|++|+|||||||||+||+++|+|||+|+
T Consensus 3 maelq~lie~eIp~gR~al~~s~~nL~rVadycednYiQs~~kk~aleetk~~ttQslasvaYqIN~la~~~l~mL~lQ~ 82 (483)
T KOG2546|consen 3 MAELQSLIESEIPDGRKALRSSYDNLPRVADYCEDNYIQSADKKAALEETKAYTTQSLASVAYQINTLAGHALRMLDLQA 82 (483)
T ss_pred HHHHHHHHHHhccccHHHHHHHHHhhHhhhhhhhhchhccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence 89999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred HHHHHHHHhhhhhhh-------------hceeeccccccccceeeCCCCCCCCCCccccCCCCCCccccCccccc---CC
Q psy9761 81 AQLEEMESQMNHIGQ-------------IGVLTANKTTNRQYKIIAPANPEKPIKYVRKPIDLNALDDIGHGVRN---AP 144 (420)
Q Consensus 81 ~~~~~~e~~i~~l~q-------------ig~lt~~k~~~r~~ki~~p~~~e~~~~y~r~pi~y~~ld~vGhg~~~---~~ 144 (420)
.+|+.||++|++|+| ||+||+||+.+|+||||+|+++|.+++|+|+||||++||+||||||. ..
T Consensus 83 ~~L~~mEs~vn~isq~V~ihkekvArreIg~lttnk~~~r~hkiIap~nl~~~iryvrkPid~~mLd~igHGIr~~~~~r 162 (483)
T KOG2546|consen 83 PQLRYMESQVNHISQTVDIHKEKVARREIGNLTTNKGLSRQHKIIAPANLEVPIRYVRKPIDYSMLDDIGHGIRGSWETR 162 (483)
T ss_pred HHHHHHHhhhhhhhhhheecchhhhhhhccceeeccccccccceeccccCCCCccceeccccceeeeccccccccccccc
Confidence 999999999999999 99999999999999999999999999999999999999999999996 23
Q ss_pred CCCCCCCCccccccCCCCCCCCCCCCCCC-----CccccccccCCCCCCCCCCCCCCCCCCCCCCCCCC----CCCCCC-
Q psy9761 145 RNKQRTPSQSNICVVPGPPAPTTKPPTPP-----SVIRSTGTLKNSREYRTPPAVAPPQVPSHYAPNYP----IGHPKR- 214 (420)
Q Consensus 145 ~~~~~~~~~gt~~r~~~~~~~t~kpp~p~-----~~~~~~gtLg~~~~yrt~~pv~pP~vp~~~~~~~~----~~~~~~- 214 (420)
+ ..+.+++|+|+|+ +++++|+++|+ ++++ |||||+++|||+++|.||+||++|++++. ++|+.|
T Consensus 163 g-~~~g~~t~~l~rs---~pstqk~paPp~~v~~~srt--~tlGr~~~~Rtl~pv~pp~vP~~Y~~~~~~~~~~~s~~rm 236 (483)
T KOG2546|consen 163 G-RFDGTSTGKLSRS---GPSTQKPPAPPLVVELGSRT--GTLGRCQEYRTLEPVLPPLVPSDYAPDYTEKYLHQSPKRM 236 (483)
T ss_pred c-CcCcccccccCCC---CCcccCCCCCchhhhcCccc--cccccCCccccCCccCCCCCcccccccccccccccchhhh
Confidence 3 6667899999999 79999999999 6666 99999999999999999999999999985 357777
Q ss_pred ----cCCCCC-CCC-----------CCCCCCCCCCCCCCCCCCC-----CCCC-CCCCCC--------CCCCCCchhHHH
Q psy9761 215 ----ERGPGY-GTL-----------PQVGMVHPLPPPPPENMPP-----HPQQ-QDPRSH--------YGQFSLAQQQQQ 264 (420)
Q Consensus 215 ----~~~~~~-g~~-----------~~~g~~~~~p~P~pps~~P-----PP~p-~~~~~~--------~~~~~~pp~~~~ 264 (420)
++++++ ++. +.+|.+++...+.++...+ ++.. ...++| ..++.+.+++..
T Consensus 237 ~~~n~~~~t~~~~~~~~gt~~~sg~g~~g~q~a~~~~~~p~~~~~~~~q~~~~~~~~~~~~~t~~~~~s~~~lr~~q~~a 316 (483)
T KOG2546|consen 237 ASDNSKDYTVKALVDHLGTVESSGGGLFGHQNADGSTAPPRASCVQAIQPPVCVCSFHQQLLTCRGYISKPGLRQQQLLA 316 (483)
T ss_pred hhhcccccccccccccccccccccccccCCcCCCCCCCCCccccccccCCceeeeecccCccccccccccccccchhhhc
Confidence 455555 211 5567888887776664332 1110 111112 144666666665
Q ss_pred HHHHHhhhHHHHHhhcCCCCCCCCCCCCCCCCCCCCCCCCCCCc--------------ccCC---CCCCCCCCCCC-Ccc
Q psy9761 265 QAQLAHHLQQQQMMSANMGNNPQMGNSHMANNPQPPNAHPPPSQ--------------YQAG---MMSQQPPPPPS-MQQ 326 (420)
Q Consensus 265 ~~~~~~~~~~~~~~~~~~g~~p~~~~~~~~~~~~pp~ppPP~~~--------------~~~~---~~~p~PPPPpp-~p~ 326 (420)
+... ++. .+++ | .+.++...-.|+||... .+.. .+.++||+++. .++
T Consensus 317 ~~p~---q~~-----~~~~--P-----~~~n~~vs~aP~pp~~~qq~~q~~~~~~~~~~~~~i~~~~tsppp~~~~~~~~ 381 (483)
T KOG2546|consen 317 VIPL---QPK-----HPIP--P-----NSVNKRVSFAPPPPTDTQQNQQQPISRGVMSSQRNLNRNDTSPPPSPPSNQPG 381 (483)
T ss_pred cccc---ccC-----CCCC--C-----ccccCccccCCCCCcchhhchhhHHhhhhhhhccccccccCCCCCCCccccCC
Confidence 5443 111 3333 2 22333333333333222 1122 12222332222 267
Q ss_pred CCCCCCCCCCCCCCCCCCCcccCCCCccccCCCCCCCCCCCCCccccccccC------------CccccCCCCEEEEEEe
Q psy9761 327 RSSSPPLPPPPTSAGQMDDHVNFGQPQAVRNGGIVPRDQDLPGWVPKNYIEK------------DELSFQESAVIYVLKK 394 (420)
Q Consensus 327 ~~~~pPPPPPP~~~g~~sd~~~~~~~~~s~~~~~~P~~~~~~~~v~~~Y~~~------------dELSf~kGDiI~Vl~k 394 (420)
+++.||||+++.. .++.++.+......+|.++++.|++..|.++ |||+|.+|.+|+|++|
T Consensus 382 ~~dlppPp~~~~~--------~~g~ee~st~~~~~~~ap~sp~w~p~syLEkVv~iydy~~~KddeLsf~E~ailyv~kk 453 (483)
T KOG2546|consen 382 PDDLPPPPPKSLS--------DLGREEKSTLPQPPPVAPSSPAWVPTSYLEKVVAIYDYTADKDDELSFAEGAILYVLKK 453 (483)
T ss_pred CCCCCCCCCCccc--------cccccccccCCCCCCCCCCCcccccHHHHHHHHhhcccccccccccccccccEEEEEEe
Confidence 7777765554322 1665444444455578889999999888665 9999999999999999
Q ss_pred cCCCeeEEEECCeeeEecCCCeeccC
Q psy9761 395 NDDGWWEGVMDGITGLFPGNYVEPCV 420 (420)
Q Consensus 395 ~~~GWweG~~~G~~G~FPsnYVe~i~ 420 (420)
++||||||.++|++|+||+|||+.|+
T Consensus 454 nddgw~EgV~~~VTglFpgnyve~~~ 479 (483)
T KOG2546|consen 454 NDDGWYEGVQDGVTGLFPGNYVEPLK 479 (483)
T ss_pred cCCcchhheecCcceeccCccccccc
Confidence 99999999999999999999999875
|
|
| >PF07815 Abi_HHR: Abl-interactor HHR; InterPro: IPR012849 The region is found towards the N terminus of a number of adaptor proteins that interact with Abl-family tyrosine kinases [] | Back alignment and domain information |
|---|
| >PF14604 SH3_9: Variant SH3 domain; PDB: 2CRE_A 2E5K_A 2CT3_A 2DE0_X 2D8H_A 2DA9_A 2X3X_E 2X3W_D 2KRN_A 2ED0_A | Back alignment and domain information |
|---|
| >KOG2070|consensus | Back alignment and domain information |
|---|
| >KOG0162|consensus | Back alignment and domain information |
|---|
| >PF07653 SH3_2: Variant SH3 domain; InterPro: IPR011511 SH3 (src Homology-3) domains are small protein modules containing approximately 50 amino acid residues [, ] | Back alignment and domain information |
|---|
| >KOG4226|consensus | Back alignment and domain information |
|---|
| >smart00326 SH3 Src homology 3 domains | Back alignment and domain information |
|---|
| >KOG2199|consensus | Back alignment and domain information |
|---|
| >PF00018 SH3_1: SH3 domain; InterPro: IPR001452 SH3 (src Homology-3) domains are small protein modules containing approximately 50 amino acid residues [, ] | Back alignment and domain information |
|---|
| >KOG1029|consensus | Back alignment and domain information |
|---|
| >KOG1118|consensus | Back alignment and domain information |
|---|
| >KOG2996|consensus | Back alignment and domain information |
|---|
| >cd00174 SH3 Src homology 3 domains; SH3 domains bind to proline-rich ligands with moderate affinity and selectivity, preferentially to PxxP motifs; they play a role in the regulation of enzymes by intramolecular interactions, changing the subcellular localization of signal pathway components and mediate multiprotein complex assemblies | Back alignment and domain information |
|---|
| >KOG4225|consensus | Back alignment and domain information |
|---|
| >KOG4225|consensus | Back alignment and domain information |
|---|
| >KOG4348|consensus | Back alignment and domain information |
|---|
| >KOG4348|consensus | Back alignment and domain information |
|---|
| >KOG2856|consensus | Back alignment and domain information |
|---|
| >KOG1264|consensus | Back alignment and domain information |
|---|
| >KOG4792|consensus | Back alignment and domain information |
|---|
| >KOG1029|consensus | Back alignment and domain information |
|---|
| >KOG4226|consensus | Back alignment and domain information |
|---|
| >KOG3655|consensus | Back alignment and domain information |
|---|
| >KOG1924|consensus | Back alignment and domain information |
|---|
| >KOG1843|consensus | Back alignment and domain information |
|---|
| >KOG3523|consensus | Back alignment and domain information |
|---|
| >KOG4792|consensus | Back alignment and domain information |
|---|
| >KOG0515|consensus | Back alignment and domain information |
|---|
| >KOG3875|consensus | Back alignment and domain information |
|---|
| >KOG3601|consensus | Back alignment and domain information |
|---|
| >KOG1702|consensus | Back alignment and domain information |
|---|
| >KOG3632|consensus | Back alignment and domain information |
|---|
| >KOG2222|consensus | Back alignment and domain information |
|---|
| >KOG4773|consensus | Back alignment and domain information |
|---|
| >KOG1451|consensus | Back alignment and domain information |
|---|
| >KOG1924|consensus | Back alignment and domain information |
|---|
| >KOG4278|consensus | Back alignment and domain information |
|---|
| >KOG2546|consensus | Back alignment and domain information |
|---|
| >KOG3771|consensus | Back alignment and domain information |
|---|
| >KOG3775|consensus | Back alignment and domain information |
|---|
| >KOG4575|consensus | Back alignment and domain information |
|---|
| >KOG4429|consensus | Back alignment and domain information |
|---|
| >KOG0609|consensus | Back alignment and domain information |
|---|
| >KOG3632|consensus | Back alignment and domain information |
|---|
| >KOG0197|consensus | Back alignment and domain information |
|---|
| >PF08239 SH3_3: Bacterial SH3 domain; InterPro: IPR013247 SH3 (src Homology-3) domains are small protein modules containing approximately 50 amino acid residues [, ] | Back alignment and domain information |
|---|
| >KOG3557|consensus | Back alignment and domain information |
|---|
| >smart00287 SH3b Bacterial SH3 domain homologues | Back alignment and domain information |
|---|
| >PF14603 hSH3: Helically-extended SH3 domain; PDB: 1RI9_A | Back alignment and domain information |
|---|
| >KOG0199|consensus | Back alignment and domain information |
|---|
| >PF06347 SH3_4: Bacterial SH3 domain; InterPro: IPR010466 SH3 (src Homology-3) domains are small protein modules containing approximately 50 amino acid residues [, ] | Back alignment and domain information |
|---|
| >KOG3725|consensus | Back alignment and domain information |
|---|
| >PRK10884 SH3 domain-containing protein; Provisional | Back alignment and domain information |
|---|
| >KOG3812|consensus | Back alignment and domain information |
|---|
| >cd00193 t_SNARE Soluble NSF (N-ethylmaleimide-sensitive fusion protein)-Attachment protein (SNAP) REceptor domain; these alpha-helical motifs form twisted and parallel heterotetrameric helix bundles; the core complex contains one helix from a protein that is anchored in the vesicle membrane (synaptobrevin), one helix from a protein of the target membrane (syntaxin), and two helices from another protein anchored in the target membrane (SNAP-25); their interaction forms a core which is composed of a polar zero layer, a flanking leucine-zipper layer acts as a water tight shield to isolate ionic interactions in the zero layer from the surrounding solvent | Back alignment and domain information |
|---|
| >smart00743 Agenet Tudor-like domain present in plant sequences | Back alignment and domain information |
|---|
| >smart00397 t_SNARE Helical region found in SNAREs | Back alignment and domain information |
|---|
| >KOG3565|consensus | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 420 | ||||
| 3p8c_F | 159 | Structure And Control Of The Actin Regulatory Wave | 8e-49 | ||
| 2ed0_A | 78 | Solution Structure Of The Sh3 Domain Of Abl Interac | 9e-17 | ||
| 3gf9_A | 295 | Crystal Structure Of Human Intersectin 2 Rhogef Dom | 1e-07 | ||
| 1udl_A | 98 | The Solution Structure Of The Fifth Sh3 Domain Of I | 3e-07 | ||
| 1zsg_A | 65 | Beta Pix-Sh3 Complexed With An Atypical Peptide Fro | 1e-06 | ||
| 2df6_A | 59 | Crystal Structure Of The Sh3 Domain Of Betapix In C | 2e-06 | ||
| 2esw_A | 61 | Atomic Structure Of The N-Terminal Sh3 Domain Of Mo | 2e-06 | ||
| 3ulr_B | 65 | Lysozyme Contamination Facilitates Crystallization | 3e-06 | ||
| 2ak5_A | 64 | Beta Pix-Sh3 Complexed With A Cbl-B Peptide Length | 4e-06 | ||
| 1ujy_A | 76 | Solution Structure Of Sh3 Domain In RacCDC42 GUANIN | 4e-06 | ||
| 2js0_A | 61 | Solution Structure Of Second Sh3 Domain Of Adaptor | 4e-06 | ||
| 2d1x_A | 66 | The Crystal Structure Of The Cortactin-Sh3 Domain A | 4e-06 | ||
| 3jv3_A | 283 | Structure Of Sh3e-Dh Unit Of Murine Intersectin-1l | 6e-06 | ||
| 1x69_A | 79 | Solution Structures Of The Sh3 Domain Of Human Src | 8e-06 | ||
| 1wi7_A | 68 | Solution Structure Of The Sh3 Domain Of Sh3-Domain | 9e-06 | ||
| 2cub_A | 88 | Solution Structure Of The Sh3 Domain Of The Human C | 1e-05 | ||
| 2o2o_A | 92 | Solution Structure Of Domain B From Human Cin85 Pro | 1e-05 | ||
| 2frw_A | 57 | Solution Structure Of The Second Sh3 Domain Of Huma | 1e-05 | ||
| 1uti_A | 58 | MonaGADS SH3C IN COMPLEX WITH HPK DERIVED PEPTIDE L | 2e-05 | ||
| 1h3h_A | 60 | Structural Basis For Specific Recognition Of An Rxx | 2e-05 | ||
| 1zlm_A | 58 | Crystal Structure Of The Sh3 Domain Of Human Osteoc | 2e-05 | ||
| 1oeb_A | 62 | MonaGADS SH3C DOMAIN Length = 62 | 2e-05 | ||
| 2d0n_A | 59 | Crystal Structure Of The C-Terminal Sh3 Domain Of T | 3e-05 | ||
| 1k76_A | 62 | Solution Structure Of The C-Terminal Sem-5 Sh3 Doma | 3e-05 | ||
| 2xmf_A | 60 | Myosin 1e Sh3 Length = 60 | 3e-05 | ||
| 1x2k_A | 68 | Solution Structure Of The Sh3 Domain Of Human Osteo | 4e-05 | ||
| 2vvk_A | 56 | Grb2 Sh3c (1) Length = 56 | 4e-05 | ||
| 2bz8_A | 58 | N-Terminal Sh3 Domain Of Cin85 Bound To Cbl-B Pepti | 4e-05 | ||
| 1io6_A | 59 | Growth Factor Receptor-Bound Protein 2 (Grb2) C-Ter | 4e-05 | ||
| 1sem_A | 58 | Structural Determinants Of Peptide-Binding Orientat | 4e-05 | ||
| 3sem_A | 60 | Sem5 Sh3 Domain Complexed With Peptoid Inhibitor Le | 6e-05 | ||
| 1gcq_A | 61 | Crystal Structure Of Vav And Grb2 Sh3 Domains Lengt | 6e-05 | ||
| 1gri_A | 217 | Grb2 Length = 217 | 7e-05 | ||
| 2drm_A | 58 | Acanthamoeba Myosin I Sh3 Domain Bound To Acan125 L | 7e-05 | ||
| 2drk_A | 59 | Acanthamoeba Myosin I Sh3 Domain Bound To Acan125 L | 8e-05 | ||
| 2dl7_A | 73 | Solution Structure Of The Second Sh3 Domain Of Huma | 8e-05 | ||
| 3ehq_A | 222 | Crystal Structure Of Human Osteoclast Stimulating F | 8e-05 | ||
| 1y0m_A | 61 | Crystal Structure Of Of The Sh3 Domain Of Phospholi | 1e-04 | ||
| 1oot_A | 60 | Crystal Structure Of The Sh3 Domain From A S. Cerev | 1e-04 | ||
| 1uj0_A | 62 | Crystal Structure Of Stam2 Sh3 Domain In Complex Wi | 2e-04 | ||
| 1ywo_A | 64 | Phospholipase Cgamma1 Sh3 In Complex With A Slp-76 | 2e-04 | ||
| 2vwf_A | 58 | Grb2 Sh3c (2) Length = 58 | 2e-04 | ||
| 2jte_A | 64 | Third Sh3 Domain Of Cd2ap Length = 64 | 2e-04 | ||
| 2ydl_A | 69 | Crystal Structure Of Sh3c From Cin85 Length = 69 | 3e-04 | ||
| 2k6d_A | 62 | Cin85 Sh3-C Domain In Complex With Ubiquitin Length | 3e-04 | ||
| 2lj0_A | 65 | The Third Sh3 Domain Of R85fl Length = 65 | 3e-04 | ||
| 2k9g_A | 73 | Solution Structure Of The Third Sh3 Domain Of The C | 3e-04 | ||
| 4e6r_A | 58 | Crystal Structure Of A Cytoplasmic Protein Nck2 (Nc | 3e-04 | ||
| 2da9_A | 70 | Solution Structure Of The Third Sh3 Domain Of Sh3-D | 3e-04 | ||
| 2lj1_A | 64 | The Third Sh3 Domain Of R85fl With Ataxin-7 Prr Len | 4e-04 | ||
| 2kbt_A | 142 | Attachment Of An Nmr-Invisible Solubility Enhanceme | 4e-04 | ||
| 3iql_A | 71 | Crystal Structure Of The Rat Endophilin-A1 Sh3 Doma | 5e-04 | ||
| 2ew3_A | 68 | Solution Structure Of The Sh3 Domain Of Human Sh3gl | 6e-04 | ||
| 1hsq_A | 71 | Solution Structure Of The Sh3 Domain Of Phospholipa | 7e-04 | ||
| 4glm_A | 72 | Crystal Structure Of The Sh3 Domain Of Dnmbp Protei | 7e-04 | ||
| 2dbm_A | 73 | Solution Structures Of The Sh3 Domain Of Human Sh3- | 8e-04 |
| >pdb|3P8C|F Chain F, Structure And Control Of The Actin Regulatory Wave Complex Length = 159 | Back alignment and structure |
|
| >pdb|2ED0|A Chain A, Solution Structure Of The Sh3 Domain Of Abl Interactor 2 (Abelson Interactor 2) Length = 78 | Back alignment and structure |
| >pdb|3GF9|A Chain A, Crystal Structure Of Human Intersectin 2 Rhogef Domain Length = 295 | Back alignment and structure |
| >pdb|1UDL|A Chain A, The Solution Structure Of The Fifth Sh3 Domain Of Intersectin 2 (Kiaa1256) Length = 98 | Back alignment and structure |
| >pdb|1ZSG|A Chain A, Beta Pix-Sh3 Complexed With An Atypical Peptide From Alpha- Pak Length = 65 | Back alignment and structure |
| >pdb|2DF6|A Chain A, Crystal Structure Of The Sh3 Domain Of Betapix In Complex With A High Affinity Peptide From Pak2 Length = 59 | Back alignment and structure |
| >pdb|2ESW|A Chain A, Atomic Structure Of The N-Terminal Sh3 Domain Of Mouse Beta Pix,P21-Activated Kinase (Pak)-Interacting Exchange Factor Length = 61 | Back alignment and structure |
| >pdb|3ULR|B Chain B, Lysozyme Contamination Facilitates Crystallization Of A Hetero- Trimericcortactin:arg:lysozyme Complex Length = 65 | Back alignment and structure |
| >pdb|2AK5|A Chain A, Beta Pix-Sh3 Complexed With A Cbl-B Peptide Length = 64 | Back alignment and structure |
| >pdb|1UJY|A Chain A, Solution Structure Of Sh3 Domain In RacCDC42 GUANINE Nucleotide Exchange Factor(Gef) 6 Length = 76 | Back alignment and structure |
| >pdb|2JS0|A Chain A, Solution Structure Of Second Sh3 Domain Of Adaptor Nck Length = 61 | Back alignment and structure |
| >pdb|2D1X|A Chain A, The Crystal Structure Of The Cortactin-Sh3 Domain And Amap1- Peptide Complex Length = 66 | Back alignment and structure |
| >pdb|3JV3|A Chain A, Structure Of Sh3e-Dh Unit Of Murine Intersectin-1l Length = 283 | Back alignment and structure |
| >pdb|1X69|A Chain A, Solution Structures Of The Sh3 Domain Of Human Src Substrate Cortactin Length = 79 | Back alignment and structure |
| >pdb|1WI7|A Chain A, Solution Structure Of The Sh3 Domain Of Sh3-Domain Kinase Binding Protein 1 Length = 68 | Back alignment and structure |
| >pdb|2CUB|A Chain A, Solution Structure Of The Sh3 Domain Of The Human Cytoplasmic Protein Nck1 Length = 88 | Back alignment and structure |
| >pdb|2O2O|A Chain A, Solution Structure Of Domain B From Human Cin85 Protein Length = 92 | Back alignment and structure |
| >pdb|2FRW|A Chain A, Solution Structure Of The Second Sh3 Domain Of Human Adaptor Protein Nck2 Length = 57 | Back alignment and structure |
| >pdb|1UTI|A Chain A, MonaGADS SH3C IN COMPLEX WITH HPK DERIVED PEPTIDE Length = 58 | Back alignment and structure |
| >pdb|1H3H|A Chain A, Structural Basis For Specific Recognition Of An Rxxk-Containing Slp-76 Peptide By The Gads C-Terminal Sh3 Domain Length = 60 | Back alignment and structure |
| >pdb|1ZLM|A Chain A, Crystal Structure Of The Sh3 Domain Of Human Osteoclast Stimulating Factor Length = 58 | Back alignment and structure |
| >pdb|1OEB|A Chain A, MonaGADS SH3C DOMAIN Length = 62 | Back alignment and structure |
| >pdb|2D0N|A Chain A, Crystal Structure Of The C-Terminal Sh3 Domain Of The Adaptor Protein Gads In Complex With Slp-76 Motif Peptide Reveals A Unique Sh3-Sh3 Interaction Length = 59 | Back alignment and structure |
| >pdb|1K76|A Chain A, Solution Structure Of The C-Terminal Sem-5 Sh3 Domain (Minimized Average Structure) Length = 62 | Back alignment and structure |
| >pdb|2XMF|A Chain A, Myosin 1e Sh3 Length = 60 | Back alignment and structure |
| >pdb|1X2K|A Chain A, Solution Structure Of The Sh3 Domain Of Human Osteoclast Stimulating Factor 1 (Ostf1) Length = 68 | Back alignment and structure |
