Diaphorina citri psyllid: psy977

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-----

MPRPCRETYGDQKPPYSYISLTAMAIWSSPEKMLPLSDIYRFIADRFPYYRRNTQRWQNSLRHNLSFNDCFVKIPRRPDRPGKGAYWALHPAALDMFENGSFLRRRKRFKLPKVDQSLLEATYPVLKAENYTSIKETKSEPLKPTTLSNANKSFSIDSIISSQPSAALPQSMPQPIFSHFHPPVCLPPPIINPSYAAIYAAALHGLLRPPLQMLPGAFPPLNLTPPAGSPLLEVVETSCSSTDSVMQTSVKMDRYSGQPYLPAQQSEHSVSAALDMFENGSFLRRRKRFKLPKVDQSLLEATYPVLKAENYTSIKETKSEPLKPTTLSNANKSFSIDSIISSQPSAALPQSMPQPIFSHFHPPVCLPPPIINPSYAAIYAAALHGLLRPPLQMLPGAFPPLNLTPPAGSPLLEVVETSCSSTDSVMQTSVKKDSFGMKAFLSDFEKILDMRNFQHTHQHIQAGQLRRITGSIQRSNDCLNKTGEL

ccccccccccccccccHHHHHHHHHHHccccccccHHHHHHHHHHcccccccccccHHHHHHccccccccEEccccccccccccccccccccccHHcccccHHHHHHccccccccHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHccccccccccccccccccccccccccccHHHHcccccccccccccccccccccHHHHHHcHHHHHHcccccccHHHHccccEEEEcccccccHHHHHHcccc

***************YSYISLTAMAIWSSPEKMLPLSDIYRFIADRFPYYRRNTQRWQNSLRHNLSFNDCFVKIPRRPDRPGKGAYWALHPAALDMFENGSFLRRRKRFKLP******************************KPTTLSNANKSFSIDSIISSQPSAALPQSMPQPIFSHFHPPVCLPPPIIN************GLLRPPL*MLPGAFPPLN***********************************************************FLRRRKRFKLPKVDQSLLEATYPVLKA***********************************************IFSHFHPPVCLPPPIINPSYAAIYAAALHGLLRPPLQMLPGAFPPLNL*******************************FGMKAFLSDFEKILDMRNFQHTHQHIQAGQLRRITGSIQRSNDCLN*****

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Protein lin-31	Lin-31 regulates how vulval precursor cells choose their fate. It helps specify three alternative cell fates in vulval development.	confident	P34683
Fork head domain-containing protein FD4	Involved in development during embryogenesis.	confident	P32028

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0044212 [MF]	transcription regulatory region DNA binding	probable	GO:0097159, GO:0000975, GO:0001067, GO:0003674, GO:0005488, GO:0003676, GO:0003677, GO:1901363
GO:0009888 [BP]	tissue development	probable	GO:0032502, GO:0048856, GO:0008150
GO:0040027 [BP]	negative regulation of vulval development	probable	GO:0051093, GO:0050793, GO:0051241, GO:0040028, GO:0048581, GO:0048580, GO:0050789, GO:0065007, GO:2000026, GO:0008150, GO:0051239, GO:0048519, GO:0061062, GO:0061064
GO:0043565 [MF]	sequence-specific DNA binding	probable	GO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:0003677, GO:1901363
GO:0040011 [BP]	locomotion	probable	GO:0008150
GO:0040015 [BP]	negative regulation of multicellular organism growth	probable	GO:0045926, GO:0040014, GO:0040008, GO:0051241, GO:0008150, GO:0065007, GO:0051239, GO:0048519, GO:0050789
GO:0040018 [BP]	positive regulation of multicellular organism growth	probable	GO:0040014, GO:0051240, GO:0050789, GO:0065007, GO:0051239, GO:0048518, GO:0008150, GO:0040008, GO:0045927
GO:0031981 [CC]	nuclear lumen	probable	GO:0005575, GO:0043231, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422
GO:0006355 [BP]	regulation of transcription, DNA-dependent	probable	GO:0009889, GO:0080090, GO:0019222, GO:0060255, GO:0031326, GO:0031323, GO:0051252, GO:2000112, GO:0050794, GO:0050789, GO:0019219, GO:0010556, GO:0065007, GO:0051171, GO:2001141, GO:0008150, GO:0010468
GO:0009987 [BP]	cellular process	probable	GO:0008150
GO:0040035 [BP]	hermaphrodite genitalia development	probable	GO:0032502, GO:0007548, GO:0032501, GO:0048608, GO:0000003, GO:0044707, GO:0022414, GO:0061458, GO:0048856, GO:0044767, GO:0003006, GO:0048513, GO:0048806, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0000981 [MF]	sequence-specific DNA binding RNA polymerase II transcription factor activity	probable	GO:0003700, GO:0003674, GO:0001071

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2HFH, chain A
Confidence level:very confident
Coverage over the Query: 12-101
View the alignment between query and template
View the model in PyMOL

Template: 2HFH, chain A
Confidence level:very confident
Coverage over the Query: 250-281
View the alignment between query and template
View the model in PyMOL