Diaphorina citri psyllid: psy9780


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300--
MAQRKKEEEERRQREVEEKKQRDLEEKRQRLEEAEKKRQAMMAALKEQTNKSKGPNFTIQRREPGLTLSTAQLERNKTKEQIEEEKKIALNIRIKPLNVEGWSIHKLQAKATELWETIVKLETDKYDLEERQKRQDYDLKELKERQKQQLRHKALKKGLDPEALTGKYPVKEEERRQREVEEKKQRDLEEKRQRLEEAEKKRQAMMAALKEQTNKSKGPNFTIQRREPGLTLSTAQLERNKTKEQIEEEKKIALNIRIKPLNVEGWSIHKLQAKATELWETIVKLETDKYDLEERQKRQDYD
cHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHcccccccHHHHHHHHHHcHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHccccccccHHHHHHHHccHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHccHHHHHHHcccc
**************************************************************************************KIALNIRIKPLNVEGWSIHKLQAKATELWETIVKLETDKY****************************************************************************************************************************KIALNIRIKPLNVEGWSIHKLQAKATELWETIVKLETDKYDLEE*Q******
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxSKGPNFTIQRREPGLTxxxxxxxxxxxxxxxxxxxxxALNIRIKPLNVEGWSIHKLQAKATELWETIVKLETDKYDLEERQKRQDYDLKELKERQKQQLRHKALKKGLDPEALTGKYPxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxSKGPNFTIQRREPGLTxxxxxxxxxxxxxxxxxxxxxALNIRIKPLNVEGWSIHKLQAKATELWETIVKLETDKYDLEERQKRQDYD

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Troponin T, skeletal muscle Troponin T is the tropomyosin-binding subunit of troponin, the thin filament regulatory complex which confers calcium-sensitivity to striated muscle actomyosin ATPase activity.confidentP19351

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005509 [MF]calcium ion bindingprobableGO:0043169, GO:0046872, GO:0003674, GO:0005488, GO:0043167
GO:0006937 [BP]regulation of muscle contractionprobableGO:0044057, GO:0008150, GO:0090257, GO:0051239, GO:0065007, GO:0050789
GO:0005865 [CC]striated muscle thin filamentprobableGO:0036379, GO:0044446, GO:0043228, GO:0015629, GO:0043232, GO:0005856, GO:0044464, GO:0044444, GO:0005623, GO:0005737, GO:0030016, GO:0030017, GO:0043229, GO:0044430, GO:0043292, GO:0005575, GO:0044424, GO:0005622, GO:0043226, GO:0044422, GO:0044449
GO:0044707 [BP]single-multicellular organism processprobableGO:0032501, GO:0008150, GO:0044699

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1YTZ, chain T
Confidence level:very confident
Coverage over the Query: 56-153
View the alignment between query and template
View the model in PyMOL
Template: 1YTZ, chain T
Confidence level:very confident
Coverage over the Query: 220-302
View the alignment between query and template
View the model in PyMOL
Template: 1I84, chain S
Confidence level:probable
Coverage over the Query: 53-123
View the alignment between query and template
View the model in PyMOL