| >pdb|2VVK|A Chain A, Grb2 Sh3c (1) Length = 56 | Back alignment and structure |
| >pdb|2BZ8|A Chain A, N-Terminal Sh3 Domain Of Cin85 Bound To Cbl-B Peptide Length = 58 | Back alignment and structure |
| >pdb|1IO6|A Chain A, Growth Factor Receptor-Bound Protein 2 (Grb2) C-Terminal Sh3 Domain Complexed With A Ligand Peptide (Nmr, Minimized Mean Structure) Length = 59 | Back alignment and structure |
| >pdb|1SEM|A Chain A, Structural Determinants Of Peptide-Binding Orientation And Of Sequence Specificity In Sh3 Domains Length = 58 | Back alignment and structure |
| >pdb|3SEM|A Chain A, Sem5 Sh3 Domain Complexed With Peptoid Inhibitor Length = 60 | Back alignment and structure |
| >pdb|1GCQ|A Chain A, Crystal Structure Of Vav And Grb2 Sh3 Domains Length = 61 | Back alignment and structure |
| >pdb|1GRI|A Chain A, Grb2 Length = 217 | Back alignment and structure |
| >pdb|2DRM|A Chain A, Acanthamoeba Myosin I Sh3 Domain Bound To Acan125 Length = 58 | Back alignment and structure |
| >pdb|2DRK|A Chain A, Acanthamoeba Myosin I Sh3 Domain Bound To Acan125 Length = 59 | Back alignment and structure |
| >pdb|2DL7|A Chain A, Solution Structure Of The Second Sh3 Domain Of Human Kiaa0769 Protein Length = 73 | Back alignment and structure |
| >pdb|3EHQ|A Chain A, Crystal Structure Of Human Osteoclast Stimulating Factor Length = 222 | Back alignment and structure |
| >pdb|1Y0M|A Chain A, Crystal Structure Of Of The Sh3 Domain Of Phospholipase C Gamma-1 Length = 61 | Back alignment and structure |
| >pdb|1OOT|A Chain A, Crystal Structure Of The Sh3 Domain From A S. Cerevisiae Hypothetical 40.4 Kda Protein At 1.39 A Resolution Length = 60 | Back alignment and structure |
| >pdb|1UJ0|A Chain A, Crystal Structure Of Stam2 Sh3 Domain In Complex With A Ubpy-Derived Peptide Length = 62 | Back alignment and structure |
| >pdb|1YWO|A Chain A, Phospholipase Cgamma1 Sh3 In Complex With A Slp-76 Motif Length = 64 | Back alignment and structure |
| >pdb|2VWF|A Chain A, Grb2 Sh3c (2) Length = 58 | Back alignment and structure |
| >pdb|2JTE|A Chain A, Third Sh3 Domain Of Cd2ap Length = 64 | Back alignment and structure |
| >pdb|2YDL|A Chain A, Crystal Structure Of Sh3c From Cin85 Length = 69 | Back alignment and structure |
| >pdb|2K6D|A Chain A, Cin85 Sh3-C Domain In Complex With Ubiquitin Length = 62 | Back alignment and structure |
| >pdb|2LJ0|A Chain A, The Third Sh3 Domain Of R85fl Length = 65 | Back alignment and structure |
| >pdb|2K9G|A Chain A, Solution Structure Of The Third Sh3 Domain Of The Cin85 Adapter Protein Length = 73 | Back alignment and structure |
| >pdb|4E6R|A Chain A, Crystal Structure Of A Cytoplasmic Protein Nck2 (Nck2) From Homo Sapiens At 2.20 A Resolution Length = 58 | Back alignment and structure |
| >pdb|2DA9|A Chain A, Solution Structure Of The Third Sh3 Domain Of Sh3-Domain Kinase Binding Protein 1 (Regulator Of Ubiquitous Kinase, Ruk) Length = 70 | Back alignment and structure |
| >pdb|2LJ1|A Chain A, The Third Sh3 Domain Of R85fl With Ataxin-7 Prr Length = 64 | Back alignment and structure |
| >pdb|2KBT|A Chain A, Attachment Of An Nmr-Invisible Solubility Enhancement Tag (Inset) Using A Sortase-Mediated Protein Ligation Method Length = 142 | Back alignment and structure |
| >pdb|3IQL|A Chain A, Crystal Structure Of The Rat Endophilin-A1 Sh3 Domain Length = 71 | Back alignment and structure |
| >pdb|2EW3|A Chain A, Solution Structure Of The Sh3 Domain Of Human Sh3gl3 Length = 68 | Back alignment and structure |
| >pdb|1HSQ|A Chain A, Solution Structure Of The Sh3 Domain Of Phospholipase Cgamma Length = 71 | Back alignment and structure |
| >pdb|4GLM|A Chain A, Crystal Structure Of The Sh3 Domain Of Dnmbp Protein [homo Sapiens] Length = 72 | Back alignment and structure |
| >pdb|2DBM|A Chain A, Solution Structures Of The Sh3 Domain Of Human Sh3- Containing Grb2-Like Protein 2 Length = 73 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 420 | |||
| 3p8c_F | 159 | ABL interactor 2; actin polymerization, protein bi | 2e-63 | |
| 2bz8_A | 58 | SH3-domain kinase binding protein 1; SH3 domain, C | 5e-20 | |
| 2drm_A | 58 | Acanthamoeba myosin IB; SH3 domain, contractIle pr | 2e-19 | |
| 2g6f_X | 59 | RHO guanine nucleotide exchange factor 7; SH3 doma | 2e-19 | |
| 2ed0_A | 78 | ABL interactor 2; coiled coil, cytoskeleton, nucle | 2e-19 | |
| 1k4u_S | 62 | Phagocyte NADPH oxidase subunit P67PHOX; SH3-pepti | 2e-19 | |
| 2ak5_A | 64 | RHO guanine nucleotide exchange factor 7; adaptor | 3e-19 | |
| 1zx6_A | 58 | YPR154WP; SH3 domain, protein binding; 1.60A {Sacc | 5e-19 | |
| 1uti_A | 58 | GRB2-related adaptor protein 2; signaling protein | 5e-19 | |
| 1sem_A | 58 | SEM-5; SRC-homology 3 (SH3) domain, peptide-bindin | 6e-19 | |
| 1zlm_A | 58 | Osteoclast stimulating factor 1; beta barrel, sign | 6e-19 | |
| 2xmf_A | 60 | Myosin 1E SH3; motor protein, SH3 domain; HET: DIA | 7e-19 | |
| 2vwf_A | 58 | Growth factor receptor-bound protein 2; polymorphi | 9e-19 | |
| 1uj0_A | 62 | Signal transducing adaptor molecule (SH3 domain an | 1e-18 | |
| 4f14_A | 64 | Nebulette; SH3 domain, heart muscle, actin-binding | 1e-18 | |
| 2dnu_A | 71 | RUH-061, SH3 multiple domains 1; RSGI, structural | 2e-18 | |
| 2dil_A | 69 | Proline-serine-threonine phosphatase-interacting p | 2e-18 | |
| 1x2k_A | 68 | OSTF1, osteoclast stimulating factor 1; SH3 domain | 2e-18 | |
| 2dmo_A | 68 | Neutrophil cytosol factor 2; SH3 domain, structura | 2e-18 | |
| 2j6f_A | 62 | CD2-associated protein; metal-binding, immune resp | 2e-18 | |
| 1y0m_A | 61 | 1-phosphatidylinositol-4,5-bisphosphate phosphodie | 3e-18 | |
| 2fei_A | 65 | CD2-associated protein; CMS SH3 domain, structural | 3e-18 | |
| 1wi7_A | 68 | SH3-domain kinase binding protein 1; beta barrel, | 3e-18 | |
| 3ulr_B | 65 | SRC substrate cortactin; SH3, protein-protein inte | 3e-18 | |
| 2gnc_A | 60 | SLIT-ROBO RHO GTPase-activating protein 1; beta ba | 5e-18 | |
| 3u23_A | 65 | CD2-associated protein; structural genomics, struc | 5e-18 | |
| 1ujy_A | 76 | RHO guanine nucleotide exchange factor 6; structur | 6e-18 | |
| 2jte_A | 64 | CD2-associated protein; SH3 domain, coiled coil, c | 7e-18 | |
| 1x69_A | 79 | Cortactin isoform A; SH3 domain, CTTN, oncogene EM | 8e-18 | |
| 2ega_A | 70 | SH3 and PX domain-containing protein 2A; SH3 domai | 9e-18 | |
| 2a28_A | 54 | BZZ1 protein; SH3 domain, signaling protein; 1.07A | 1e-17 | |
| 1w70_A | 60 | Neutrophil cytosol factor 4; NADPH oxidase, P40PHO | 1e-17 | |
| 2eqi_A | 69 | Phospholipase C, gamma 2; SH3 domain, PLCG2, struc | 1e-17 | |
| 1x2p_A | 68 | Protein arginine N-methyltransferase 2; SH3 domain | 1e-17 | |
| 2dl8_A | 72 | SLIT-ROBO RHO GTPase-activating protein 2; SH3 dom | 2e-17 | |
| 2dl3_A | 68 | Sorbin and SH3 domain-containing protein 1; ponsin | 2e-17 | |
| 3ngp_A | 62 | Spectrin alpha chain, brain; beta barrel, structur | 3e-17 | |
| 2l0a_A | 72 | STAM-1, signal transducing adapter molecule 1; str | 4e-17 | |
| 2nwm_A | 65 | Vinexin; cell adhesion; NMR {Homo sapiens} Length | 4e-17 | |
| 2cub_A | 88 | Cytoplasmic protein NCK1; SH3 domain, NCK1 adaptor | 4e-17 | |
| 1hsq_A | 71 | Phospholipase C-gamma (SH3 domain); phosphoric die | 4e-17 | |
| 2yun_A | 79 | Nostrin; nitric oxide synthase trafficker, structu | 6e-17 | |
| 2djq_A | 68 | SH3 domain containing ring finger 2; MUS musculus | 6e-17 | |
| 1oot_A | 60 | Hypothetical 40.4 kDa protein in PES4-His2 interge | 6e-17 | |
| 2dl7_A | 73 | KIAA0769 protein; SH3 domain, FCHSD2, structural g | 6e-17 | |
| 1udl_A | 98 | Intersectin 2, KIAA1256; beta barrel, SH3 domain, | 6e-17 | |
| 2dl4_A | 68 | Protein STAC; SH3 domain, STAC protein, SRC homolo | 6e-17 | |
| 2fpe_A | 62 | C-JUN-amino-terminal kinase interacting protein 1; | 1e-16 | |
| 2ct3_A | 70 | Vinexin; SH3 domian, structural genomics, NPPSFA, | 1e-16 | |
| 1uhf_A | 69 | Intersectin 2; beta barrel, SH3 domain, riken stru | 1e-16 | |
| 2cuc_A | 70 | SH3 domain containing ring finger 2; structural ge | 1e-16 | |
| 2ydl_A | 69 | SH3 domain-containing kinase-binding protein 1; si | 2e-16 | |
| 2da9_A | 70 | SH3-domain kinase binding protein 1; structural ge | 2e-16 | |
| 2x3w_D | 60 | Syndapin I, protein kinase C and casein kinase sub | 3e-16 | |
| 2yuo_A | 78 | CIP85, RUN and TBC1 domain containing 3; structura | 3e-16 | |
| 2ebp_A | 73 | SAM and SH3 domain-containing protein 1; proline-g | 3e-16 | |
| 2dm1_A | 73 | Protein VAV-2; RHO family guanine nucleotide excha | 4e-16 | |
| 2k9g_A | 73 | SH3 domain-containing kinase-binding protein 1; CI | 4e-16 | |
| 1ugv_A | 72 | KIAA0621, olygophrenin-1 like protein; beta barrel | 5e-16 | |
| 1x2q_A | 88 | Signal transducing adapter molecule 2; SH3 domain, | 5e-16 | |
| 1yn8_A | 59 | NBP2, NAP1-binding protein 2; SH3 domain, unknown | 5e-16 | |
| 2epd_A | 76 | RHO GTPase-activating protein 4; SH3 domain, struc | 5e-16 | |
| 2o2o_A | 92 | SH3-domain kinase-binding protein 1; CIN85, protei | 5e-16 | |
| 2csi_A | 76 | RIM-BP2, RIM binding protein 2; SH3 domain, struct | 6e-16 | |
| 2ew3_A | 68 | SH3-containing GRB2-like protein 3; SH3GL3, soluti | 6e-16 | |
| 1jo8_A | 58 | ABP1P, actin binding protein; SH3 domain actin-bin | 6e-16 | |
| 3c0c_A | 73 | Endophilin-A2; endocytosis, SH3, voltage-gated cal | 7e-16 | |
| 2eyx_A | 67 | V-CRK sarcoma virus CT10 oncogene homolog isoform | 7e-16 | |
| 2dbm_A | 73 | SH3-containing GRB2-like protein 2; EC 2.3.1.-, SH | 7e-16 | |
| 2ege_A | 75 | Uncharacterized protein KIAA1666; SH3 domain, KIAA | 8e-16 | |
| 3thk_A | 73 | Spectrin alpha chain, brain; SH3 domain, chimera, | 1e-15 | |
| 2bzy_A | 67 | CRK-like protein, CRKL SH3C; SH3 domain, dimer, nu | 1e-15 | |
| 4esr_A | 69 | Jouberin; AHI-1, AHI1, AHI-1 SH3 domain, SH3 domai | 1e-15 | |
| 2cre_A | 71 | HEF-like protein; SH3 domain, SRC homology 3 domai | 1e-15 | |
| 2ysq_A | 81 | RHO guanine nucleotide exchange factor 9; SH3 doma | 1e-15 | |
| 2fpf_A | 71 | C-JUN-amino-terminal kinase interacting protein 1; | 1e-15 | |
| 1cka_A | 57 | C-CRK N-terminal SH3 domain; complex (oncogene pro | 2e-15 | |
| 2ekh_A | 80 | SH3 and PX domain-containing protein 2A; SH3 domai | 2e-15 | |
| 2ed1_A | 76 | 130 kDa phosphatidylinositol 4,5-biphosphate- depe | 2e-15 | |
| 1s1n_A | 68 | Nephrocystin 1; beta barrel, cell adhesion; NMR {H | 2e-15 | |
| 1ue9_A | 80 | Intersectin 2; beta barrel, SH3 domain, riken stru | 3e-15 | |
| 2lcs_A | 73 | NAP1-binding protein 2; adaptor, transferase, sign | 3e-15 | |
| 2gqi_A | 71 | RAS GTPase-activating protein 1; GAP, RAS P21 prot | 3e-15 | |
| 1b07_A | 65 | Protein (proto-oncogene CRK (CRK)); SH3 domain, in | 4e-15 | |
| 1z9q_A | 79 | Neutrophil cytosol factor 4; oxidoreductase activa | 4e-15 | |
| 2dlp_A | 85 | KIAA1783 protein; SH3 domain, structural genomics, | 5e-15 | |
| 2ecz_A | 70 | Sorbin and SH3 domain-containing protein 1; glycop | 7e-15 | |
| 1wyx_A | 69 | CRK-associated substrate; beta sheets, cell adhesi | 7e-15 | |
| 1gbq_A | 74 | GRB2; complex (signal transduction/peptide), SH3 d | 1e-14 | |
| 4e6r_A | 58 | Cytoplasmic protein NCK2; SH3 domain, protein bind | 1e-14 | |
| 2dbk_A | 88 | CRK-like protein; structural genomics, NPPSFA, nat | 1e-14 | |
| 2j05_A | 65 | RAS GTPase-activating protein 1; GTPase activation | 1e-14 | |
| 1x6b_A | 79 | RHO guanine exchange factor (GEF) 16; SH3 domain, | 2e-14 | |
| 1tuc_A | 63 | Alpha-spectrin; capping protein, calcium-binding, | 2e-14 | |
| 2d8h_A | 80 | SH3YL1 protein; SH3 domain, hypothetical protein S | 2e-14 | |
| 1j3t_A | 74 | Intersectin 2; beta barrel, SH3 domain, riken stru | 2e-14 | |
| 1zuy_A | 58 | Myosin-5 isoform; SH3 domain, contractIle protein; | 3e-14 | |
| 1neg_A | 83 | Spectrin alpha chain, brain; SH3-domain fold, five | 3e-14 | |
| 1tg0_A | 68 | BBC1 protein, myosin tail region-interacting prote | 3e-14 | |
| 3haj_A | 486 | Human pacsin2 F-BAR; pacsin,syndapin,FAP52,F-BAR, | 4e-14 | |
| 2o9s_A | 67 | Ponsin; SH3 domain, signaling protein; 0.83A {Homo | 4e-14 | |
| 2lqn_A | 303 | CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT | 4e-14 | |
| 2lqn_A | 303 | CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT | 2e-08 | |
| 2pqh_A | 80 | Spectrin alpha chain, brain; SH3 domain, chimera, | 5e-14 | |
| 2eyz_A | 304 | V-CRK sarcoma virus CT10 oncogene homolog isoform | 6e-14 | |
| 3eg3_A | 63 | Proto-oncogene tyrosine-protein kinase ABL1; beta, | 7e-14 | |
| 3h0h_A | 73 | Proto-oncogene tyrosine-protein kinase FYN; beta b | 8e-14 | |
| 1uff_A | 93 | Intersectin 2; beta barrel, SH3 domain, endocytosi | 1e-13 | |
| 2kxd_A | 73 | 11-MER peptide, SH3 domain of spectrin alpha CHAI; | 1e-13 | |
| 2ke9_A | 83 | Caskin-2; SH3 domain, ANK repeat, cytoplasm, phosp | 1e-13 | |
| 4ag1_C | 84 | Fynomer; hydrolase-de novo protein complex, inhibi | 1e-13 | |
| 2oaw_A | 65 | Spectrin alpha chain, brain; SH3 domain, chimera, | 1e-13 | |
| 2kxc_A | 67 | Brain-specific angiogenesis inhibitor 1-associate | 2e-13 | |
| 1spk_A | 72 | RSGI RUH-010, riken cDNA 1300006M19; structural ge | 3e-13 | |
| 1x43_A | 81 | Endophilin B1, SH3 domain GRB2-like protein B1; st | 3e-13 | |
| 1gl5_A | 67 | Tyrosine-protein kinase TEC; transferase, ATP-bind | 4e-13 | |
| 3qwy_A | 308 | Cell death abnormality protein 2; cell engulfment, | 4e-13 | |
| 3qwy_A | 308 | Cell death abnormality protein 2; cell engulfment, | 1e-09 | |
| 2kbt_A | 142 | Chimera of proto-oncogene VAV, linker, immunoglobu | 4e-13 | |
| 2e5k_A | 94 | Suppressor of T-cell receptor signaling 1; SH3 dom | 5e-13 | |
| 1ruw_A | 69 | Myosin-3 isoform, MYO3; SH3 domain, yeast, high-th | 5e-13 | |
| 1ng2_A | 193 | Neutrophil cytosolic factor 1; P47PHOX, autoinhibi | 5e-13 | |
| 1ng2_A | 193 | Neutrophil cytosolic factor 1; P47PHOX, autoinhibi | 5e-12 | |
| 3cqt_A | 79 | P59-FYN, proto-oncogene tyrosine-protein kinase FY | 5e-13 | |
| 2v1q_A | 60 | SLA1, cytoskeleton assembly control protein SLA1; | 6e-13 | |
| 1wxb_A | 68 | Epidermal growth factor receptor pathway substrate | 7e-13 | |
| 1aww_A | 67 | ATK, AMGX1, BPK, bruton'S tyrosine kinase; X-linke | 8e-13 | |
| 2rf0_A | 89 | Mitogen-activated protein kinase kinase kinase 10; | 9e-13 | |
| 2kgt_A | 72 | Tyrosine-protein kinase 6; SH3 domain, SRC kinase, | 1e-12 | |
| 2yup_A | 90 | Vinexin; sorbin and SH3 domain-containing protein | 1e-12 | |
| 2csq_A | 97 | RIM-BP2, RIM binding protein 2; SH3 domain, struct | 2e-12 | |
| 1wie_A | 96 | RIM binding protein 2; beta barrel, KIAA0318 prote | 2e-12 | |
| 3rnj_A | 67 | Brain-specific angiogenesis inhibitor 1-associate | 2e-12 | |
| 2d8j_A | 77 | FYN-related kinase; SH3 domain, structural genomic | 3e-12 | |
| 2vkn_A | 70 | Protein SSU81; membrane, SH3 domain, transmembrane | 3e-12 | |
| 2egc_A | 75 | SH3 and PX domain-containing protein 2A; SH3 domai | 4e-12 | |
| 1uhc_A | 79 | KIAA1010 protein; beta barrel, SH3, human cDNA, st | 4e-12 | |
| 2i0n_A | 80 | Class VII unconventional myosin; beta-sheet loop, | 4e-12 | |
| 3qwx_X | 174 | Cell death abnormality protein 2; cell engulfment, | 5e-12 | |
| 1wxt_A | 68 | Hypothetical protein FLJ21522; SH3 domain, EPS8-re | 5e-12 | |
| 2jmc_A | 77 | Spectrin alpha chain, brain and P41 peptide chimer | 7e-12 | |
| 1m2v_B | 926 | SEC24, protein transport protein SEC24, SEC24P, SE | 8e-12 | |
| 1m2v_B | 926 | SEC24, protein transport protein SEC24, SEC24P, SE | 1e-10 | |
| 1m2v_B | 926 | SEC24, protein transport protein SEC24, SEC24P, SE | 2e-06 | |
| 1m2v_B | 926 | SEC24, protein transport protein SEC24, SEC24P, SE | 4e-04 | |
| 1m2v_B | 926 | SEC24, protein transport protein SEC24, SEC24P, SE | 8e-04 | |
| 2enm_A | 77 | Sorting nexin-9; SH3-like barrel, protein transpor | 1e-11 | |
| 1w1f_A | 65 | Tyrosine-protein kinase LYN; SH3-domain, SH3 domai | 2e-11 | |
| 1wxu_A | 93 | Peroxisomal biogenesis factor 13; SH3 domain, PEX1 | 2e-11 | |
| 1u5s_A | 71 | Cytoplasmic protein NCK2; protein-protein complex, | 2e-11 | |
| 1gri_A | 217 | Growth factor bound protein 2; SH2, SH3, signal tr | 2e-11 | |
| 1gri_A | 217 | Growth factor bound protein 2; SH2, SH3, signal tr | 1e-07 | |
| 2jt4_A | 71 | Cytoskeleton assembly control protein SLA1; endocy | 3e-11 | |
| 1zuu_A | 58 | BZZ1 protein; SH3 domain, unknown function; 0.97A | 3e-11 | |
| 1csk_A | 71 | C-SRC SH3 domain; phosphotransferase; 2.50A {Homo | 6e-11 | |
| 2ct4_A | 70 | CDC42-interacting protein 4; thyroid receptor inte | 6e-11 | |
| 1nm7_A | 69 | Peroxisomal membrane protein PAS20; yeast, PEX5P, | 8e-11 | |
| 2rqv_A | 108 | BUD emergence protein 1; BEM1P, SH3, CDC42P, cytop | 1e-10 | |
| 2dyb_A | 341 | Neutrophil cytosol factor 4; P40(PHOX), NADPH oxid | 1e-10 | |
| 3reb_B | 90 | Tyrosine-protein kinase HCK; HIV-1 NEF, SH3 domain | 1e-10 | |
| 2yt6_A | 109 | Adult MALE urinary bladder cDNA, riken FULL- lengt | 3e-10 | |
| 1wx6_A | 91 | Cytoplasmic protein NCK2; SH3 domain, structural g | 4e-10 | |
| 2dl5_A | 78 | KIAA0769 protein; SH3 domain, FCHSD2, structural g | 5e-10 | |
| 1bb9_A | 115 | Amphiphysin 2; transferase, SH3 domain; 2.20A {Rat | 5e-10 | |
| 2iim_A | 62 | Proto-oncogene tyrosine-protein kinase LCK; beta-b | 7e-10 | |
| 2kym_A | 120 | BUD emergence protein 1; SH3 domain, BEM1P, SH3-CI | 1e-09 | |
| 2v1r_A | 80 | Peroxisomal membrane protein PAS20; protein transp | 1e-09 | |
| 1x6g_A | 81 | Megakaryocyte-associated tyrosine-protein kinase; | 3e-09 | |
| 2oi3_A | 86 | Tyrosine-protein kinase HCK; human HCK, SH3, SRC-t | 3e-09 | |
| 1jqq_A | 92 | PEX13P, peroxisomal membrane protein PAS20, PAS20P | 4e-09 | |
| 2b86_A | 67 | Cytoplasmic protein NCK2; NCK SH3 domain, signalin | 5e-09 | |
| 2yuq_A | 85 | Tyrosine-protein kinase ITK/TSK; T-cell-specific k | 6e-09 | |
| 2dvj_A | 230 | V-CRK sarcoma virus CT10 oncogene homolog, isoform | 7e-09 | |
| 2k2m_A | 68 | EPS8-like protein 1; alternative splicing, coiled | 1e-08 | |
| 1awj_A | 77 | ITK; transferase, regulatory intramolecular comple | 2e-08 | |
| 2jw4_A | 72 | Cytoplasmic protein NCK1; SH3 domain, phosphorylat | 2e-08 | |
| 1i07_A | 60 | Epidermal growth factor receptor kinase substrate | 4e-08 | |
| 2rqr_A | 119 | CED-12 homolog, engulfment and cell motility prote | 4e-08 | |
| 2cud_A | 79 | SRC-like-adapter; SH3 domain, negative mitogenesis | 5e-08 | |
| 2jxb_A | 86 | T-cell surface glycoprotein CD3 epsilon chain, cyt | 2e-07 | |
| 2de0_X | 526 | Alpha-(1,6)-fucosyltransferase; FUT8, glycosyltran | 2e-07 | |
| 1g2b_A | 62 | Spectrin alpha chain; capping protein, calcium-bin | 2e-07 | |
| 2pz1_A | 466 | RHO guanine nucleotide exchange factor 4; helical | 5e-07 | |
| 3o5z_A | 90 | Phosphatidylinositol 3-kinase regulatory subunit; | 6e-07 | |
| 2h8h_A | 535 | Proto-oncogene tyrosine-protein kinase SRC; SRC ki | 6e-07 | |
| 1k1z_A | 78 | VAV; SH3, proto-oncogene, signaling protein; NMR { | 6e-07 | |
| 1gcq_C | 70 | VAV proto-oncogene; SH3 domain, protein-protein co | 2e-06 | |
| 1i1j_A | 108 | Melanoma derived growth regulatory protein; SH3 su | 2e-06 | |
| 1opk_A | 495 | P150, C-ABL, proto-oncogene tyrosine-protein kinas | 4e-06 | |
| 3jv3_A | 283 | Intersectin-1; SH3 domain, DH domain, guanine nucl | 7e-06 | |
| 3a98_A | 184 | DOCK2, dedicator of cytokinesis protein 2; protein | 2e-04 | |
| 3i5r_A | 83 | Phosphatidylinositol 3-kinase regulatory subunit a | 2e-04 | |
| 1ug1_A | 92 | KIAA1010 protein; structural genomics, SH3 domain, | 8e-04 |
| >3p8c_F ABL interactor 2; actin polymerization, protein binding; 2.29A {Homo sapiens} Length = 159 | Back alignment and structure |
|---|
Score = 200 bits (509), Expect = 2e-63
Identities = 94/158 (59%), Positives = 116/158 (73%), Gaps = 13/158 (8%)
Query: 1 MAELASLLTTEIPEGRTSLLDSHSNLEKVAEYCEGNYFQADNKRMALEETKNYTTQSLAS 60
MAEL LL EIP GR +L DS++NLE+VA+YCE NY Q+ +K+ ALEETK YTTQSLAS
Sbjct: 2 MAELQMLLEEEIPGGRRALFDSYTNLERVADYCENNYIQSADKQRALEETKAYTTQSLAS 61
Query: 61 VAYQINTLAYNFLQLLDLQTAQLEEMESQMNHIGQ-------------IGVLTANKTTNR 107
VAY INTLA N LQ+LD+Q +QL MES +NHI Q IG+LT NK T+R
Sbjct: 62 VAYLINTLANNVLQMLDIQASQLRRMESSINHISQTVDIHKEKVARREIGILTTNKNTSR 121
Query: 108 QYKIIAPANPEKPIKYVRKPIDLNALDDIGHGVRNAPR 145
+KIIAPAN E+P++Y+RKPID LDDIGHGV+ + +
Sbjct: 122 THKIIAPANLERPVRYIRKPIDYTILDDIGHGVKVSTQ 159
|
| >2bz8_A SH3-domain kinase binding protein 1; SH3 domain, CIN85 adaptor protein, CBL ubiquitin ligase; 2.0A {Homo sapiens} Length = 58 | Back alignment and structure |
|---|
| >2drm_A Acanthamoeba myosin IB; SH3 domain, contractIle protein; 1.35A {Acanthamoeba} PDB: 2drk_A Length = 58 | Back alignment and structure |
|---|
| >2g6f_X RHO guanine nucleotide exchange factor 7; SH3 domain, peptide interaction, signaling protein; HET: NCO; 0.92A {Rattus norvegicus} PDB: 2df6_A* 2p4r_A 2esw_A Length = 59 | Back alignment and structure |
|---|
| >2ed0_A ABL interactor 2; coiled coil, cytoskeleton, nuclear protein, phosphorylation, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 78 | Back alignment and structure |
|---|
| >1k4u_S Phagocyte NADPH oxidase subunit P67PHOX; SH3-peptide complex, helix-turn-helix, hormone/growth factor complex; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 62 | Back alignment and structure |
|---|
| >2ak5_A RHO guanine nucleotide exchange factor 7; adaptor proteins, CIN85, PIX/COOL, protein-protein interaction, X-RAY, endocytosis; 1.85A {Rattus norvegicus} PDB: 1zsg_A Length = 64 | Back alignment and structure |
|---|
| >1zx6_A YPR154WP; SH3 domain, protein binding; 1.60A {Saccharomyces cerevisiae} PDB: 1ynz_A Length = 58 | Back alignment and structure |
|---|
| >1uti_A GRB2-related adaptor protein 2; signaling protein regulator, SH3 domain/complex, adaptor protein (MONA); 1.5A {Mus musculus} SCOP: b.34.2.1 PDB: 1h3h_A 1oeb_A 2w10_A 2d0n_A Length = 58 | Back alignment and structure |
|---|
| >1sem_A SEM-5; SRC-homology 3 (SH3) domain, peptide-binding protein; 2.00A {Caenorhabditis elegans} SCOP: b.34.2.1 PDB: 2sem_A 3sem_A 1k76_A 1kfz_A Length = 58 | Back alignment and structure |
|---|
| >1zlm_A Osteoclast stimulating factor 1; beta barrel, signaling protein; 1.07A {Homo sapiens} Length = 58 | Back alignment and structure |
|---|
| >2xmf_A Myosin 1E SH3; motor protein, SH3 domain; HET: DIA; 1.50A {Mus musculus} Length = 60 | Back alignment and structure |
|---|
| >2vwf_A Growth factor receptor-bound protein 2; polymorphism, phosphoprotein, golgi apparatus, alternative splicing, HOST-virus interaction, SH3C, signaling; 1.58A {Homo sapiens} PDB: 2w0z_A 1gcq_A 1gfc_A 1gfd_A 1io6_A 2vvk_A Length = 58 | Back alignment and structure |
|---|
| >1uj0_A Signal transducing adaptor molecule (SH3 domain and ITAM motif) 2; STAM, SH3, GRB2, GADS, PXXP, HRS, endocytosis, early endosome, signaling protein/signaling protein complex; 1.70A {Mus musculus} SCOP: b.34.2.1 Length = 62 | Back alignment and structure |
|---|
| >4f14_A Nebulette; SH3 domain, heart muscle, actin-binding protein-peptide COMP; 1.20A {Homo sapiens} PDB: 1ark_A 1neb_A 3i35_A Length = 64 | Back alignment and structure |
|---|
| >2dnu_A RUH-061, SH3 multiple domains 1; RSGI, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 71 | Back alignment and structure |
|---|
| >2dil_A Proline-serine-threonine phosphatase-interacting protein 1; SH3 domain, PEST phosphatase-interacting protein 1, CD2- binding protein 1; NMR {Homo sapiens} Length = 69 | Back alignment and structure |
|---|
| >1x2k_A OSTF1, osteoclast stimulating factor 1; SH3 domain, human osteoclast stimulating factor 1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 68 | Back alignment and structure |
|---|
| >2dmo_A Neutrophil cytosol factor 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 68 | Back alignment and structure |
|---|
| >2j6f_A CD2-associated protein; metal-binding, immune response, SH3, SH2 domain, SH3 zinc-finger, SH3- binding, UBL conjugation pathway; 1.7A {Homo sapiens} PDB: 2j6k_A 2j6o_A 2j7i_A 2krm_A Length = 62 | Back alignment and structure |
|---|
| >1y0m_A 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma 1; SH3 domain, hydrolase; 1.20A {Rattus norvegicus} PDB: 1ywp_A 1ywo_A Length = 61 | Back alignment and structure |
|---|
| >2fei_A CD2-associated protein; CMS SH3 domain, structural protein; NMR {Homo sapiens} Length = 65 | Back alignment and structure |
|---|
| >1wi7_A SH3-domain kinase binding protein 1; beta barrel, SH3KBP1, RUK, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} Length = 68 | Back alignment and structure |
|---|
| >3ulr_B SRC substrate cortactin; SH3, protein-protein interaction, hydrolase, protein binding; 1.65A {Mus musculus} PDB: 2d1x_A Length = 65 | Back alignment and structure |
|---|
| >2gnc_A SLIT-ROBO RHO GTPase-activating protein 1; beta barrel, signaling protein; 1.80A {Mus musculus} Length = 60 | Back alignment and structure |
|---|
| >3u23_A CD2-associated protein; structural genomics, structural genomics consortium, SGC, BE barrel, adaptor protein, protein binding; 1.11A {Homo sapiens} PDB: 2krn_A Length = 65 | Back alignment and structure |
|---|
| >1ujy_A RHO guanine nucleotide exchange factor 6; structural genomics, SH3 domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 76 | Back alignment and structure |
|---|
| >2jte_A CD2-associated protein; SH3 domain, coiled coil, cytoplasm, phosphorylation, SH3-binding, signaling protein; NMR {Mus musculus} PDB: 2kro_A Length = 64 | Back alignment and structure |
|---|
| >1x69_A Cortactin isoform A; SH3 domain, CTTN, oncogene EMS1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 79 | Back alignment and structure |
|---|
| >2ega_A SH3 and PX domain-containing protein 2A; SH3 domain, KIAA0418 protein, SH3MD1, SH3 multiple domains 1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 | Back alignment and structure |
|---|
| >2a28_A BZZ1 protein; SH3 domain, signaling protein; 1.07A {Saccharomyces cerevisiae} Length = 54 | Back alignment and structure |
|---|
| >1w70_A Neutrophil cytosol factor 4; NADPH oxidase, P40PHOX, P47PHOX, SH3 domain, polyproline; 1.46A {Homo sapiens} PDB: 1w6x_A Length = 60 | Back alignment and structure |
|---|
| >2eqi_A Phospholipase C, gamma 2; SH3 domain, PLCG2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 69 | Back alignment and structure |
|---|
| >1x2p_A Protein arginine N-methyltransferase 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 68 | Back alignment and structure |
|---|
| >2dl8_A SLIT-ROBO RHO GTPase-activating protein 2; SH3 domain, formin-binding protein 2, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 72 | Back alignment and structure |
|---|
| >2dl3_A Sorbin and SH3 domain-containing protein 1; ponsin, C-CBL-associated protein, CAP, SH3 domain protein 5 SH3P12, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dlm_A Length = 68 | Back alignment and structure |
|---|
| >3ngp_A Spectrin alpha chain, brain; beta barrel, structural protein; 1.08A {Gallus gallus} PDB: 1e7o_A 1e6g_A 1e6h_A 1uue_A 1h8k_A 2lj3_A 1aey_A 1m8m_A 1shg_A 1u06_A 2nuz_A 2cdt_A 1hd3_A 2f2v_A 2f2w_A 2jm8_A 2jm9_A 2jma_A 3m0r_A 3m0p_A ... Length = 62 | Back alignment and structure |
|---|
| >2l0a_A STAM-1, signal transducing adapter molecule 1; structural genomics, northeast structural genomics consortiu PSI-2, protein structure initiative; NMR {Homo sapiens} Length = 72 | Back alignment and structure |
|---|
| >2nwm_A Vinexin; cell adhesion; NMR {Homo sapiens} Length = 65 | Back alignment and structure |
|---|
| >2cub_A Cytoplasmic protein NCK1; SH3 domain, NCK1 adaptor, tyrosine kinase, signal transduction, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 | Back alignment and structure |
|---|
| >1hsq_A Phospholipase C-gamma (SH3 domain); phosphoric diester hydrolase; NMR {Homo sapiens} SCOP: b.34.2.1 PDB: 2hsp_A Length = 71 | Back alignment and structure |
|---|
| >2yun_A Nostrin; nitric oxide synthase trafficker, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 79 | Back alignment and structure |
|---|
| >2djq_A SH3 domain containing ring finger 2; MUS musculus 0 DAY neonate head cDNA, riken FULL-length enriched library, clone:4831401O22, structural genomics; NMR {Mus musculus} Length = 68 | Back alignment and structure |
|---|
| >1oot_A Hypothetical 40.4 kDa protein in PES4-His2 intergenic region; SH3 domain, sturctural genomics, structural genomics; 1.39A {Saccharomyces cerevisiae} SCOP: b.34.2.1 PDB: 1ssh_A 2a08_A Length = 60 | Back alignment and structure |
|---|
| >2dl7_A KIAA0769 protein; SH3 domain, FCHSD2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 | Back alignment and structure |
|---|
| >1udl_A Intersectin 2, KIAA1256; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 98 | Back alignment and structure |
|---|
| >2dl4_A Protein STAC; SH3 domain, STAC protein, SRC homology 3, cysteine-rich domain protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 68 | Back alignment and structure |
|---|
| >2fpe_A C-JUN-amino-terminal kinase interacting protein 1; SRC-homology 3 (SH3) domain, all beta structure, signaling protein; HET: P6G; 1.75A {Rattus norvegicus} PDB: 2fpd_A* Length = 62 | Back alignment and structure |
|---|
| >2ct3_A Vinexin; SH3 domian, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 70 | Back alignment and structure |
|---|
| >1uhf_A Intersectin 2; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, signaling protein; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 69 | Back alignment and structure |
|---|
| >2cuc_A SH3 domain containing ring finger 2; structural genomics, ring finger 2 containing protein, NPPSFA; NMR {Mus musculus} Length = 70 | Back alignment and structure |
|---|
| >2ydl_A SH3 domain-containing kinase-binding protein 1; signaling protein; 2.05A {Homo sapiens} PDB: 2k6d_A Length = 69 | Back alignment and structure |
|---|
| >2da9_A SH3-domain kinase binding protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 70 | Back alignment and structure |
|---|
| >2x3w_D Syndapin I, protein kinase C and casein kinase substrate in N protein 1; endocytosis, N-WAsp, dynamin, pacsin I, transferase; 2.64A {Mus musculus} PDB: 2x3x_D Length = 60 | Back alignment and structure |
|---|
| >2yuo_A CIP85, RUN and TBC1 domain containing 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 78 | Back alignment and structure |
|---|
| >2ebp_A SAM and SH3 domain-containing protein 1; proline-glutamate repeat-containing protein, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2kea_A Length = 73 | Back alignment and structure |
|---|
| >2dm1_A Protein VAV-2; RHO family guanine nucleotide exchange factor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 73 | Back alignment and structure |
|---|
| >2k9g_A SH3 domain-containing kinase-binding protein 1; CIN85, adaptor protein, downregulation, CBL, apoptosis, junction, cytoplasmic vesicle, cytoskeleton; NMR {Homo sapiens} Length = 73 | Back alignment and structure |
|---|
| >1ugv_A KIAA0621, olygophrenin-1 like protein; beta barrel, GRAF protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 72 | Back alignment and structure |
|---|
| >1x2q_A Signal transducing adapter molecule 2; SH3 domain, signal transducing adaptor molecule, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 | Back alignment and structure |
|---|
| >1yn8_A NBP2, NAP1-binding protein 2; SH3 domain, unknown function; 1.70A {Saccharomyces cerevisiae} Length = 59 | Back alignment and structure |
|---|
| >2epd_A RHO GTPase-activating protein 4; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 76 | Back alignment and structure |
|---|
| >2o2o_A SH3-domain kinase-binding protein 1; CIN85, protein binding; NMR {Homo sapiens} Length = 92 | Back alignment and structure |
|---|
| >2csi_A RIM-BP2, RIM binding protein 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 76 | Back alignment and structure |
|---|
| >2ew3_A SH3-containing GRB2-like protein 3; SH3GL3, solution structure, signaling protein; NMR {Homo sapiens} Length = 68 | Back alignment and structure |
|---|
| >1jo8_A ABP1P, actin binding protein; SH3 domain actin-binding-protein, structural protein; 1.30A {Saccharomyces cerevisiae} SCOP: b.34.2.1 PDB: 2k3b_A 2rpn_A Length = 58 | Back alignment and structure |
|---|
| >3c0c_A Endophilin-A2; endocytosis, SH3, voltage-gated calcium channel, endosome, L binding, membrane, phosphoprotein, proto-oncogene, SH3 DOMA; 1.70A {Rattus norvegicus} Length = 73 | Back alignment and structure |
|---|
| >2eyx_A V-CRK sarcoma virus CT10 oncogene homolog isoform A; SH3, signaling protein; NMR {Homo sapiens} Length = 67 | Back alignment and structure |
|---|
| >2dbm_A SH3-containing GRB2-like protein 2; EC 2.3.1.-, SH3 domain protein 2A, endophilin 1, EEN-B1, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2knb_B 3iql_A Length = 73 | Back alignment and structure |
|---|
| >2ege_A Uncharacterized protein KIAA1666; SH3 domain, KIAA1666 protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 75 | Back alignment and structure |
|---|
| >3thk_A Spectrin alpha chain, brain; SH3 domain, chimera, structural protein; 1.70A {Rattus norvegicus} Length = 73 | Back alignment and structure |
|---|
| >2bzy_A CRK-like protein, CRKL SH3C; SH3 domain, dimer, nuclear export; 2.5A {Homo sapiens} PDB: 2bzx_A Length = 67 | Back alignment and structure |
|---|
| >4esr_A Jouberin; AHI-1, AHI1, AHI-1 SH3 domain, SH3 domain, dynamin-2, protei binding, chronic myeloid leukemia; 1.53A {Homo sapiens} Length = 69 | Back alignment and structure |
|---|
| >2cre_A HEF-like protein; SH3 domain, SRC homology 3 domain, beta barrel, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71 | Back alignment and structure |
|---|
| >2ysq_A RHO guanine nucleotide exchange factor 9; SH3 domain, CDC42 guanine nucleotide exchange factor (GEF) 9, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 | Back alignment and structure |
|---|
| >2fpf_A C-JUN-amino-terminal kinase interacting protein 1; scaffold protein 1, islet-brain-1, IB-1, mitogen-activated P kinase 8-interacting protein 1; 3.00A {Rattus norvegicus} Length = 71 | Back alignment and structure |
|---|
| >1cka_A C-CRK N-terminal SH3 domain; complex (oncogene protein/peptide); 1.50A {Mus musculus} SCOP: b.34.2.1 PDB: 1ckb_A 1m3c_A 1m30_A 1m3b_A 1m3a_A Length = 57 | Back alignment and structure |
|---|
| >2ekh_A SH3 and PX domain-containing protein 2A; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 80 | Back alignment and structure |
|---|
| >2ed1_A 130 kDa phosphatidylinositol 4,5-biphosphate- dependent ARF1 GTPase-activating protein...; GTPase activation, membrane, metal-binding, SH3 domain; NMR {Homo sapiens} PDB: 2rqt_A 2rqu_A Length = 76 | Back alignment and structure |
|---|
| >1s1n_A Nephrocystin 1; beta barrel, cell adhesion; NMR {Homo sapiens} Length = 68 | Back alignment and structure |
|---|
| >1ue9_A Intersectin 2; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, endocytosis/exocytosis complex; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 80 | Back alignment and structure |
|---|
| >2lcs_A NAP1-binding protein 2; adaptor, transferase, signaling protein; NMR {Saccharomyces cerevisiae} Length = 73 | Back alignment and structure |
|---|
| >2gqi_A RAS GTPase-activating protein 1; GAP, RAS P21 protein activator, P120GAP, rasgap, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71 | Back alignment and structure |
|---|
| >1b07_A Protein (proto-oncogene CRK (CRK)); SH3 domain, inhibitors, peptoids, protein-protein recognition, proline-rich motifs, signal transduction; 2.50A {Mus musculus} SCOP: b.34.2.1 Length = 65 | Back alignment and structure |
|---|
| >1z9q_A Neutrophil cytosol factor 4; oxidoreductase activator; NMR {Homo sapiens} Length = 79 | Back alignment and structure |
|---|
| >2dlp_A KIAA1783 protein; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 85 | Back alignment and structure |
|---|
| >2ecz_A Sorbin and SH3 domain-containing protein 1; glycoprotein, membrane, nuclear protein, phosphorylation, polymorphism, transport, structural genomics; NMR {Homo sapiens} Length = 70 | Back alignment and structure |
|---|
| >1wyx_A CRK-associated substrate; beta sheets, cell adhesion; 1.14A {Homo sapiens} Length = 69 | Back alignment and structure |
|---|
| >1gbq_A GRB2; complex (signal transduction/peptide), SH3 domain; NMR {Mus musculus} SCOP: b.34.2.1 PDB: 1gbr_A 2gbq_A 3gbq_A 4gbq_A Length = 74 | Back alignment and structure |
|---|
| >4e6r_A Cytoplasmic protein NCK2; SH3 domain, protein binding, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; HET: MLY; 2.20A {Homo sapiens} PDB: 2frw_A 2js0_A Length = 58 | Back alignment and structure |
|---|
| >2dbk_A CRK-like protein; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 88 | Back alignment and structure |
|---|
| >2j05_A RAS GTPase-activating protein 1; GTPase activation, SH3 domain, SH2 domain, SRC homology 3, RAS signaling pathway, proto- oncogene, phosphorylation; 1.5A {Homo sapiens} PDB: 2j06_A Length = 65 | Back alignment and structure |
|---|
| >1x6b_A RHO guanine exchange factor (GEF) 16; SH3 domain, neuroblastoma, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 79 | Back alignment and structure |
|---|
| >1tuc_A Alpha-spectrin; capping protein, calcium-binding, duplication, repeat, SH3 domain, cytoskeleton; 2.02A {Gallus gallus} SCOP: b.34.2.1 Length = 63 | Back alignment and structure |
|---|
| >2d8h_A SH3YL1 protein; SH3 domain, hypothetical protein SH3YL1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 | Back alignment and structure |
|---|
| >1j3t_A Intersectin 2; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, endocytosis/exocytosis complex; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 74 | Back alignment and structure |
|---|
| >1zuy_A Myosin-5 isoform; SH3 domain, contractIle protein; 1.39A {Saccharomyces cerevisiae} PDB: 1yp5_A Length = 58 | Back alignment and structure |
|---|
| >1neg_A Spectrin alpha chain, brain; SH3-domain fold, five antiparallel beta sheets, structural protein; 2.30A {Gallus gallus} SCOP: b.34.2.1 Length = 83 | Back alignment and structure |
|---|
| >1tg0_A BBC1 protein, myosin tail region-interacting protein MTI1; yeast, SH3 domain, structural genomics, contractIle protein; 0.97A {Saccharomyces cerevisiae} PDB: 1zuk_A 1wdx_A Length = 68 | Back alignment and structure |
|---|
| >3haj_A Human pacsin2 F-BAR; pacsin,syndapin,FAP52,F-BAR, alternative splicing, coiled coil, cytoplasmic vesicle, endocytosis, phosphoprotein, polymorphism; 2.78A {Homo sapiens} Length = 486 | Back alignment and structure |
|---|
| >2o9s_A Ponsin; SH3 domain, signaling protein; 0.83A {Homo sapiens} PDB: 2o31_A 2o9v_A 2o2w_A Length = 67 | Back alignment and structure |
|---|
| >2lqn_A CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT10 oncogene homolog (avian)- signaling protein; NMR {Homo sapiens} PDB: 2lqw_A* Length = 303 | Back alignment and structure |
|---|
| >2lqn_A CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT10 oncogene homolog (avian)- signaling protein; NMR {Homo sapiens} PDB: 2lqw_A* Length = 303 | Back alignment and structure |
|---|
| >2eyz_A V-CRK sarcoma virus CT10 oncogene homolog isoform A; SH2, SH3, signaling protein; NMR {Homo sapiens} PDB: 2l3s_A 2l3p_A 2l3q_A 2ggr_A Length = 304 | Back alignment and structure |
|---|
| >3eg3_A Proto-oncogene tyrosine-protein kinase ABL1; beta, ATP-binding, cell adhesion, cytoskeleton, LIPO magnesium, manganese, metal-binding, myristate; 1.40A {Homo sapiens} PDB: 3egu_A 3eg0_A 3eg2_A 3eg1_A 1abo_A 1abq_A 1ju5_C* 2o88_A 1bbz_A 1awo_A Length = 63 | Back alignment and structure |
|---|
| >3h0h_A Proto-oncogene tyrosine-protein kinase FYN; beta barrel, transferase; HET: PG4; 1.76A {Homo sapiens} PDB: 3h0i_A 3h0f_A* Length = 73 | Back alignment and structure |
|---|
| >1uff_A Intersectin 2; beta barrel, SH3 domain, endocytosis, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 93 | Back alignment and structure |
|---|
| >2kxd_A 11-MER peptide, SH3 domain of spectrin alpha CHAI; alpha spectrin SH3 domain, SPC-S19P20S circular permutant, S protein; NMR {Synthetic} Length = 73 | Back alignment and structure |
|---|
| >2ke9_A Caskin-2; SH3 domain, ANK repeat, cytoplasm, phosphoprotein, protein binding; NMR {Homo sapiens} Length = 83 | Back alignment and structure |
|---|
| >4ag1_C Fynomer; hydrolase-de novo protein complex, inhibitor, serine proteas; 1.40A {Synthetic construct} PDB: 4afz_C 4ag2_C* 4afq_C* 4afs_C 4afu_C 1azg_B 1nyf_A 1nyg_A 1a0n_B 1fyn_A 1m27_C* 1shf_A 1zbj_A 1efn_A 1avz_C 1nlo_C* 1nlp_C* 1qwe_A 1qwf_A 1prl_C ... Length = 84 | Back alignment and structure |
|---|
| >2oaw_A Spectrin alpha chain, brain; SH3 domain, chimera, structural protein; 1.90A {Gallus gallus} PDB: 2rot_A 2rmo_A 2kr3_A Length = 65 | Back alignment and structure |
|---|
| >2kxc_A Brain-specific angiogenesis inhibitor 1-associate 2-like protein 1; IRTKS-SH3, espfu, complex structure, protein binding; NMR {Homo sapiens} Length = 67 | Back alignment and structure |
|---|
| >1spk_A RSGI RUH-010, riken cDNA 1300006M19; structural genomics, SH3 domain, five-stranded barrel, mouse cDNA; NMR {Mus musculus} SCOP: b.34.2.1 Length = 72 | Back alignment and structure |
|---|
| >1x43_A Endophilin B1, SH3 domain GRB2-like protein B1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 81 | Back alignment and structure |
|---|
| >1gl5_A Tyrosine-protein kinase TEC; transferase, ATP-binding, SH3 domain, phosphorylation; NMR {Mus musculus} SCOP: b.34.2.1 Length = 67 | Back alignment and structure |
|---|
| >3qwy_A Cell death abnormality protein 2; cell engulfment, signaling protein; 2.52A {Caenorhabditis elegans} Length = 308 | Back alignment and structure |
|---|
| >3qwy_A Cell death abnormality protein 2; cell engulfment, signaling protein; 2.52A {Caenorhabditis elegans} Length = 308 | Back alignment and structure |
|---|
| >2kbt_A Chimera of proto-oncogene VAV, linker, immunoglobulin G-binding protein G; sortase, protein ligation, intein, inset, solubility enhancement; NMR {Mus musculus} Length = 142 | Back alignment and structure |
|---|
| >2e5k_A Suppressor of T-cell receptor signaling 1; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 94 | Back alignment and structure |
|---|
| >1ruw_A Myosin-3 isoform, MYO3; SH3 domain, yeast, high-throughput, structural genomics, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2btt_A 1va7_A Length = 69 | Back alignment and structure |
|---|
| >1ng2_A Neutrophil cytosolic factor 1; P47PHOX, autoinhibited, SH3 domain, NADPH oxidase, oxidoredu activator; 1.70A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 PDB: 1uec_A 1ov3_A 1wlp_B Length = 193 | Back alignment and structure |
|---|
| >1ng2_A Neutrophil cytosolic factor 1; P47PHOX, autoinhibited, SH3 domain, NADPH oxidase, oxidoredu activator; 1.70A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 PDB: 1uec_A 1ov3_A 1wlp_B Length = 193 | Back alignment and structure |
|---|
| >3cqt_A P59-FYN, proto-oncogene tyrosine-protein kinase FYN; beta barrel, ATP-binding, developmental protein, lipoprotein, manganese, metal-binding; 1.60A {Gallus gallus} PDB: 2l2p_A Length = 79 | Back alignment and structure |
|---|
| >2v1q_A SLA1, cytoskeleton assembly control protein SLA1; structural genomics, phosphorylation, structural protein, yeast, SH3 domain; 1.2A {Saccharomyces cerevisiae} PDB: 1z9z_A Length = 60 | Back alignment and structure |
|---|
| >1wxb_A Epidermal growth factor receptor pathway substrate 8-like protein; SH3, EPS8, EPS8L2, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 68 | Back alignment and structure |
|---|
| >1aww_A ATK, AMGX1, BPK, bruton'S tyrosine kinase; X-linked agammaglobulinemia, XLA, BTK, SH3 domain, transferase; NMR {Homo sapiens} SCOP: b.34.2.1 PDB: 1awx_A 1qly_A Length = 67 | Back alignment and structure |
|---|
| >2rf0_A Mitogen-activated protein kinase kinase kinase 10; MAP3K10, MLK2, SH3 domain, TKL kinase, MKN28, structural GEN structural genomics consortium, SGC; 2.00A {Homo sapiens} Length = 89 | Back alignment and structure |
|---|
| >2kgt_A Tyrosine-protein kinase 6; SH3 domain, SRC kinase, PTK6, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; NMR {Homo sapiens} Length = 72 | Back alignment and structure |
|---|
| >2yup_A Vinexin; sorbin and SH3 domain-containing protein 3, SH3-containing adapter molecule 1, SCAM-1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 90 | Back alignment and structure |
|---|
| >2csq_A RIM-BP2, RIM binding protein 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 97 | Back alignment and structure |
|---|
| >1wie_A RIM binding protein 2; beta barrel, KIAA0318 protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 96 | Back alignment and structure |
|---|
| >3rnj_A Brain-specific angiogenesis inhibitor 1-associate 2; structural genomics, structural genomics consortium, SGC, BE barrel; HET: EDT; 1.50A {Homo sapiens} Length = 67 | Back alignment and structure |
|---|
| >2d8j_A FYN-related kinase; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 77 | Back alignment and structure |
|---|
| >2vkn_A Protein SSU81; membrane, SH3 domain, transmembrane, membrane; 2.05A {Saccharomyces cerevisiae} Length = 70 | Back alignment and structure |
|---|
| >2egc_A SH3 and PX domain-containing protein 2A; SH3 domain, KIAA0418 protein, SH3MD1, SH3 multiple domains 1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 75 | Back alignment and structure |
|---|
| >1uhc_A KIAA1010 protein; beta barrel, SH3, human cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 79 | Back alignment and structure |
|---|
| >2i0n_A Class VII unconventional myosin; beta-sheet loop, structural protein; NMR {Dictyostelium discoideum} Length = 80 | Back alignment and structure |
|---|
| >3qwx_X Cell death abnormality protein 2; cell engulfment, signaling protein; 2.01A {Caenorhabditis elegans} Length = 174 | Back alignment and structure |
|---|
| >1wxt_A Hypothetical protein FLJ21522; SH3 domain, EPS8-related protein 3, protein-protein interaction, structural genomics; NMR {Homo sapiens} Length = 68 | Back alignment and structure |
|---|
| >2jmc_A Spectrin alpha chain, brain and P41 peptide chimera; SPC-SH3, signaling protein; NMR {Gallus gallus} Length = 77 | Back alignment and structure |
|---|
| >1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 | Back alignment and structure |
|---|
| >1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 | Back alignment and structure |
|---|
| >1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 | Back alignment and structure |
|---|
| >1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 | Back alignment and structure |
|---|
| >1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 | Back alignment and structure |
|---|
| >2enm_A Sorting nexin-9; SH3-like barrel, protein transport, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 77 | Back alignment and structure |
|---|
| >1wxu_A Peroxisomal biogenesis factor 13; SH3 domain, PEX13, protein-protein interaction, structural genomics; NMR {Mus musculus} Length = 93 | Back alignment and structure |
|---|
| >1u5s_A Cytoplasmic protein NCK2; protein-protein complex, beta barrel, beta sheet, zinc finger, metal binding protein; NMR {Homo sapiens} SCOP: b.34.2.1 PDB: 2fry_A Length = 71 | Back alignment and structure |
|---|
| >1gri_A Growth factor bound protein 2; SH2, SH3, signal transduction adaptor; 3.10A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 d.93.1.1 PDB: 1aze_A 2a37_A 2azv_A 2a36_A 2azs_A Length = 217 | Back alignment and structure |
|---|
| >1gri_A Growth factor bound protein 2; SH2, SH3, signal transduction adaptor; 3.10A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 d.93.1.1 PDB: 1aze_A 2a37_A 2azv_A 2a36_A 2azs_A Length = 217 | Back alignment and structure |
|---|
| >2jt4_A Cytoskeleton assembly control protein SLA1; endocytosis, SH3, actin-binding, cytoplasm, cytoskeleton, phosphorylation, SH3 domain, DNA damage, DNA repair, nucleus; NMR {Saccharomyces cerevisiae} Length = 71 | Back alignment and structure |
|---|
| >1zuu_A BZZ1 protein; SH3 domain, unknown function; 0.97A {Saccharomyces cerevisiae} SCOP: b.34.2.1 Length = 58 | Back alignment and structure |
|---|
| >1csk_A C-SRC SH3 domain; phosphotransferase; 2.50A {Homo sapiens} SCOP: b.34.2.1 Length = 71 | Back alignment and structure |
|---|
| >2ct4_A CDC42-interacting protein 4; thyroid receptor interacting protein 10, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 | Back alignment and structure |
|---|
| >1nm7_A Peroxisomal membrane protein PAS20; yeast, PEX5P, PEX14P, PEX13P, import machine, SH3 domain, protein transport; NMR {Saccharomyces cerevisiae} SCOP: b.34.2.1 Length = 69 | Back alignment and structure |
|---|
| >2rqv_A BUD emergence protein 1; BEM1P, SH3, CDC42P, cytoplasm, cytoskeleton, SH3 domain, SIG protein; NMR {Saccharomyces cerevisiae} PDB: 2rqw_A Length = 108 | Back alignment and structure |
|---|
| >2dyb_A Neutrophil cytosol factor 4; P40(PHOX), NADPH oxidase, oxidoreductase; HET: CAF; 3.15A {Homo sapiens} Length = 341 | Back alignment and structure |
|---|
| >3reb_B Tyrosine-protein kinase HCK; HIV-1 NEF, SH3 domain binding, signaling, HCK SH3 domain, PR binding; 3.45A {Homo sapiens} Length = 90 | Back alignment and structure |
|---|
| >2yt6_A Adult MALE urinary bladder cDNA, riken FULL- length enriched library, clone:9530076O17...; SH3_1 domain; NMR {Mus musculus} Length = 109 | Back alignment and structure |
|---|
| >1wx6_A Cytoplasmic protein NCK2; SH3 domain, structural genomics, signal transduction, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} Length = 91 | Back alignment and structure |
|---|
| >2dl5_A KIAA0769 protein; SH3 domain, FCHSD2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 | Back alignment and structure |
|---|
| >1bb9_A Amphiphysin 2; transferase, SH3 domain; 2.20A {Rattus norvegicus} SCOP: b.34.2.1 PDB: 1muz_A 1mv0_B Length = 115 | Back alignment and structure |
|---|
| >2iim_A Proto-oncogene tyrosine-protein kinase LCK; beta-barrels, signaling protein; HET: PG4; 1.00A {Homo sapiens} SCOP: b.34.2.1 PDB: 1h92_A 1kik_A Length = 62 | Back alignment and structure |
|---|
| >2kym_A BUD emergence protein 1; SH3 domain, BEM1P, SH3-CI, STE20P PRR, CDC42P-interacting, S signaling protein; NMR {Lodderomyces elongisporus} Length = 120 | Back alignment and structure |
|---|
| >2v1r_A Peroxisomal membrane protein PAS20; protein transport, translocation, transmembrane, peptide COM structural genomics, peroxisome; 2.1A {Saccharomyces cerevisiae} SCOP: b.34.2.1 Length = 80 | Back alignment and structure |
|---|
| >1x6g_A Megakaryocyte-associated tyrosine-protein kinase; MATK, CTK, HYL, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 | Back alignment and structure |
|---|
| >2oi3_A Tyrosine-protein kinase HCK; human HCK, SH3, SRC-type tyrosine kinase, transferase; NMR {Homo sapiens} PDB: 2oj2_A 4hck_A 5hck_A Length = 86 | Back alignment and structure |
|---|
| >1jqq_A PEX13P, peroxisomal membrane protein PAS20, PAS20P, roxin-13; compact beta-barrel of five anti-parrallel beta-strands; 2.65A {Saccharomyces cerevisiae} SCOP: b.34.2.1 PDB: 1n5z_A Length = 92 | Back alignment and structure |
|---|
| >2b86_A Cytoplasmic protein NCK2; NCK SH3 domain, signaling protein; NMR {Homo sapiens} PDB: 2js2_A Length = 67 | Back alignment and structure |
|---|
| >2yuq_A Tyrosine-protein kinase ITK/TSK; T-cell-specific kinase, tyrosine-protein kinase LYK, kinase EMT, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 85 | Back alignment and structure |
|---|
| >2dvj_A V-CRK sarcoma virus CT10 oncogene homolog, isoform A; SH3, SH2, signal transduction, adapter molecule, signaling protein; HET: PTR; NMR {Homo sapiens} PDB: 2eyy_A 2eyv_A 2eyw_A Length = 230 | Back alignment and structure |
|---|
| >2k2m_A EPS8-like protein 1; alternative splicing, coiled coil, cytoplasm, SH3 domain, signaling protein; NMR {Homo sapiens} PDB: 2rol_A Length = 68 | Back alignment and structure |
|---|
| >1awj_A ITK; transferase, regulatory intramolecular complex, kinase; NMR {Mus musculus} SCOP: b.34.2.1 PDB: 2rn8_A 2rna_A 2k79_A 2k7a_A Length = 77 | Back alignment and structure |
|---|
| >2jw4_A Cytoplasmic protein NCK1; SH3 domain, phosphorylation, SH2 domain, signaling protein; NMR {Homo sapiens} Length = 72 | Back alignment and structure |
|---|
| >1i07_A Epidermal growth factor receptor kinase substrate EPS8; hormone/growth factor; 1.80A {Mus musculus} SCOP: b.34.2.1 PDB: 1aoj_A 1i0c_A Length = 60 | Back alignment and structure |
|---|
| >2rqr_A CED-12 homolog, engulfment and cell motility protein 1, linker, D of cytokinesis protein 2; KIAA0209, KIAA0281, apoptosis, membrane, phagocytosis; NMR {Homo sapiens} Length = 119 | Back alignment and structure |
|---|
| >2cud_A SRC-like-adapter; SH3 domain, negative mitogenesis regulator, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 79 | Back alignment and structure |
|---|
| >2jxb_A T-cell surface glycoprotein CD3 epsilon chain, cytoplasmic protein NCK2; T-cell receptor, SH3 domain, immunology, SH2 domain; NMR {Homo sapiens} Length = 86 | Back alignment and structure |
|---|
| >2de0_X Alpha-(1,6)-fucosyltransferase; FUT8, glycosyltransferase, N-glycan, COR SH3 domain; 2.61A {Homo sapiens} Length = 526 | Back alignment and structure |
|---|
| >1g2b_A Spectrin alpha chain; capping protein, calcium-binding, duplication, repeat, SH3 domain, cytoskeleton, metal binding protein; 1.12A {Gallus gallus} SCOP: b.34.2.1 PDB: 1tud_A Length = 62 | Back alignment and structure |
|---|
| >2pz1_A RHO guanine nucleotide exchange factor 4; helical bundle, beta barrel, beta sandwich, signaling protei; 2.25A {Homo sapiens} PDB: 2dx1_A 3nmz_D 3nmx_D Length = 466 | Back alignment and structure |
|---|
| >3o5z_A Phosphatidylinositol 3-kinase regulatory subunit; SRC homology 3 domain, protein binding; 2.01A {Homo sapiens} PDB: 2kt1_A Length = 90 | Back alignment and structure |
|---|
| >2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Length = 535 | Back alignment and structure |
|---|
| >1k1z_A VAV; SH3, proto-oncogene, signaling protein; NMR {Mus musculus} SCOP: b.34.2.1 Length = 78 | Back alignment and structure |
|---|
| >1gcq_C VAV proto-oncogene; SH3 domain, protein-protein complex, GRB2,VAV, signaling protein/signaling protein complex; 1.68A {Mus musculus} SCOP: b.34.2.1 PDB: 1gcp_A Length = 70 | Back alignment and structure |
|---|
| >1i1j_A Melanoma derived growth regulatory protein; SH3 subdomain, hormone/growth factor complex; 1.39A {Homo sapiens} SCOP: b.34.2.1 PDB: 1k0x_A 1hjd_A Length = 108 | Back alignment and structure |
|---|
| >1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A Length = 495 | Back alignment and structure |
|---|
| >3jv3_A Intersectin-1; SH3 domain, DH domain, guanine nucleotide exchange factor, autoinhibition, domain-swapped, cell junction, cell project endocytosis; 2.40A {Mus musculus} PDB: 3gf9_A Length = 283 | Back alignment and structure |
|---|
| >3a98_A DOCK2, dedicator of cytokinesis protein 2; protein-protein complex, DOCK2, ELMO1, SH3 domain, PH domain bundle, proline-rich sequence, cytoskeleton; 2.10A {Homo sapiens} Length = 184 | Back alignment and structure |
|---|
| >3i5r_A Phosphatidylinositol 3-kinase regulatory subunit alpha; SH3 domain, peptide complex, alternative splicing, disease mutation, HOST-virus interaction, phosphoprotein, polymorphism; 1.70A {Homo sapiens} PDB: 3i5s_A 1pht_A 1pnj_A 2pni_A 1pks_A 1pkt_A Length = 83 | Back alignment and structure |
|---|
| >1ug1_A KIAA1010 protein; structural genomics, SH3 domain, hypothetical protein BAA76854.1, riken structural genomics/proteomics initiative RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 92 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 420 | |||
| 3p8c_F | 159 | ABL interactor 2; actin polymerization, protein bi | 100.0 | |
| 2lx7_A | 60 | GAS-7, growth arrest-specific protein 7; structura | 99.45 | |
| 2lj0_A | 65 | Sorbin and SH3 domain-containing protein 1; R85FL, | 99.44 | |
| 2dbk_A | 88 | CRK-like protein; structural genomics, NPPSFA, nat | 99.39 | |
| 2eyx_A | 67 | V-CRK sarcoma virus CT10 oncogene homolog isoform | 99.38 | |
| 2g6f_X | 59 | RHO guanine nucleotide exchange factor 7; SH3 doma | 99.38 | |
| 2xmf_A | 60 | Myosin 1E SH3; motor protein, SH3 domain; HET: DIA | 99.37 | |
| 1k4u_S | 62 | Phagocyte NADPH oxidase subunit P67PHOX; SH3-pepti | 99.37 | |
| 1zx6_A | 58 | YPR154WP; SH3 domain, protein binding; 1.60A {Sacc | 99.37 | |
| 1w70_A | 60 | Neutrophil cytosol factor 4; NADPH oxidase, P40PHO | 99.37 | |
| 2ew3_A | 68 | SH3-containing GRB2-like protein 3; SH3GL3, soluti | 99.37 | |
| 2nwm_A | 65 | Vinexin; cell adhesion; NMR {Homo sapiens} | 99.37 | |
| 1uti_A | 58 | GRB2-related adaptor protein 2; signaling protein | 99.37 | |
| 2bz8_A | 58 | SH3-domain kinase binding protein 1; SH3 domain, C | 99.36 | |
| 2dmo_A | 68 | Neutrophil cytosol factor 2; SH3 domain, structura | 99.36 | |
| 1x69_A | 79 | Cortactin isoform A; SH3 domain, CTTN, oncogene EM | 99.36 | |
| 2ebp_A | 73 | SAM and SH3 domain-containing protein 1; proline-g | 99.36 | |
| 2bzy_A | 67 | CRK-like protein, CRKL SH3C; SH3 domain, dimer, nu | 99.36 | |
| 2fei_A | 65 | CD2-associated protein; CMS SH3 domain, structural | 99.36 | |
| 1sem_A | 58 | SEM-5; SRC-homology 3 (SH3) domain, peptide-bindin | 99.35 | |
| 2djq_A | 68 | SH3 domain containing ring finger 2; MUS musculus | 99.35 | |
| 1jo8_A | 58 | ABP1P, actin binding protein; SH3 domain actin-bin | 99.35 | |
| 2drm_A | 58 | Acanthamoeba myosin IB; SH3 domain, contractIle pr | 99.35 | |
| 2jte_A | 64 | CD2-associated protein; SH3 domain, coiled coil, c | 99.34 | |
| 2dl4_A | 68 | Protein STAC; SH3 domain, STAC protein, SRC homolo | 99.34 | |
| 3ulr_B | 65 | SRC substrate cortactin; SH3, protein-protein inte | 99.34 | |
| 2ak5_A | 64 | RHO guanine nucleotide exchange factor 7; adaptor | 99.34 | |
| 2dl8_A | 72 | SLIT-ROBO RHO GTPase-activating protein 2; SH3 dom | 99.34 | |
| 1oot_A | 60 | Hypothetical 40.4 kDa protein in PES4-His2 interge | 99.34 | |
| 2j6f_A | 62 | CD2-associated protein; metal-binding, immune resp | 99.34 | |
| 2i0n_A | 80 | Class VII unconventional myosin; beta-sheet loop, | 99.34 | |
| 2vwf_A | 58 | Growth factor receptor-bound protein 2; polymorphi | 99.34 | |
| 1z9q_A | 79 | Neutrophil cytosol factor 4; oxidoreductase activa | 99.34 | |
| 3ngp_A | 62 | Spectrin alpha chain, brain; beta barrel, structur | 99.34 | |
| 2fpe_A | 62 | C-JUN-amino-terminal kinase interacting protein 1; | 99.33 | |
| 2ydl_A | 69 | SH3 domain-containing kinase-binding protein 1; si | 99.33 | |
| 2ed0_A | 78 | ABL interactor 2; coiled coil, cytoskeleton, nucle | 99.33 | |
| 4glm_A | 72 | Dynamin-binding protein; SH3 domain, DNMBP, struct | 99.33 | |
| 1zlm_A | 58 | Osteoclast stimulating factor 1; beta barrel, sign | 99.33 | |
| 2ekh_A | 80 | SH3 and PX domain-containing protein 2A; SH3 domai | 99.32 | |
| 1uff_A | 93 | Intersectin 2; beta barrel, SH3 domain, endocytosi | 99.32 | |
| 1wyx_A | 69 | CRK-associated substrate; beta sheets, cell adhesi | 99.32 | |
| 2dl7_A | 73 | KIAA0769 protein; SH3 domain, FCHSD2, structural g | 99.32 | |
| 1x2p_A | 68 | Protein arginine N-methyltransferase 2; SH3 domain | 99.32 | |
| 2gnc_A | 60 | SLIT-ROBO RHO GTPase-activating protein 1; beta ba | 99.32 | |
| 1cka_A | 57 | C-CRK N-terminal SH3 domain; complex (oncogene pro | 99.32 | |
| 1x2k_A | 68 | OSTF1, osteoclast stimulating factor 1; SH3 domain | 99.32 | |
| 3u23_A | 65 | CD2-associated protein; structural genomics, struc | 99.32 | |
| 3c0c_A | 73 | Endophilin-A2; endocytosis, SH3, voltage-gated cal | 99.32 | |
| 2dlp_A | 85 | KIAA1783 protein; SH3 domain, structural genomics, | 99.31 | |
| 1tg0_A | 68 | BBC1 protein, myosin tail region-interacting prote | 99.31 | |
| 1b07_A | 65 | Protein (proto-oncogene CRK (CRK)); SH3 domain, in | 99.31 | |
| 1ujy_A | 76 | RHO guanine nucleotide exchange factor 6; structur | 99.31 | |
| 4e6r_A | 58 | Cytoplasmic protein NCK2; SH3 domain, protein bind | 99.31 | |
| 2pqh_A | 80 | Spectrin alpha chain, brain; SH3 domain, chimera, | 99.31 | |
| 2dbm_A | 73 | SH3-containing GRB2-like protein 2; EC 2.3.1.-, SH | 99.31 | |
| 2yuo_A | 78 | CIP85, RUN and TBC1 domain containing 3; structura | 99.31 | |
| 2fpf_A | 71 | C-JUN-amino-terminal kinase interacting protein 1; | 99.31 | |
| 2dl3_A | 68 | Sorbin and SH3 domain-containing protein 1; ponsin | 99.3 | |
| 3h0h_A | 73 | Proto-oncogene tyrosine-protein kinase FYN; beta b | 99.3 | |
| 1x2q_A | 88 | Signal transducing adapter molecule 2; SH3 domain, | 99.3 | |
| 1y0m_A | 61 | 1-phosphatidylinositol-4,5-bisphosphate phosphodie | 99.3 | |
| 2dil_A | 69 | Proline-serine-threonine phosphatase-interacting p | 99.3 | |
| 2a28_A | 54 | BZZ1 protein; SH3 domain, signaling protein; 1.07A | 99.3 | |
| 4esr_A | 69 | Jouberin; AHI-1, AHI1, AHI-1 SH3 domain, SH3 domai | 99.3 | |
| 2epd_A | 76 | RHO GTPase-activating protein 4; SH3 domain, struc | 99.29 | |
| 3thk_A | 73 | Spectrin alpha chain, brain; SH3 domain, chimera, | 99.29 | |
| 2cre_A | 71 | HEF-like protein; SH3 domain, SRC homology 3 domai | 99.29 | |
| 2ed1_A | 76 | 130 kDa phosphatidylinositol 4,5-biphosphate- depe | 99.29 | |
| 2ysq_A | 81 | RHO guanine nucleotide exchange factor 9; SH3 doma | 99.29 | |
| 1uj0_A | 62 | Signal transducing adaptor molecule (SH3 domain an | 99.29 | |
| 1uhc_A | 79 | KIAA1010 protein; beta barrel, SH3, human cDNA, st | 99.29 | |
| 4f14_A | 64 | Nebulette; SH3 domain, heart muscle, actin-binding | 99.29 | |
| 2l0a_A | 72 | STAM-1, signal transducing adapter molecule 1; str | 99.29 | |
| 1wi7_A | 68 | SH3-domain kinase binding protein 1; beta barrel, | 99.29 | |
| 1u5s_A | 71 | Cytoplasmic protein NCK2; protein-protein complex, | 99.29 | |
| 2kxd_A | 73 | 11-MER peptide, SH3 domain of spectrin alpha CHAI; | 99.28 | |
| 2yun_A | 79 | Nostrin; nitric oxide synthase trafficker, structu | 99.28 | |
| 2v1q_A | 60 | SLA1, cytoskeleton assembly control protein SLA1; | 99.28 | |
| 2k9g_A | 73 | SH3 domain-containing kinase-binding protein 1; CI | 99.28 | |
| 2ega_A | 70 | SH3 and PX domain-containing protein 2A; SH3 domai | 99.28 | |
| 2lcs_A | 73 | NAP1-binding protein 2; adaptor, transferase, sign | 99.28 | |
| 1gl5_A | 67 | Tyrosine-protein kinase TEC; transferase, ATP-bind | 99.28 | |
| 1zuy_A | 58 | Myosin-5 isoform; SH3 domain, contractIle protein; | 99.28 | |
| 1x6b_A | 79 | RHO guanine exchange factor (GEF) 16; SH3 domain, | 99.28 | |
| 1x43_A | 81 | Endophilin B1, SH3 domain GRB2-like protein B1; st | 99.28 | |
| 2jt4_A | 71 | Cytoskeleton assembly control protein SLA1; endocy | 99.27 | |
| 2oaw_A | 65 | Spectrin alpha chain, brain; SH3 domain, chimera, | 99.27 | |
| 1ue9_A | 80 | Intersectin 2; beta barrel, SH3 domain, riken stru | 99.27 | |
| 2da9_A | 70 | SH3-domain kinase binding protein 1; structural ge | 99.27 | |
| 1neg_A | 83 | Spectrin alpha chain, brain; SH3-domain fold, five | 99.27 | |
| 2dnu_A | 71 | RUH-061, SH3 multiple domains 1; RSGI, structural | 99.26 | |
| 3eg3_A | 63 | Proto-oncogene tyrosine-protein kinase ABL1; beta, | 99.26 | |
| 1ruw_A | 69 | Myosin-3 isoform, MYO3; SH3 domain, yeast, high-th | 99.26 | |
| 2d8h_A | 80 | SH3YL1 protein; SH3 domain, hypothetical protein S | 99.26 | |
| 1ugv_A | 72 | KIAA0621, olygophrenin-1 like protein; beta barrel | 99.26 | |
| 1uhf_A | 69 | Intersectin 2; beta barrel, SH3 domain, riken stru | 99.26 | |
| 2dm1_A | 73 | Protein VAV-2; RHO family guanine nucleotide excha | 99.26 | |
| 2ke9_A | 83 | Caskin-2; SH3 domain, ANK repeat, cytoplasm, phosp | 99.26 | |
| 2jxb_A | 86 | T-cell surface glycoprotein CD3 epsilon chain, cyt | 99.26 | |
| 1csk_A | 71 | C-SRC SH3 domain; phosphotransferase; 2.50A {Homo | 99.26 | |
| 3cqt_A | 79 | P59-FYN, proto-oncogene tyrosine-protein kinase FY | 99.26 | |
| 1w1f_A | 65 | Tyrosine-protein kinase LYN; SH3-domain, SH3 domai | 99.26 | |
| 2cub_A | 88 | Cytoplasmic protein NCK1; SH3 domain, NCK1 adaptor | 99.26 | |
| 2iim_A | 62 | Proto-oncogene tyrosine-protein kinase LCK; beta-b | 99.26 | |
| 2cuc_A | 70 | SH3 domain containing ring finger 2; structural ge | 99.25 | |
| 2ege_A | 75 | Uncharacterized protein KIAA1666; SH3 domain, KIAA | 99.25 | |
| 1aww_A | 67 | ATK, AMGX1, BPK, bruton'S tyrosine kinase; X-linke | 99.25 | |
| 1j3t_A | 74 | Intersectin 2; beta barrel, SH3 domain, riken stru | 99.25 | |
| 2j05_A | 65 | RAS GTPase-activating protein 1; GTPase activation | 99.25 | |
| 1jqq_A | 92 | PEX13P, peroxisomal membrane protein PAS20, PAS20P | 99.25 | |
| 2ecz_A | 70 | Sorbin and SH3 domain-containing protein 1; glycop | 99.25 | |
| 2o9s_A | 67 | Ponsin; SH3 domain, signaling protein; 0.83A {Homo | 99.25 | |
| 3rnj_A | 67 | Brain-specific angiogenesis inhibitor 1-associate | 99.24 | |
| 2eqi_A | 69 | Phospholipase C, gamma 2; SH3 domain, PLCG2, struc | 99.24 | |
| 2x3w_D | 60 | Syndapin I, protein kinase C and casein kinase sub | 99.24 | |
| 1spk_A | 72 | RSGI RUH-010, riken cDNA 1300006M19; structural ge | 99.24 | |
| 1yn8_A | 59 | NBP2, NAP1-binding protein 2; SH3 domain, unknown | 99.24 | |
| 2o2o_A | 92 | SH3-domain kinase-binding protein 1; CIN85, protei | 99.24 | |
| 2yup_A | 90 | Vinexin; sorbin and SH3 domain-containing protein | 99.24 | |
| 2b86_A | 67 | Cytoplasmic protein NCK2; NCK SH3 domain, signalin | 99.24 | |
| 1awj_A | 77 | ITK; transferase, regulatory intramolecular comple | 99.24 | |
| 2k2m_A | 68 | EPS8-like protein 1; alternative splicing, coiled | 99.24 | |
| 1nm7_A | 69 | Peroxisomal membrane protein PAS20; yeast, PEX5P, | 99.24 | |
| 1wie_A | 96 | RIM binding protein 2; beta barrel, KIAA0318 prote | 99.23 | |
| 2kxc_A | 67 | Brain-specific angiogenesis inhibitor 1-associate | 99.23 | |
| 2ct3_A | 70 | Vinexin; SH3 domian, structural genomics, NPPSFA, | 99.23 | |
| 2egc_A | 75 | SH3 and PX domain-containing protein 2A; SH3 domai | 99.23 | |
| 1zuu_A | 58 | BZZ1 protein; SH3 domain, unknown function; 0.97A | 99.23 | |
| 2oi3_A | 86 | Tyrosine-protein kinase HCK; human HCK, SH3, SRC-t | 99.23 | |
| 2rqr_A | 119 | CED-12 homolog, engulfment and cell motility prote | 99.23 | |
| 1wx6_A | 91 | Cytoplasmic protein NCK2; SH3 domain, structural g | 99.23 | |
| 2gqi_A | 71 | RAS GTPase-activating protein 1; GAP, RAS P21 prot | 99.23 | |
| 2v1r_A | 80 | Peroxisomal membrane protein PAS20; protein transp | 99.23 | |
| 2csq_A | 97 | RIM-BP2, RIM binding protein 2; SH3 domain, struct | 99.23 | |
| 2rf0_A | 89 | Mitogen-activated protein kinase kinase kinase 10; | 99.22 | |
| 1s1n_A | 68 | Nephrocystin 1; beta barrel, cell adhesion; NMR {H | 99.22 | |
| 4ag1_C | 84 | Fynomer; hydrolase-de novo protein complex, inhibi | 99.21 | |
| 2dl5_A | 78 | KIAA0769 protein; SH3 domain, FCHSD2, structural g | 99.21 | |
| 2jw4_A | 72 | Cytoplasmic protein NCK1; SH3 domain, phosphorylat | 99.21 | |
| 2d8j_A | 77 | FYN-related kinase; SH3 domain, structural genomic | 99.21 | |
| 1wxb_A | 68 | Epidermal growth factor receptor pathway substrate | 99.21 | |
| 2kgt_A | 72 | Tyrosine-protein kinase 6; SH3 domain, SRC kinase, | 99.2 | |
| 1wxt_A | 68 | Hypothetical protein FLJ21522; SH3 domain, EPS8-re | 99.2 | |
| 1gbq_A | 74 | GRB2; complex (signal transduction/peptide), SH3 d | 99.19 | |
| 1tuc_A | 63 | Alpha-spectrin; capping protein, calcium-binding, | 99.19 | |
| 2csi_A | 76 | RIM-BP2, RIM binding protein 2; SH3 domain, struct | 99.18 | |
| 1i07_A | 60 | Epidermal growth factor receptor kinase substrate | 99.18 | |
| 1k1z_A | 78 | VAV; SH3, proto-oncogene, signaling protein; NMR { | 99.18 | |
| 1i1j_A | 108 | Melanoma derived growth regulatory protein; SH3 su | 99.18 | |
| 2yuq_A | 85 | Tyrosine-protein kinase ITK/TSK; T-cell-specific k | 99.18 | |
| 2cud_A | 79 | SRC-like-adapter; SH3 domain, negative mitogenesis | 99.18 | |
| 2kbt_A | 142 | Chimera of proto-oncogene VAV, linker, immunoglobu | 99.17 | |
| 1gcq_C | 70 | VAV proto-oncogene; SH3 domain, protein-protein co | 99.16 | |
| 2vkn_A | 70 | Protein SSU81; membrane, SH3 domain, transmembrane | 99.16 | |
| 1x6g_A | 81 | Megakaryocyte-associated tyrosine-protein kinase; | 99.16 | |
| 2enm_A | 77 | Sorting nexin-9; SH3-like barrel, protein transpor | 99.16 | |
| 2ct4_A | 70 | CDC42-interacting protein 4; thyroid receptor inte | 99.16 | |
| 1udl_A | 98 | Intersectin 2, KIAA1256; beta barrel, SH3 domain, | 99.15 | |
| 1hsq_A | 71 | Phospholipase C-gamma (SH3 domain); phosphoric die | 99.14 | |
| 2e5k_A | 94 | Suppressor of T-cell receptor signaling 1; SH3 dom | 99.14 | |
| 2yt6_A | 109 | Adult MALE urinary bladder cDNA, riken FULL- lengt | 99.13 | |
| 1wxu_A | 93 | Peroxisomal biogenesis factor 13; SH3 domain, PEX1 | 99.13 | |
| 2rqv_A | 108 | BUD emergence protein 1; BEM1P, SH3, CDC42P, cytop | 99.13 | |
| 2m0y_A | 74 | Dedicator of cytokinesis protein 1; apoptosis; NMR | 99.13 | |
| 3reb_B | 90 | Tyrosine-protein kinase HCK; HIV-1 NEF, SH3 domain | 99.12 | |
| 1bb9_A | 115 | Amphiphysin 2; transferase, SH3 domain; 2.20A {Rat | 99.11 | |
| 2jmc_A | 77 | Spectrin alpha chain, brain and P41 peptide chimer | 99.1 | |
| 3o5z_A | 90 | Phosphatidylinositol 3-kinase regulatory subunit; | 99.1 | |
| 3i5r_A | 83 | Phosphatidylinositol 3-kinase regulatory subunit a | 99.08 | |
| 1mv3_A | 213 | MYC box dependent interacting protein 1; tumor sup | 99.07 | |
| 2kym_A | 120 | BUD emergence protein 1; SH3 domain, BEM1P, SH3-CI | 99.06 | |
| 3qwx_X | 174 | Cell death abnormality protein 2; cell engulfment, | 99.04 | |
| 1ng2_A | 193 | Neutrophil cytosolic factor 1; P47PHOX, autoinhibi | 99.02 | |
| 1gri_A | 217 | Growth factor bound protein 2; SH2, SH3, signal tr | 99.02 | |
| 2eyz_A | 304 | V-CRK sarcoma virus CT10 oncogene homolog isoform | 99.02 | |
| 2dvj_A | 230 | V-CRK sarcoma virus CT10 oncogene homolog, isoform | 98.99 | |
| 1ng2_A | 193 | Neutrophil cytosolic factor 1; P47PHOX, autoinhibi | 98.96 | |
| 4d8k_A | 175 | Tyrosine-protein kinase LCK; protein kinases, SH2 | 98.93 | |
| 2h8h_A | 535 | Proto-oncogene tyrosine-protein kinase SRC; SRC ki | 98.91 | |
| 1v1c_A | 71 | Obscurin; muscle, sarcomere, adapter, myogenesis, | 98.9 | |
| 2dyb_A | 341 | Neutrophil cytosol factor 4; P40(PHOX), NADPH oxid | 98.89 | |
| 2pz1_A | 466 | RHO guanine nucleotide exchange factor 4; helical | 98.88 | |
| 2lqn_A | 303 | CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT | 98.38 | |
| 3qwy_A | 308 | Cell death abnormality protein 2; cell engulfment, | 98.83 | |
| 2eyz_A | 304 | V-CRK sarcoma virus CT10 oncogene homolog isoform | 98.82 | |
| 3a98_A | 184 | DOCK2, dedicator of cytokinesis protein 2; protein | 98.8 | |
| 3qwy_A | 308 | Cell death abnormality protein 2; cell engulfment, | 98.78 | |
| 2de0_X | 526 | Alpha-(1,6)-fucosyltransferase; FUT8, glycosyltran | 98.73 | |
| 2lqn_A | 303 | CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT | 98.17 | |
| 1k9a_A | 450 | Carboxyl-terminal SRC kinase; COOH-terminal SRC ki | 98.68 | |
| 1opk_A | 495 | P150, C-ABL, proto-oncogene tyrosine-protein kinas | 98.6 | |
| 1qcf_A | 454 | Haematopoetic cell kinase (HCK); tyrosine kinase-i | 98.57 | |
| 3haj_A | 486 | Human pacsin2 F-BAR; pacsin,syndapin,FAP52,F-BAR, | 98.54 | |
| 1ri9_A | 102 | FYN-binding protein; SH3-like, helically extended, | 98.5 | |
| 1u3o_A | 82 | Huntingtin-associated protein-interacting protein; | 98.42 | |
| 1g2b_A | 62 | Spectrin alpha chain; capping protein, calcium-bin | 98.36 | |
| 1kjw_A | 295 | Postsynaptic density protein 95; protein-protein i | 98.2 | |
| 3pvl_A | 655 | Myosin VIIA isoform 1; protein complex, novel fold | 98.2 | |
| 1ycs_B | 239 | 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres | 98.16 | |
| 2gtj_A | 96 | FYN-binding protein; SH3, redox, signaling protein | 98.08 | |
| 3ehr_A | 222 | Osteoclast-stimulating factor 1; beta barrel, heli | 97.97 | |
| 4dey_A | 337 | Voltage-dependent L-type calcium channel subunit; | 97.97 | |
| 1ug1_A | 92 | KIAA1010 protein; structural genomics, SH3 domain, | 97.96 | |
| 2xkx_A | 721 | Disks large homolog 4; structural protein, scaffol | 97.79 | |
| 3tsz_A | 391 | Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffol | 97.75 | |
| 3shw_A | 468 | Tight junction protein ZO-1; PDZ-SH3-GUK supramodu | 97.61 | |
| 2dyb_A | 341 | Neutrophil cytosol factor 4; P40(PHOX), NADPH oxid | 97.49 | |
| 3pe0_A | 283 | Plectin; cytoskeleton, plakin, spectrin repeat, SH | 97.06 | |
| 3kfv_A | 308 | Tight junction protein ZO-3; structural genomics c | 96.67 | |
| 3tvt_A | 292 | Disks large 1 tumor suppressor protein; DLG, SRC-h | 96.49 | |
| 3r6n_A | 450 | Desmoplakin; spectrin repeat, SH3 domain, cell adh | 95.81 | |
| 2krs_A | 74 | Probable enterotoxin; all beta, SH3, ENTD, CPF_058 | 94.1 | |
| 2kt8_A | 76 | Probable surface protein; SH3 family, structural g | 93.97 | |
| 2kq8_A | 70 | Cell WALL hydrolase; GFT protein structure, NESG, | 93.94 | |
| 3b5n_C | 70 | Protein transport protein SEC9; snare complex, syn | 88.44 | |
| 3h8z_A | 128 | FragIle X mental retardation syndrome-related Pro; | 83.04 | |
| 1l4a_C | 83 | S-SNAP25 fusion protein; snare, snare complex, mem | 83.04 | |
| 2d4y_A | 463 | HAP1, flagellar HOOK-associated protein 1; multi-d | 80.85 | |
| 3npf_A | 306 | Putative dipeptidyl-peptidase VI; structural genom | 80.05 | |
| 1n7s_C | 79 | SNAP-25A; neuronal snare protein complex, four hel | 80.04 |
| >3p8c_F ABL interactor 2; actin polymerization, protein binding; 2.29A {Homo sapiens} | Back alignment and structure |
|---|
Probab=100.00 E-value=5.1e-60 Score=425.56 Aligned_cols=142 Identities=66% Similarity=0.985 Sum_probs=140.5
Q ss_pred ChHHHHHHhhcchhhHHHHHHhHHhHHHHHHHHhhhccCCchhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q psy9761 1 MAELASLLTTEIPEGRTSLLDSHSNLEKVAEYCEGNYFQADNKRMALEETKNYTTQSLASVAYQINTLAYNFLQLLDLQT 80 (420)
Q Consensus 1 m~el~~~~~~~ip~~r~~L~~~~~nL~~vA~YCe~nY~~~~dk~~aleetk~y~~qsLasVayqIn~lA~~ll~lLd~Q~ 80 (420)
|+||++||++|||++|++|+|||+||++||||||+||++++||++||||||+||+|||||||||||+||++||+|||+|+
T Consensus 2 ~~~l~~l~~~eiP~~r~~L~~s~~nL~~vAdYCE~nY~qs~dK~~aleeTK~Ya~qsLaSVAyqIn~lA~~ll~lLd~Q~ 81 (159)
T 3p8c_F 2 MAELQMLLEEEIPGGRRALFDSYTNLERVADYCENNYIQSADKQRALEETKAYTTQSLASVAYLINTLANNVLQMLDIQA 81 (159)
T ss_dssp HHHHHHHHHTHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCSCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred HHHHHHHHHhhhhhHHHHHHHHHhhHHHHHHHHHHHHhccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence 79999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred HHHHHHHHhhhhhhh-------------hceeeccccccccceeeCCCCCCCCCCccccCCCCCCccccCccccc
Q psy9761 81 AQLEEMESQMNHIGQ-------------IGVLTANKTTNRQYKIIAPANPEKPIKYVRKPIDLNALDDIGHGVRN 142 (420)
Q Consensus 81 ~~~~~~e~~i~~l~q-------------ig~lt~~k~~~r~~ki~~p~~~e~~~~y~r~pi~y~~ld~vGhg~~~ 142 (420)
++|++||++|++|+| ||+||++|+..|+||||+|++.|+++||+|+||||++||+||||+|.
T Consensus 82 ~~l~~mes~v~~l~Q~v~ih~EKvaRreIg~lT~~k~~~r~~kii~p~~~e~~~~Y~R~pI~y~~LD~iGhGvk~ 156 (159)
T 3p8c_F 82 SQLRRMESSINHISQTVDIHKEKVARREIGILTTNKNTSRTHKIIAPANLERPVRYIRKPIDYTILDDIGHGVKV 156 (159)
T ss_dssp HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTCEECCCCCCCSEECCSSCCCCCCCCCCCCCTTTTTTTTTCCCC
T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhccccccCCcCcccCCCCCCCCCCCccCCCchHhhcCCCcCccc
Confidence 999999999999999 89999999999999999999999999999999999999999999983
|
| >2lx7_A GAS-7, growth arrest-specific protein 7; structural genomics, northeast structural genomics consortiu target HR8574A, PSI-biology; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2lj0_A Sorbin and SH3 domain-containing protein 1; R85FL, ponsin, CAP, signaling protein; NMR {Homo sapiens} PDB: 2lj1_A | Back alignment and structure |
|---|
| >2dbk_A CRK-like protein; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eyx_A V-CRK sarcoma virus CT10 oncogene homolog isoform A; SH3, signaling protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2g6f_X RHO guanine nucleotide exchange factor 7; SH3 domain, peptide interaction, signaling protein; HET: NCO; 0.92A {Rattus norvegicus} PDB: 2df6_A* 2p4r_A 2esw_A | Back alignment and structure |
|---|
| >2xmf_A Myosin 1E SH3; motor protein, SH3 domain; HET: DIA; 1.50A {Mus musculus} | Back alignment and structure |
|---|
| >1k4u_S Phagocyte NADPH oxidase subunit P67PHOX; SH3-peptide complex, helix-turn-helix, hormone/growth factor complex; NMR {Homo sapiens} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >1zx6_A YPR154WP; SH3 domain, protein binding; 1.60A {Saccharomyces cerevisiae} PDB: 1ynz_A | Back alignment and structure |
|---|
| >1w70_A Neutrophil cytosol factor 4; NADPH oxidase, P40PHOX, P47PHOX, SH3 domain, polyproline; 1.46A {Homo sapiens} PDB: 1w6x_A | Back alignment and structure |
|---|
| >2ew3_A SH3-containing GRB2-like protein 3; SH3GL3, solution structure, signaling protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2nwm_A Vinexin; cell adhesion; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1uti_A GRB2-related adaptor protein 2; signaling protein regulator, SH3 domain/complex, adaptor protein (MONA); 1.5A {Mus musculus} SCOP: b.34.2.1 PDB: 1h3h_A 1oeb_A 2w10_A 2d0n_A | Back alignment and structure |
|---|
| >2bz8_A SH3-domain kinase binding protein 1; SH3 domain, CIN85 adaptor protein, CBL ubiquitin ligase; 2.0A {Homo sapiens} | Back alignment and structure |
|---|
| >2dmo_A Neutrophil cytosol factor 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x69_A Cortactin isoform A; SH3 domain, CTTN, oncogene EMS1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ebp_A SAM and SH3 domain-containing protein 1; proline-glutamate repeat-containing protein, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2kea_A | Back alignment and structure |
|---|
| >2bzy_A CRK-like protein, CRKL SH3C; SH3 domain, dimer, nuclear export; 2.5A {Homo sapiens} PDB: 2bzx_A | Back alignment and structure |
|---|
| >2fei_A CD2-associated protein; CMS SH3 domain, structural protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1sem_A SEM-5; SRC-homology 3 (SH3) domain, peptide-binding protein; 2.00A {Caenorhabditis elegans} SCOP: b.34.2.1 PDB: 2sem_A 3sem_A 1k76_A 1kfz_A | Back alignment and structure |
|---|
| >2djq_A SH3 domain containing ring finger 2; MUS musculus 0 DAY neonate head cDNA, riken FULL-length enriched library, clone:4831401O22, structural genomics; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1jo8_A ABP1P, actin binding protein; SH3 domain actin-binding-protein, structural protein; 1.30A {Saccharomyces cerevisiae} SCOP: b.34.2.1 PDB: 2k3b_A 2rpn_A | Back alignment and structure |
|---|
| >2drm_A Acanthamoeba myosin IB; SH3 domain, contractIle protein; 1.35A {Acanthamoeba} PDB: 2drk_A | Back alignment and structure |
|---|
| >2jte_A CD2-associated protein; SH3 domain, coiled coil, cytoplasm, phosphorylation, SH3-binding, signaling protein; NMR {Mus musculus} PDB: 2kro_A | Back alignment and structure |
|---|
| >2dl4_A Protein STAC; SH3 domain, STAC protein, SRC homology 3, cysteine-rich domain protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3ulr_B SRC substrate cortactin; SH3, protein-protein interaction, hydrolase, protein binding; 1.65A {Mus musculus} SCOP: b.34.2.0 PDB: 2d1x_A | Back alignment and structure |
|---|
| >2ak5_A RHO guanine nucleotide exchange factor 7; adaptor proteins, CIN85, PIX/COOL, protein-protein interaction, X-RAY, endocytosis; 1.85A {Rattus norvegicus} PDB: 1zsg_A | Back alignment and structure |
|---|
| >2dl8_A SLIT-ROBO RHO GTPase-activating protein 2; SH3 domain, formin-binding protein 2, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1oot_A Hypothetical 40.4 kDa protein in PES4-His2 intergenic region; SH3 domain, sturctural genomics, structural genomics; 1.39A {Saccharomyces cerevisiae} SCOP: b.34.2.1 PDB: 1ssh_A 2a08_A | Back alignment and structure |
|---|
| >2j6f_A CD2-associated protein; metal-binding, immune response, SH3, SH2 domain, SH3 zinc-finger, SH3- binding, UBL conjugation pathway; 1.7A {Homo sapiens} PDB: 2j6k_A 2j6o_A 2j7i_A 2krm_A | Back alignment and structure |
|---|
| >2i0n_A Class VII unconventional myosin; beta-sheet loop, structural protein; NMR {Dictyostelium discoideum} | Back alignment and structure |
|---|
| >2vwf_A Growth factor receptor-bound protein 2; polymorphism, phosphoprotein, golgi apparatus, alternative splicing, HOST-virus interaction, SH3C, signaling; 1.58A {Homo sapiens} PDB: 2w0z_A 1gcq_A 1gfc_A 1gfd_A 1io6_A 2vvk_A | Back alignment and structure |
|---|
| >1z9q_A Neutrophil cytosol factor 4; oxidoreductase activator; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3ngp_A Spectrin alpha chain, brain; beta barrel, structural protein; 1.08A {Gallus gallus} PDB: 1e7o_A 1e6g_A 1e6h_A 1uue_A 1h8k_A 2lj3_A 1aey_A 1m8m_A 1shg_A 1u06_A 2nuz_A 2cdt_A 1hd3_A 2f2v_A 2f2w_A 2jm8_A 2jm9_A 2jma_A 3m0r_A 3m0p_A ... | Back alignment and structure |
|---|
| >2fpe_A C-JUN-amino-terminal kinase interacting protein 1; SRC-homology 3 (SH3) domain, all beta structure, signaling protein; HET: P6G; 1.75A {Rattus norvegicus} PDB: 2fpd_A* | Back alignment and structure |
|---|
| >2ydl_A SH3 domain-containing kinase-binding protein 1; signaling protein; 2.05A {Homo sapiens} PDB: 2k6d_A | Back alignment and structure |
|---|
| >2ed0_A ABL interactor 2; coiled coil, cytoskeleton, nuclear protein, phosphorylation, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4glm_A Dynamin-binding protein; SH3 domain, DNMBP, structural genomics, structural genomics consortium, SGC, SRC homology 3 domains, cell junctions; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >1zlm_A Osteoclast stimulating factor 1; beta barrel, signaling protein; 1.07A {Homo sapiens} | Back alignment and structure |
|---|
| >2ekh_A SH3 and PX domain-containing protein 2A; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1uff_A Intersectin 2; beta barrel, SH3 domain, endocytosis, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >1wyx_A CRK-associated substrate; beta sheets, cell adhesion; 1.14A {Homo sapiens} | Back alignment and structure |
|---|
| >2dl7_A KIAA0769 protein; SH3 domain, FCHSD2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x2p_A Protein arginine N-methyltransferase 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2gnc_A SLIT-ROBO RHO GTPase-activating protein 1; beta barrel, signaling protein; 1.80A {Mus musculus} | Back alignment and structure |
|---|
| >1cka_A C-CRK N-terminal SH3 domain; complex (oncogene protein/peptide); 1.50A {Mus musculus} SCOP: b.34.2.1 PDB: 1ckb_A 1m3c_A 1m30_A 1m3b_A 1m3a_A | Back alignment and structure |
|---|
| >1x2k_A OSTF1, osteoclast stimulating factor 1; SH3 domain, human osteoclast stimulating factor 1, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3u23_A CD2-associated protein; structural genomics, structural genomics consortium, SGC, BE barrel, adaptor protein, protein binding; 1.11A {Homo sapiens} PDB: 2krn_A | Back alignment and structure |
|---|
| >3c0c_A Endophilin-A2; endocytosis, SH3, voltage-gated calcium channel, endosome, L binding, membrane, phosphoprotein, proto-oncogene, SH3 DOMA; 1.70A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2dlp_A KIAA1783 protein; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1tg0_A BBC1 protein, myosin tail region-interacting protein MTI1; yeast, SH3 domain, structural genomics, contractIle protein; 0.97A {Saccharomyces cerevisiae} PDB: 1zuk_A 1wdx_A | Back alignment and structure |
|---|
| >1b07_A Protein (proto-oncogene CRK (CRK)); SH3 domain, inhibitors, peptoids, protein-protein recognition, proline-rich motifs, signal transduction; 2.50A {Mus musculus} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >1ujy_A RHO guanine nucleotide exchange factor 6; structural genomics, SH3 domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >4e6r_A Cytoplasmic protein NCK2; SH3 domain, protein binding, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; HET: MLY; 2.20A {Homo sapiens} PDB: 2frw_A 2js0_A | Back alignment and structure |
|---|
| >2dbm_A SH3-containing GRB2-like protein 2; EC 2.3.1.-, SH3 domain protein 2A, endophilin 1, EEN-B1, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2knb_B 3iql_A | Back alignment and structure |
|---|
| >2yuo_A CIP85, RUN and TBC1 domain containing 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2fpf_A C-JUN-amino-terminal kinase interacting protein 1; scaffold protein 1, islet-brain-1, IB-1, mitogen-activated P kinase 8-interacting protein 1; 3.00A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2dl3_A Sorbin and SH3 domain-containing protein 1; ponsin, C-CBL-associated protein, CAP, SH3 domain protein 5 SH3P12, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dlm_A | Back alignment and structure |
|---|
| >3h0h_A Proto-oncogene tyrosine-protein kinase FYN; beta barrel, transferase; HET: PG4; 1.76A {Homo sapiens} SCOP: b.34.2.1 PDB: 3h0i_A 3h0f_A* | Back alignment and structure |
|---|
| >1x2q_A Signal transducing adapter molecule 2; SH3 domain, signal transducing adaptor molecule, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1y0m_A 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma 1; SH3 domain, hydrolase; 1.20A {Rattus norvegicus} PDB: 1ywp_A 1ywo_A | Back alignment and structure |
|---|
| >2dil_A Proline-serine-threonine phosphatase-interacting protein 1; SH3 domain, PEST phosphatase-interacting protein 1, CD2- binding protein 1; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2a28_A BZZ1 protein; SH3 domain, signaling protein; 1.07A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4esr_A Jouberin; AHI-1, AHI1, AHI-1 SH3 domain, SH3 domain, dynamin-2, protei binding, chronic myeloid leukemia; 1.53A {Homo sapiens} | Back alignment and structure |
|---|
| >2epd_A RHO GTPase-activating protein 4; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3thk_A Spectrin alpha chain, brain; SH3 domain, chimera, structural protein; 1.70A {Rattus norvegicus} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >2cre_A HEF-like protein; SH3 domain, SRC homology 3 domain, beta barrel, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ed1_A 130 kDa phosphatidylinositol 4,5-biphosphate- dependent ARF1 GTPase-activating protein...; GTPase activation, membrane, metal-binding, SH3 domain; NMR {Homo sapiens} PDB: 2rqt_A 2rqu_A | Back alignment and structure |
|---|
| >2ysq_A RHO guanine nucleotide exchange factor 9; SH3 domain, CDC42 guanine nucleotide exchange factor (GEF) 9, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1uj0_A Signal transducing adaptor molecule (SH3 domain and ITAM motif) 2; STAM, SH3, GRB2, GADS, PXXP, HRS, endocytosis, early endosome, signaling protein/signaling protein complex; 1.70A {Mus musculus} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >1uhc_A KIAA1010 protein; beta barrel, SH3, human cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >4f14_A Nebulette; SH3 domain, heart muscle, actin-binding protein-peptide COMP; 1.20A {Homo sapiens} PDB: 1ark_A 1neb_A 3i35_A | Back alignment and structure |
|---|
| >2l0a_A STAM-1, signal transducing adapter molecule 1; structural genomics, northeast structural genomics consortiu PSI-2, protein structure initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wi7_A SH3-domain kinase binding protein 1; beta barrel, SH3KBP1, RUK, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1u5s_A Cytoplasmic protein NCK2; protein-protein complex, beta barrel, beta sheet, zinc finger, metal binding protein; NMR {Homo sapiens} SCOP: b.34.2.1 PDB: 2fry_A | Back alignment and structure |
|---|
| >2kxd_A 11-MER peptide, SH3 domain of spectrin alpha CHAI; alpha spectrin SH3 domain, SPC-S19P20S circular permutant, S protein; NMR {Synthetic} | Back alignment and structure |
|---|
| >2yun_A Nostrin; nitric oxide synthase trafficker, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2v1q_A SLA1, cytoskeleton assembly control protein SLA1; structural genomics, phosphorylation, structural protein, yeast, SH3 domain; 1.2A {Saccharomyces cerevisiae} PDB: 1z9z_A | Back alignment and structure |
|---|
| >2k9g_A SH3 domain-containing kinase-binding protein 1; CIN85, adaptor protein, downregulation, CBL, apoptosis, junction, cytoplasmic vesicle, cytoskeleton; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ega_A SH3 and PX domain-containing protein 2A; SH3 domain, KIAA0418 protein, SH3MD1, SH3 multiple domains 1, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2lcs_A NAP1-binding protein 2; adaptor, transferase, signaling protein; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1gl5_A Tyrosine-protein kinase TEC; transferase, ATP-binding, SH3 domain, phosphorylation; NMR {Mus musculus} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >1zuy_A Myosin-5 isoform; SH3 domain, contractIle protein; 1.39A {Saccharomyces cerevisiae} PDB: 1yp5_A | Back alignment and structure |
|---|
| >1x6b_A RHO guanine exchange factor (GEF) 16; SH3 domain, neuroblastoma, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x43_A Endophilin B1, SH3 domain GRB2-like protein B1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2jt4_A Cytoskeleton assembly control protein SLA1; endocytosis, SH3, actin-binding, cytoplasm, cytoskeleton, phosphorylation, SH3 domain, DNA damage, DNA repair, nucleus; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2oaw_A Spectrin alpha chain, brain; SH3 domain, chimera, structural protein; 1.90A {Gallus gallus} PDB: 2rot_A 2rmo_A 2kr3_A | Back alignment and structure |
|---|
| >1ue9_A Intersectin 2; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, endocytosis/exocytosis complex; NMR {Homo sapiens} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >2da9_A SH3-domain kinase binding protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1neg_A Spectrin alpha chain, brain; SH3-domain fold, five antiparallel beta sheets, structural protein; 2.30A {Gallus gallus} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >2dnu_A RUH-061, SH3 multiple domains 1; RSGI, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3eg3_A Proto-oncogene tyrosine-protein kinase ABL1; beta, ATP-binding, cell adhesion, cytoskeleton, LIPO magnesium, manganese, metal-binding, myristate; 1.40A {Homo sapiens} PDB: 3egu_A 3eg0_A 3eg2_A 3eg1_A 1abo_A 1abq_A 1ju5_C* 2o88_A 1bbz_A 1awo_A | Back alignment and structure |
|---|
| >1ruw_A Myosin-3 isoform, MYO3; SH3 domain, yeast, high-throughput, structural genomics, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2btt_A 1va7_A | Back alignment and structure |
|---|
| >2d8h_A SH3YL1 protein; SH3 domain, hypothetical protein SH3YL1, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1ugv_A KIAA0621, olygophrenin-1 like protein; beta barrel, GRAF protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >1uhf_A Intersectin 2; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, signaling protein; NMR {Homo sapiens} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >2dm1_A Protein VAV-2; RHO family guanine nucleotide exchange factor, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ke9_A Caskin-2; SH3 domain, ANK repeat, cytoplasm, phosphoprotein, protein binding; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2jxb_A T-cell surface glycoprotein CD3 epsilon chain, cytoplasmic protein NCK2; T-cell receptor, SH3 domain, immunology, SH2 domain; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1csk_A C-SRC SH3 domain; phosphotransferase; 2.50A {Homo sapiens} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >3cqt_A P59-FYN, proto-oncogene tyrosine-protein kinase FYN; beta barrel, ATP-binding, developmental protein, lipoprotein, manganese, metal-binding; 1.60A {Gallus gallus} PDB: 2l2p_A | Back alignment and structure |
|---|
| >2cub_A Cytoplasmic protein NCK1; SH3 domain, NCK1 adaptor, tyrosine kinase, signal transduction, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2iim_A Proto-oncogene tyrosine-protein kinase LCK; beta-barrels, signaling protein; HET: PG4; 1.00A {Homo sapiens} SCOP: b.34.2.1 PDB: 1h92_A 1kik_A | Back alignment and structure |
|---|
| >2cuc_A SH3 domain containing ring finger 2; structural genomics, ring finger 2 containing protein, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2ege_A Uncharacterized protein KIAA1666; SH3 domain, KIAA1666 protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1aww_A ATK, AMGX1, BPK, bruton'S tyrosine kinase; X-linked agammaglobulinemia, XLA, BTK, SH3 domain, transferase; NMR {Homo sapiens} SCOP: b.34.2.1 PDB: 1awx_A 1qly_A | Back alignment and structure |
|---|
| >1j3t_A Intersectin 2; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, endocytosis/exocytosis complex; NMR {Homo sapiens} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >2j05_A RAS GTPase-activating protein 1; GTPase activation, SH3 domain, SH2 domain, SRC homology 3, RAS signaling pathway, proto- oncogene, phosphorylation; 1.5A {Homo sapiens} PDB: 2j06_A | Back alignment and structure |
|---|
| >1jqq_A PEX13P, peroxisomal membrane protein PAS20, PAS20P, roxin-13; compact beta-barrel of five anti-parrallel beta-strands; 2.65A {Saccharomyces cerevisiae} SCOP: b.34.2.1 PDB: 1n5z_A | Back alignment and structure |
|---|
| >2ecz_A Sorbin and SH3 domain-containing protein 1; glycoprotein, membrane, nuclear protein, phosphorylation, polymorphism, transport, structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2o9s_A Ponsin; SH3 domain, signaling protein; 0.83A {Homo sapiens} PDB: 2o31_A 2o9v_A 2o2w_A | Back alignment and structure |
|---|
| >3rnj_A Brain-specific angiogenesis inhibitor 1-associate 2; structural genomics, structural genomics consortium, SGC, BE barrel; HET: EDT; 1.50A {Homo sapiens} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >2eqi_A Phospholipase C, gamma 2; SH3 domain, PLCG2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2x3w_D Syndapin I, protein kinase C and casein kinase substrate in N protein 1; endocytosis, N-WAsp, dynamin, pacsin I, transferase; 2.64A {Mus musculus} PDB: 2x3x_D | Back alignment and structure |
|---|
| >1spk_A RSGI RUH-010, riken cDNA 1300006M19; structural genomics, SH3 domain, five-stranded barrel, mouse cDNA; NMR {Mus musculus} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >1yn8_A NBP2, NAP1-binding protein 2; SH3 domain, unknown function; 1.70A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2o2o_A SH3-domain kinase-binding protein 1; CIN85, protein binding; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yup_A Vinexin; sorbin and SH3 domain-containing protein 3, SH3-containing adapter molecule 1, SCAM-1, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2b86_A Cytoplasmic protein NCK2; NCK SH3 domain, signaling protein; NMR {Homo sapiens} PDB: 2js2_A | Back alignment and structure |
|---|
| >1awj_A ITK; transferase, regulatory intramolecular complex, kinase; NMR {Mus musculus} SCOP: b.34.2.1 PDB: 2rn8_A 2rna_A 2k79_A 2k7a_A | Back alignment and structure |
|---|
| >2k2m_A EPS8-like protein 1; alternative splicing, coiled coil, cytoplasm, SH3 domain, signaling protein; NMR {Homo sapiens} PDB: 2rol_A | Back alignment and structure |
|---|
| >1nm7_A Peroxisomal membrane protein PAS20; yeast, PEX5P, PEX14P, PEX13P, import machine, SH3 domain, protein transport; NMR {Saccharomyces cerevisiae} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >1wie_A RIM binding protein 2; beta barrel, KIAA0318 protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >2kxc_A Brain-specific angiogenesis inhibitor 1-associate 2-like protein 1; IRTKS-SH3, espfu, complex structure, protein binding; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ct3_A Vinexin; SH3 domian, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2egc_A SH3 and PX domain-containing protein 2A; SH3 domain, KIAA0418 protein, SH3MD1, SH3 multiple domains 1, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1zuu_A BZZ1 protein; SH3 domain, unknown function; 0.97A {Saccharomyces cerevisiae} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >2oi3_A Tyrosine-protein kinase HCK; human HCK, SH3, SRC-type tyrosine kinase, transferase; NMR {Homo sapiens} PDB: 2oj2_A 4hck_A 5hck_A | Back alignment and structure |
|---|
| >2rqr_A CED-12 homolog, engulfment and cell motility protein 1, linker, D of cytokinesis protein 2; KIAA0209, KIAA0281, apoptosis, membrane, phagocytosis; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wx6_A Cytoplasmic protein NCK2; SH3 domain, structural genomics, signal transduction, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2gqi_A RAS GTPase-activating protein 1; GAP, RAS P21 protein activator, P120GAP, rasgap, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2v1r_A Peroxisomal membrane protein PAS20; protein transport, translocation, transmembrane, peptide COM structural genomics, peroxisome; 2.1A {Saccharomyces cerevisiae} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >2csq_A RIM-BP2, RIM binding protein 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2rf0_A Mitogen-activated protein kinase kinase kinase 10; MAP3K10, MLK2, SH3 domain, TKL kinase, MKN28, structural GEN structural genomics consortium, SGC; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1s1n_A Nephrocystin 1; beta barrel, cell adhesion; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4ag1_C Fynomer; hydrolase-de novo protein complex, inhibitor, serine proteas; 1.40A {Synthetic construct} PDB: 4afz_C 4ag2_C* 4afq_C* 4afs_C 4afu_C 1azg_B 1nyf_A 1nyg_A 1a0n_B 3ua7_A 3ua6_A 1fyn_A 1m27_C* 1shf_A 1zbj_A 1efn_A 1avz_C 1nlo_C* 1nlp_C* 1qwe_A ... | Back alignment and structure |
|---|
| >2dl5_A KIAA0769 protein; SH3 domain, FCHSD2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2jw4_A Cytoplasmic protein NCK1; SH3 domain, phosphorylation, SH2 domain, signaling protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2d8j_A FYN-related kinase; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1wxb_A Epidermal growth factor receptor pathway substrate 8-like protein; SH3, EPS8, EPS8L2, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kgt_A Tyrosine-protein kinase 6; SH3 domain, SRC kinase, PTK6, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wxt_A Hypothetical protein FLJ21522; SH3 domain, EPS8-related protein 3, protein-protein interaction, structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1gbq_A GRB2; complex (signal transduction/peptide), SH3 domain; NMR {Mus musculus} SCOP: b.34.2.1 PDB: 1gbr_A 2gbq_A 3gbq_A 4gbq_A | Back alignment and structure |
|---|
| >1tuc_A Alpha-spectrin; capping protein, calcium-binding, duplication, repeat, SH3 domain, cytoskeleton; 2.02A {Gallus gallus} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >2csi_A RIM-BP2, RIM binding protein 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1i07_A Epidermal growth factor receptor kinase substrate EPS8; hormone/growth factor; 1.80A {Mus musculus} SCOP: b.34.2.1 PDB: 1aoj_A 1i0c_A | Back alignment and structure |
|---|
| >1k1z_A VAV; SH3, proto-oncogene, signaling protein; NMR {Mus musculus} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >1i1j_A Melanoma derived growth regulatory protein; SH3 subdomain, hormone/growth factor complex; 1.39A {Homo sapiens} SCOP: b.34.2.1 PDB: 1k0x_A 1hjd_A | Back alignment and structure |
|---|
| >2yuq_A Tyrosine-protein kinase ITK/TSK; T-cell-specific kinase, tyrosine-protein kinase LYK, kinase EMT, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cud_A SRC-like-adapter; SH3 domain, negative mitogenesis regulator, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kbt_A Chimera of proto-oncogene VAV, linker, immunoglobulin G-binding protein G; sortase, protein ligation, intein, inset, solubility enhancement; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1gcq_C VAV proto-oncogene; SH3 domain, protein-protein complex, GRB2,VAV, signaling protein/signaling protein complex; 1.68A {Mus musculus} SCOP: b.34.2.1 PDB: 1gcp_A | Back alignment and structure |
|---|
| >2vkn_A Protein SSU81; membrane, SH3 domain, transmembrane, membrane; 2.05A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1x6g_A Megakaryocyte-associated tyrosine-protein kinase; MATK, CTK, HYL, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2enm_A Sorting nexin-9; SH3-like barrel, protein transport, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2ct4_A CDC42-interacting protein 4; thyroid receptor interacting protein 10, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1udl_A Intersectin 2, KIAA1256; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >1hsq_A Phospholipase C-gamma (SH3 domain); phosphoric diester hydrolase; NMR {Homo sapiens} SCOP: b.34.2.1 PDB: 2hsp_A | Back alignment and structure |
|---|
| >2e5k_A Suppressor of T-cell receptor signaling 1; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yt6_A Adult MALE urinary bladder cDNA, riken FULL- length enriched library, clone:9530076O17...; SH3_1 domain; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1wxu_A Peroxisomal biogenesis factor 13; SH3 domain, PEX13, protein-protein interaction, structural genomics; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2rqv_A BUD emergence protein 1; BEM1P, SH3, CDC42P, cytoplasm, cytoskeleton, SH3 domain, SIG protein; NMR {Saccharomyces cerevisiae} PDB: 2rqw_A | Back alignment and structure |
|---|
| >2m0y_A Dedicator of cytokinesis protein 1; apoptosis; NMR {Mus musculus} | Back alignment and structure |
|---|
| >3reb_B Tyrosine-protein kinase HCK; HIV-1 NEF, SH3 domain binding, signaling, HCK SH3 domain, PR binding; 3.45A {Homo sapiens} | Back alignment and structure |
|---|
| >1bb9_A Amphiphysin 2; transferase, SH3 domain; 2.20A {Rattus norvegicus} SCOP: b.34.2.1 PDB: 1muz_A 1mv0_B | Back alignment and structure |
|---|
| >2jmc_A Spectrin alpha chain, brain and P41 peptide chimera; SPC-SH3, signaling protein; NMR {Gallus gallus} | Back alignment and structure |
|---|
| >3o5z_A Phosphatidylinositol 3-kinase regulatory subunit; SRC homology 3 domain, protein binding; 2.01A {Homo sapiens} SCOP: b.34.2.0 PDB: 2kt1_A | Back alignment and structure |
|---|
| >3i5r_A Phosphatidylinositol 3-kinase regulatory subunit alpha; SH3 domain, peptide complex, alternative splicing, disease mutation, HOST-virus interaction, phosphoprotein, polymorphism; 1.70A {Homo sapiens} SCOP: b.34.2.1 PDB: 3i5s_A 1pht_A 1pnj_A 2pni_A 1pks_A 1pkt_A | Back alignment and structure |
|---|
| >1mv3_A MYC box dependent interacting protein 1; tumor suppressor, endocytosis/exocytosis complex; NMR {Homo sapiens} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >2kym_A BUD emergence protein 1; SH3 domain, BEM1P, SH3-CI, STE20P PRR, CDC42P-interacting, S signaling protein; NMR {Lodderomyces elongisporus} | Back alignment and structure |
|---|
| >3qwx_X Cell death abnormality protein 2; cell engulfment, signaling protein; 2.01A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >1ng2_A Neutrophil cytosolic factor 1; P47PHOX, autoinhibited, SH3 domain, NADPH oxidase, oxidoredu activator; 1.70A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 PDB: 1uec_A 1ov3_A 1wlp_B | Back alignment and structure |
|---|
| >1gri_A Growth factor bound protein 2; SH2, SH3, signal transduction adaptor; 3.10A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 d.93.1.1 PDB: 1aze_A 2a37_A 2azv_A 2a36_A 2azs_A | Back alignment and structure |
|---|
| >2eyz_A V-CRK sarcoma virus CT10 oncogene homolog isoform A; SH2, SH3, signaling protein; NMR {Homo sapiens} PDB: 2l3s_A 2l3p_A 2l3q_A 2ggr_A | Back alignment and structure |
|---|
| >2dvj_A V-CRK sarcoma virus CT10 oncogene homolog, isoform A; SH3, SH2, signal transduction, adapter molecule, signaling protein; HET: PTR; NMR {Homo sapiens} PDB: 2eyy_A 2eyv_A 2eyw_A | Back alignment and structure |
|---|
| >1ng2_A Neutrophil cytosolic factor 1; P47PHOX, autoinhibited, SH3 domain, NADPH oxidase, oxidoredu activator; 1.70A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 PDB: 1uec_A 1ov3_A 1wlp_B | Back alignment and structure |
|---|
| >4d8k_A Tyrosine-protein kinase LCK; protein kinases, SH2 domain, SH3 domain, structural genomics center for structural genomics, JCSG; 2.36A {Homo sapiens} PDB: 1lck_A* 1x27_A* | Back alignment and structure |
|---|
| >2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 | Back alignment and structure |
|---|
| >2dyb_A Neutrophil cytosol factor 4; P40(PHOX), NADPH oxidase, oxidoreductase; HET: CAF; 3.15A {Homo sapiens} | Back alignment and structure |
|---|
| >2pz1_A RHO guanine nucleotide exchange factor 4; helical bundle, beta barrel, beta sandwich, signaling protei; 2.25A {Homo sapiens} PDB: 2dx1_A 3nmz_D 3nmx_D | Back alignment and structure |
|---|
| >2lqn_A CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT10 oncogene homolog (avian)- signaling protein; NMR {Homo sapiens} PDB: 2lqw_A* | Back alignment and structure |
|---|
| >3qwy_A Cell death abnormality protein 2; cell engulfment, signaling protein; 2.52A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >2eyz_A V-CRK sarcoma virus CT10 oncogene homolog isoform A; SH2, SH3, signaling protein; NMR {Homo sapiens} PDB: 2l3s_A 2l3p_A 2l3q_A 2ggr_A | Back alignment and structure |
|---|
| >3a98_A DOCK2, dedicator of cytokinesis protein 2; protein-protein complex, DOCK2, ELMO1, SH3 domain, PH domain bundle, proline-rich sequence, cytoskeleton; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3qwy_A Cell death abnormality protein 2; cell engulfment, signaling protein; 2.52A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >2de0_X Alpha-(1,6)-fucosyltransferase; FUT8, glycosyltransferase, N-glycan, COR SH3 domain; 2.61A {Homo sapiens} | Back alignment and structure |
|---|
| >2lqn_A CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT10 oncogene homolog (avian)- signaling protein; NMR {Homo sapiens} PDB: 2lqw_A* | Back alignment and structure |
|---|
| >1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A | Back alignment and structure |
|---|
| >1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A | Back alignment and structure |
|---|
| >1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B | Back alignment and structure |
|---|
| >3haj_A Human pacsin2 F-BAR; pacsin,syndapin,FAP52,F-BAR, alternative splicing, coiled coil, cytoplasmic vesicle, endocytosis, phosphoprotein, polymorphism; 2.78A {Homo sapiens} | Back alignment and structure |
|---|
| >1ri9_A FYN-binding protein; SH3-like, helically extended, signaling protein; NMR {Homo sapiens} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >1u3o_A Huntingtin-associated protein-interacting protein; SH3, CIS-proline,, signaling protein; NMR {Rattus norvegicus} | Back alignment and structure |
|---|
| >1g2b_A Spectrin alpha chain; capping protein, calcium-binding, duplication, repeat, SH3 domain, cytoskeleton, metal binding protein; 1.12A {Gallus gallus} SCOP: b.34.2.1 PDB: 1tud_A | Back alignment and structure |
|---|
| >1kjw_A Postsynaptic density protein 95; protein-protein interaction, scaffold, neuropeptide; 1.80A {Rattus norvegicus} SCOP: b.34.2.1 c.37.1.1 PDB: 1jxm_A* 1jxo_A | Back alignment and structure |
|---|
| >3pvl_A Myosin VIIA isoform 1; protein complex, novel folding, protein cargo binding, cargo proteins, motor protein-protein transport complex; 2.80A {Mus musculus} | Back alignment and structure |
|---|
| >1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B | Back alignment and structure |
|---|
| >2gtj_A FYN-binding protein; SH3, redox, signaling protein; NMR {Homo sapiens} PDB: 2gto_A | Back alignment and structure |
|---|
| >3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A | Back alignment and structure |
|---|
| >4dey_A Voltage-dependent L-type calcium channel subunit; maguk, voltage dependent calcium channel, transport protein; 1.95A {Oryctolagus cuniculus} PDB: 4dex_A 1t3l_A 1t3s_A 1vyv_A 1vyu_A 1vyt_A 1t0h_B 1t0j_B 1t0h_A 1t0j_A | Back alignment and structure |
|---|
| >1ug1_A KIAA1010 protein; structural genomics, SH3 domain, hypothetical protein BAA76854.1, riken structural genomics/proteomics initiative RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3tsz_A Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffolding, JAM, tight junction, cell adhesio; 2.50A {Homo sapiens} PDB: 3tsw_A 3lh5_A | Back alignment and structure |
|---|
| >3shw_A Tight junction protein ZO-1; PDZ-SH3-GUK supramodule, cell adhesion; 2.90A {Homo sapiens} | Back alignment and structure |
|---|
| >2dyb_A Neutrophil cytosol factor 4; P40(PHOX), NADPH oxidase, oxidoreductase; HET: CAF; 3.15A {Homo sapiens} | Back alignment and structure |
|---|
| >3pe0_A Plectin; cytoskeleton, plakin, spectrin repeat, SH3, structural prote intermediate filament, crosslinking; 2.95A {Homo sapiens} | Back alignment and structure |
|---|
| >3kfv_A Tight junction protein ZO-3; structural genomics consortium, SGC, cell junction, cell membrane, membrane, SH3 domain; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3tvt_A Disks large 1 tumor suppressor protein; DLG, SRC-homology-3, guanylate kinase, phosphorylation-depen cell membrane; 1.60A {Drosophila melanogaster} PDB: 3uat_A* | Back alignment and structure |
|---|
| >3r6n_A Desmoplakin; spectrin repeat, SH3 domain, cell adhesion, desmosome; 2.95A {Homo sapiens} | Back alignment and structure |
|---|
| >2krs_A Probable enterotoxin; all beta, SH3, ENTD, CPF_0587, CPE0606, structural genomics, PSI-2, protein structure initiative; NMR {Clostridium perfringens} | Back alignment and structure |
|---|
| >2kt8_A Probable surface protein; SH3 family, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; NMR {Clostridium perfringens} PDB: 2kyb_A | Back alignment and structure |
|---|
| >2kq8_A Cell WALL hydrolase; GFT protein structure, NESG, PSI, SH3 domain, structural genomics, protein structure initiative; NMR {Bacillus thuringiensis serovarkonkukian} | Back alignment and structure |
|---|
| >3b5n_C Protein transport protein SEC9; snare complex, syntaxin, synaptobrevin, SNAP-25, SSO1P, SNC1P, SEC9P, SSO1, SNC1, coiled coil; 1.60A {Saccharomyces cerevisiae} SCOP: h.1.15.1 | Back alignment and structure |
|---|
| >3h8z_A FragIle X mental retardation syndrome-related Pro; tudor domains, FXR2, structura genomics, structural genomics consortium, SGC; 1.92A {Homo sapiens} PDB: 3o8v_A 3kuf_A 2bkd_N* | Back alignment and structure |
|---|
| >1l4a_C S-SNAP25 fusion protein; snare, snare complex, membrane fusion, neurotransmission, endocytosis/exocytosis complex; 2.95A {Loligo pealei} SCOP: h.1.15.1 | Back alignment and structure |
|---|
| >2d4y_A HAP1, flagellar HOOK-associated protein 1; multi-domain protein, alpha-helical bundle, complex all- beta folds, structural protein; 2.10A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >3npf_A Putative dipeptidyl-peptidase VI; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: CSA GOL; 1.72A {Bacteroides ovatus} PDB: 3pvq_A | Back alignment and structure |
|---|
| >1n7s_C SNAP-25A; neuronal snare protein complex, four helix bundle, transport protein; 1.45A {Rattus norvegicus} SCOP: h.1.15.1 PDB: 1sfc_C 1urq_C 3hd7_C* 3hd9_C 3ipd_C 3rk2_C 3rk3_C 3rl0_C 1kil_C 1jth_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 420 | ||||
| d1utia_ | 57 | b.34.2.1 (A:) Grb2-related adaptor protein 2 (Mona | 4e-17 | |
| d1gcqa_ | 56 | b.34.2.1 (A:) Growth factor receptor-bound protein | 8e-17 | |
| d1k4us_ | 62 | b.34.2.1 (S:) p67phox {Human (Homo sapiens) [TaxId | 1e-16 | |
| d1sema_ | 58 | b.34.2.1 (A:) Growth factor receptor-bound protein | 3e-16 | |
| d1u06a1 | 55 | b.34.2.1 (A:7-61) alpha-Spectrin, SH3 domain {Chic | 1e-15 | |
| d1uj0a_ | 58 | b.34.2.1 (A:) Signal transducing adaptor molecule | 2e-15 | |
| d1ckaa_ | 57 | b.34.2.1 (A:) C-Crk, N-terminal SH3 domain {Mouse | 1e-14 | |
| d1ujya_ | 76 | b.34.2.1 (A:) Rac/CDC42 GEF 6 {Human (Homo sapiens | 8e-14 | |
| d1arka_ | 60 | b.34.2.1 (A:) SH3 domain from nebulin {Human (Homo | 9e-14 | |
| d1uhfa_ | 69 | b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Hom | 1e-13 | |
| d1fmka1 | 64 | b.34.2.1 (A:82-145) c-src protein tyrosine kinase | 1e-13 | |
| d1efna_ | 57 | b.34.2.1 (A:) Fyn proto-oncogene tyrosine kinase, | 1e-13 | |
| d1awwa_ | 67 | b.34.2.1 (A:) Bruton's tyrosine kinase {Human (Hom | 2e-13 | |
| d1gria1 | 56 | b.34.2.1 (A:1-56) Growth factor receptor-bound pro | 3e-13 | |
| d2hspa_ | 71 | b.34.2.1 (A:) Phospholipase C, SH3 domain {Human ( | 5e-13 | |
| d1qcfa1 | 65 | b.34.2.1 (A:80-145) Hemapoetic cell kinase Hck {Hu | 1e-12 | |
| d1udla_ | 98 | b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Hom | 1e-12 | |
| d1jo8a_ | 58 | b.34.2.1 (A:) Actin binding protein ABP1 {Baker's | 1e-12 | |
| d1opka1 | 57 | b.34.2.1 (A:83-139) Abl tyrosine kinase, SH3 domai | 2e-12 | |
| d1gl5a_ | 67 | b.34.2.1 (A:) tyrosine kinase tec {Mouse (Mus musc | 2e-12 | |
| d1j3ta_ | 74 | b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Hom | 3e-12 | |
| d1oota_ | 58 | b.34.2.1 (A:) Hypothetical protein YFR024c {Baker' | 4e-12 | |
| d2rn8a1 | 53 | b.34.2.1 (A:176-228) Bruton's tyrosine kinase {Mus | 7e-12 | |
| d1ycsb2 | 63 | b.34.2.1 (B:457-519) 53BP2 {Human (Homo sapiens) [ | 1e-11 | |
| d1wlpb1 | 53 | b.34.2.1 (B:229-281) p47pox (neutrophil cytosolic | 2e-11 | |
| d1ng2a2 | 118 | b.34.2.1 (A:215-332) p47pox (neutrophil cytosolic | 2e-11 | |
| d2iima1 | 62 | b.34.2.1 (A:58-119) p56-lck tyrosine kinase, SH3 d | 2e-11 | |
| d1ng2a1 | 58 | b.34.2.1 (A:157-214) p47pox (neutrophil cytosolic | 6e-11 | |
| d1uhca_ | 79 | b.34.2.1 (A:) Hypothetical protein Baa76854.1 (KIA | 9e-11 | |
| d1gcqc_ | 69 | b.34.2.1 (C:) Vav N-terminal SH3 domain {Mouse (Mu | 9e-11 | |
| d2v1ra1 | 67 | b.34.2.1 (A:10-76) Peroxisomal membrane protein Pe | 1e-10 | |
| d1ue9a_ | 80 | b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Hom | 1e-10 | |
| d1u5sa1 | 71 | b.34.2.1 (A:1-71) Nck-2 {Human (Homo sapiens) [Tax | 2e-10 | |
| d1ugva_ | 72 | b.34.2.1 (A:) Olygophrenin-1 like protein (KIAA062 | 3e-10 | |
| d1i07a_ | 59 | b.34.2.1 (A:) EPS8 SH3 domain {Mouse (Mus musculus | 4e-10 | |
| d1bb9a_ | 83 | b.34.2.1 (A:) Amphiphysin 2 {Rat (Rattus norvegicu | 5e-10 | |
| d1spka_ | 72 | b.34.2.1 (A:) BAI1-associated protein 2-like 1 (RI | 1e-09 | |
| d1k9aa1 | 71 | b.34.2.1 (A:6-76) Carboxyl-terminal src kinase (cs | 3e-09 | |
| d1zuua1 | 56 | b.34.2.1 (A:2-57) BZZ1 {Baker's yeast (Saccharomyc | 6e-09 | |
| d1uffa_ | 93 | b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Hom | 1e-08 | |
| d1wfwa_ | 74 | b.34.2.1 (A:) Kalirin-9a {Mouse (Mus musculus) [Ta | 4e-08 | |
| d1wiea_ | 96 | b.34.2.1 (A:) RIM binding protein 2, RIMBP2 {Human | 1e-07 | |
| d1kjwa1 | 96 | b.34.2.1 (A:430-525) Psd-95 {Rat (Rattus norvegicu | 2e-06 | |
| d1phta_ | 83 | b.34.2.1 (A:) Phosphatidylinositol 3-kinase (p85-a | 5e-06 | |
| d1ug1a_ | 92 | b.34.2.1 (A:) Hypothetical protein Baa76854.1 (KIA | 2e-05 | |
| d1t0ha_ | 96 | b.34.2.1 (A:) SH3-like domain of the L-type calciu | 4e-05 | |
| d1i1ja_ | 106 | b.34.2.1 (A:) Melanoma inhibitory activity protein | 5e-05 |
| >d1utia_ b.34.2.1 (A:) Grb2-related adaptor protein 2 (Mona/Gads) {Mouse (Mus musculus) [TaxId: 10090]} Length = 57 | Back information, alignment and structure |
|---|
class: All beta proteins fold: SH3-like barrel superfamily: SH3-domain family: SH3-domain domain: Grb2-related adaptor protein 2 (Mona/Gads) species: Mouse (Mus musculus) [TaxId: 10090]
Score = 72.8 bits (179), Expect = 4e-17
Identities = 19/44 (43%), Positives = 26/44 (59%)
Query: 377 EKDELSFQESAVIYVLKKNDDGWWEGVMDGITGLFPGNYVEPCV 420
E+DEL F+ V+ VL ++ WW G + GLFP NYV P +
Sbjct: 14 EEDELGFRSGEVVEVLDSSNPSWWTGRLHNKLGLFPANYVAPMM 57
|
| >d1gcqa_ b.34.2.1 (A:) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Length = 56 | Back information, alignment and structure |
|---|
| >d1k4us_ b.34.2.1 (S:) p67phox {Human (Homo sapiens) [TaxId: 9606]} Length = 62 | Back information, alignment and structure |
|---|
| >d1sema_ b.34.2.1 (A:) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Caenorhabditis elegans, SEM-5 [TaxId: 6239]} Length = 58 | Back information, alignment and structure |
|---|
| >d1u06a1 b.34.2.1 (A:7-61) alpha-Spectrin, SH3 domain {Chicken (Gallus gallus) [TaxId: 9031]} Length = 55 | Back information, alignment and structure |
|---|
| >d1uj0a_ b.34.2.1 (A:) Signal transducing adaptor molecule Stam2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 58 | Back information, alignment and structure |
|---|
| >d1ckaa_ b.34.2.1 (A:) C-Crk, N-terminal SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 57 | Back information, alignment and structure |
|---|
| >d1ujya_ b.34.2.1 (A:) Rac/CDC42 GEF 6 {Human (Homo sapiens) [TaxId: 9606]} Length = 76 | Back information, alignment and structure |
|---|
| >d1arka_ b.34.2.1 (A:) SH3 domain from nebulin {Human (Homo sapiens) [TaxId: 9606]} Length = 60 | Back information, alignment and structure |
|---|
| >d1uhfa_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Length = 69 | Back information, alignment and structure |
|---|
| >d1fmka1 b.34.2.1 (A:82-145) c-src protein tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 64 | Back information, alignment and structure |
|---|
| >d1efna_ b.34.2.1 (A:) Fyn proto-oncogene tyrosine kinase, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Length = 57 | Back information, alignment and structure |
|---|
| >d1awwa_ b.34.2.1 (A:) Bruton's tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 67 | Back information, alignment and structure |
|---|
| >d1gria1 b.34.2.1 (A:1-56) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Length = 56 | Back information, alignment and structure |
|---|
| >d2hspa_ b.34.2.1 (A:) Phospholipase C, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Length = 71 | Back information, alignment and structure |
|---|
| >d1qcfa1 b.34.2.1 (A:80-145) Hemapoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]} Length = 65 | Back information, alignment and structure |
|---|
| >d1udla_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Length = 98 | Back information, alignment and structure |
|---|
| >d1jo8a_ b.34.2.1 (A:) Actin binding protein ABP1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 58 | Back information, alignment and structure |
|---|
| >d1opka1 b.34.2.1 (A:83-139) Abl tyrosine kinase, SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 57 | Back information, alignment and structure |
|---|
| >d1gl5a_ b.34.2.1 (A:) tyrosine kinase tec {Mouse (Mus musculus) [TaxId: 10090]} Length = 67 | Back information, alignment and structure |
|---|
| >d1j3ta_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Length = 74 | Back information, alignment and structure |
|---|
| >d1oota_ b.34.2.1 (A:) Hypothetical protein YFR024c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 58 | Back information, alignment and structure |
|---|
| >d2rn8a1 b.34.2.1 (A:176-228) Bruton's tyrosine kinase {Mus musculus [TaxId: 10090]} Length = 53 | Back information, alignment and structure |
|---|
| >d1ycsb2 b.34.2.1 (B:457-519) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 63 | Back information, alignment and structure |
|---|
| >d1wlpb1 b.34.2.1 (B:229-281) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} Length = 53 | Back information, alignment and structure |
|---|
| >d1ng2a2 b.34.2.1 (A:215-332) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} Length = 118 | Back information, alignment and structure |
|---|
| >d2iima1 b.34.2.1 (A:58-119) p56-lck tyrosine kinase, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Length = 62 | Back information, alignment and structure |
|---|
| >d1ng2a1 b.34.2.1 (A:157-214) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} Length = 58 | Back information, alignment and structure |
|---|
| >d1uhca_ b.34.2.1 (A:) Hypothetical protein Baa76854.1 (KIAA1010) {Human (Homo sapiens) [TaxId: 9606]} Length = 79 | Back information, alignment and structure |
|---|
| >d1gcqc_ b.34.2.1 (C:) Vav N-terminal SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 69 | Back information, alignment and structure |
|---|
| >d2v1ra1 b.34.2.1 (A:10-76) Peroxisomal membrane protein Pex13p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 67 | Back information, alignment and structure |
|---|
| >d1ue9a_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Length = 80 | Back information, alignment and structure |
|---|
| >d1u5sa1 b.34.2.1 (A:1-71) Nck-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 71 | Back information, alignment and structure |
|---|
| >d1ugva_ b.34.2.1 (A:) Olygophrenin-1 like protein (KIAA0621) {Human (Homo sapiens) [TaxId: 9606]} Length = 72 | Back information, alignment and structure |
|---|
| >d1i07a_ b.34.2.1 (A:) EPS8 SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 59 | Back information, alignment and structure |
|---|
| >d1bb9a_ b.34.2.1 (A:) Amphiphysin 2 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 83 | Back information, alignment and structure |
|---|
| >d1spka_ b.34.2.1 (A:) BAI1-associated protein 2-like 1 (RIKEN cDNA 1300006m19) {Mouse (Mus musculus) [TaxId: 10090]} Length = 72 | Back information, alignment and structure |
|---|
| >d1k9aa1 b.34.2.1 (A:6-76) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Length = 71 | Back information, alignment and structure |
|---|
| >d1zuua1 b.34.2.1 (A:2-57) BZZ1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 56 | Back information, alignment and structure |
|---|
| >d1uffa_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Length = 93 | Back information, alignment and structure |
|---|
| >d1wfwa_ b.34.2.1 (A:) Kalirin-9a {Mouse (Mus musculus) [TaxId: 10090]} Length = 74 | Back information, alignment and structure |
|---|
| >d1wiea_ b.34.2.1 (A:) RIM binding protein 2, RIMBP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 96 | Back information, alignment and structure |
|---|
| >d1kjwa1 b.34.2.1 (A:430-525) Psd-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 96 | Back information, alignment and structure |
|---|
| >d1phta_ b.34.2.1 (A:) Phosphatidylinositol 3-kinase (p85-alpha subunit, pi3k), SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Length = 83 | Back information, alignment and structure |
|---|
| >d1ug1a_ b.34.2.1 (A:) Hypothetical protein Baa76854.1 (KIAA1010) {Human (Homo sapiens) [TaxId: 9606]} Length = 92 | Back information, alignment and structure |
|---|
| >d1t0ha_ b.34.2.1 (A:) SH3-like domain of the L-type calcium channel {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 96 | Back information, alignment and structure |
|---|
| >d1i1ja_ b.34.2.1 (A:) Melanoma inhibitory activity protein {Human (Homo sapiens) [TaxId: 9606]} Length = 106 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 420 | |||
| d1utia_ | 57 | Grb2-related adaptor protein 2 (Mona/Gads) {Mouse | 99.48 | |
| d1gcqa_ | 56 | Growth factor receptor-bound protein 2 (GRB2), N- | 99.46 | |
| d1u06a1 | 55 | alpha-Spectrin, SH3 domain {Chicken (Gallus gallus | 99.44 | |
| d1sema_ | 58 | Growth factor receptor-bound protein 2 (GRB2), N- | 99.44 | |
| d1k4us_ | 62 | p67phox {Human (Homo sapiens) [TaxId: 9606]} | 99.42 | |
| d1uj0a_ | 58 | Signal transducing adaptor molecule Stam2 {Mouse ( | 99.39 | |
| d1wlpb1 | 53 | p47pox (neutrophil cytosolic factor 1) {Human (Hom | 99.39 | |
| d1ng2a2 | 118 | p47pox (neutrophil cytosolic factor 1) {Human (Hom | 99.38 | |
| d1udla_ | 98 | Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta | 99.38 | |
| d1ng2a1 | 58 | p47pox (neutrophil cytosolic factor 1) {Human (Hom | 99.37 | |
| d1ujya_ | 76 | Rac/CDC42 GEF 6 {Human (Homo sapiens) [TaxId: 9606 | 99.37 | |
| d1jo8a_ | 58 | Actin binding protein ABP1 {Baker's yeast (Sacchar | 99.35 | |
| d1ckaa_ | 57 | C-Crk, N-terminal SH3 domain {Mouse (Mus musculus) | 99.34 | |
| d2rn8a1 | 53 | Bruton's tyrosine kinase {Mus musculus [TaxId: 100 | 99.32 | |
| d1oota_ | 58 | Hypothetical protein YFR024c {Baker's yeast (Sacch | 99.31 | |
| d1j3ta_ | 74 | Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta | 99.3 | |
| d1arka_ | 60 | SH3 domain from nebulin {Human (Homo sapiens) [Tax | 99.3 | |
| d1ue9a_ | 80 | Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta | 99.3 | |
| d2v1ra1 | 67 | Peroxisomal membrane protein Pex13p {Baker's yeast | 99.29 | |
| d1gl5a_ | 67 | tyrosine kinase tec {Mouse (Mus musculus) [TaxId: | 99.29 | |
| d1uffa_ | 93 | Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta | 99.28 | |
| d1spka_ | 72 | BAI1-associated protein 2-like 1 (RIKEN cDNA 13000 | 99.28 | |
| d1opka1 | 57 | Abl tyrosine kinase, SH3 domain {Mouse (Mus muscul | 99.28 | |
| d1efna_ | 57 | Fyn proto-oncogene tyrosine kinase, SH3 domain {Hu | 99.27 | |
| d1gcqc_ | 69 | Vav N-terminal SH3 domain {Mouse (Mus musculus) [T | 99.27 | |
| d1gria1 | 56 | Growth factor receptor-bound protein 2 (GRB2), N- | 99.26 | |
| d1ycsb2 | 63 | 53BP2 {Human (Homo sapiens) [TaxId: 9606]} | 99.26 | |
| d1awwa_ | 67 | Bruton's tyrosine kinase {Human (Homo sapiens) [Ta | 99.25 | |
| d1u5sa1 | 71 | Nck-2 {Human (Homo sapiens) [TaxId: 9606]} | 99.24 | |
| d1uhca_ | 79 | Hypothetical protein Baa76854.1 (KIAA1010) {Human | 99.23 | |
| d1uhfa_ | 69 | Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta | 99.22 | |
| d1wiea_ | 96 | RIM binding protein 2, RIMBP2 {Human (Homo sapiens | 99.22 | |
| d1fmka1 | 64 | c-src protein tyrosine kinase {Human (Homo sapiens | 99.22 | |
| d1kjwa1 | 96 | Psd-95 {Rat (Rattus norvegicus) [TaxId: 10116]} | 99.21 | |
| d1phta_ | 83 | Phosphatidylinositol 3-kinase (p85-alpha subunit, | 99.21 | |
| d1ug1a_ | 92 | Hypothetical protein Baa76854.1 (KIAA1010) {Human | 99.21 | |
| d1ugva_ | 72 | Olygophrenin-1 like protein (KIAA0621) {Human (Hom | 99.2 | |
| d1wfwa_ | 74 | Kalirin-9a {Mouse (Mus musculus) [TaxId: 10090]} | 99.2 | |
| d2hspa_ | 71 | Phospholipase C, SH3 domain {Human (Homo sapiens) | 99.2 | |
| d1i07a_ | 59 | EPS8 SH3 domain {Mouse (Mus musculus) [TaxId: 1009 | 99.2 | |
| d1qcfa1 | 65 | Hemapoetic cell kinase Hck {Human (Homo sapiens) [ | 99.18 | |
| d1k9aa1 | 71 | Carboxyl-terminal src kinase (csk) {Human (Homo sa | 99.16 | |
| d1bb9a_ | 83 | Amphiphysin 2 {Rat (Rattus norvegicus) [TaxId: 101 | 99.15 | |
| d2iima1 | 62 | p56-lck tyrosine kinase, SH3 domain {Human (Homo s | 99.1 | |
| d1zuua1 | 56 | BZZ1 {Baker's yeast (Saccharomyces cerevisiae) [Ta | 99.07 | |
| d1i1ja_ | 106 | Melanoma inhibitory activity protein {Human (Homo | 99.06 | |
| d1t0ha_ | 96 | SH3-like domain of the L-type calcium channel {Rab | 99.04 | |
| d1vyva1 | 145 | SH3-like domain of the L-type calcium channel {Rat | 98.92 | |
| d1vyua1 | 136 | SH3-like domain of the L-type calcium channel {Rat | 98.62 | |
| d1ri9a_ | 77 | Fyn-binding protein (T-cell adapter protein adap) | 94.66 |
| >d1utia_ b.34.2.1 (A:) Grb2-related adaptor protein 2 (Mona/Gads) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
class: All beta proteins fold: SH3-like barrel superfamily: SH3-domain family: SH3-domain domain: Grb2-related adaptor protein 2 (Mona/Gads) species: Mouse (Mus musculus) [TaxId: 10090]
Probab=99.48 E-value=1.9e-14 Score=107.33 Aligned_cols=52 Identities=38% Similarity=0.825 Sum_probs=47.4
Q ss_pred CccccccccC----CccccCCCCEEEEEEecCCCeeEEEECCeeeEecCCCeeccC
Q psy9761 369 GWVPKNYIEK----DELSFQESAVIYVLKKNDDGWWEGVMDGITGLFPGNYVEPCV 420 (420)
Q Consensus 369 ~~v~~~Y~~~----dELSf~kGDiI~Vl~k~~~GWweG~~~G~~G~FPsnYVe~i~ 420 (420)
.+++++|++. +||+|++||+|.|+++.++|||.|+.+|+.||||+|||+.|+
T Consensus 2 ~yarAlydy~~~~~~eLs~~~Gd~i~v~~~~~~~Ww~g~~~g~~G~~P~~yve~iv 57 (57)
T d1utia_ 2 RWARALYDFEALEEDELGFRSGEVVEVLDSSNPSWWTGRLHNKLGLFPANYVAPMM 57 (57)
T ss_dssp CEEEESSCBCCCSTTBCCBCTTCEEEEEECCSSSEEEEEETTEEEEEEGGGEEECC
T ss_pred EEEEECcCCCCCCcCCcCCCCCCEEEEeEEcCCCEEEEEECCcEEEEEHHHEEEcC
Confidence 3567777766 999999999999999999999999999999999999999985
|
| >d1gcqa_ b.34.2.1 (A:) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u06a1 b.34.2.1 (A:7-61) alpha-Spectrin, SH3 domain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1sema_ b.34.2.1 (A:) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Caenorhabditis elegans, SEM-5 [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1k4us_ b.34.2.1 (S:) p67phox {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uj0a_ b.34.2.1 (A:) Signal transducing adaptor molecule Stam2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wlpb1 b.34.2.1 (B:229-281) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ng2a2 b.34.2.1 (A:215-332) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1udla_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ng2a1 b.34.2.1 (A:157-214) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ujya_ b.34.2.1 (A:) Rac/CDC42 GEF 6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jo8a_ b.34.2.1 (A:) Actin binding protein ABP1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ckaa_ b.34.2.1 (A:) C-Crk, N-terminal SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2rn8a1 b.34.2.1 (A:176-228) Bruton's tyrosine kinase {Mus musculus [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1oota_ b.34.2.1 (A:) Hypothetical protein YFR024c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1j3ta_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1arka_ b.34.2.1 (A:) SH3 domain from nebulin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ue9a_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2v1ra1 b.34.2.1 (A:10-76) Peroxisomal membrane protein Pex13p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1gl5a_ b.34.2.1 (A:) tyrosine kinase tec {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1uffa_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1spka_ b.34.2.1 (A:) BAI1-associated protein 2-like 1 (RIKEN cDNA 1300006m19) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1opka1 b.34.2.1 (A:83-139) Abl tyrosine kinase, SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1efna_ b.34.2.1 (A:) Fyn proto-oncogene tyrosine kinase, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gcqc_ b.34.2.1 (C:) Vav N-terminal SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1gria1 b.34.2.1 (A:1-56) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ycsb2 b.34.2.1 (B:457-519) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1awwa_ b.34.2.1 (A:) Bruton's tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u5sa1 b.34.2.1 (A:1-71) Nck-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uhca_ b.34.2.1 (A:) Hypothetical protein Baa76854.1 (KIAA1010) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uhfa_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wiea_ b.34.2.1 (A:) RIM binding protein 2, RIMBP2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fmka1 b.34.2.1 (A:82-145) c-src protein tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kjwa1 b.34.2.1 (A:430-525) Psd-95 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1phta_ b.34.2.1 (A:) Phosphatidylinositol 3-kinase (p85-alpha subunit, pi3k), SH3 domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ug1a_ b.34.2.1 (A:) Hypothetical protein Baa76854.1 (KIAA1010) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ugva_ b.34.2.1 (A:) Olygophrenin-1 like protein (KIAA0621) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wfwa_ b.34.2.1 (A:) Kalirin-9a {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2hspa_ b.34.2.1 (A:) Phospholipase C, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1i07a_ b.34.2.1 (A:) EPS8 SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1qcfa1 b.34.2.1 (A:80-145) Hemapoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k9aa1 b.34.2.1 (A:6-76) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bb9a_ b.34.2.1 (A:) Amphiphysin 2 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2iima1 b.34.2.1 (A:58-119) p56-lck tyrosine kinase, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zuua1 b.34.2.1 (A:2-57) BZZ1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1i1ja_ b.34.2.1 (A:) Melanoma inhibitory activity protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1t0ha_ b.34.2.1 (A:) SH3-like domain of the L-type calcium channel {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} | Back information, alignment and structure |
|---|
| >d1vyva1 b.34.2.1 (A:71-215) SH3-like domain of the L-type calcium channel {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1vyua1 b.34.2.1 (A:39-174) SH3-like domain of the L-type calcium channel {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1ri9a_ b.34.2.1 (A:) Fyn-binding protein (T-cell adapter protein adap) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|