Diaphorina citri psyllid: psy9781

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------29
MCLASEVPLIESGTAGYEGQVELIKKGETKCYECDPKPAAKTYPGCTIRNTPSEPIHCIVWAKHLFNLEGSAPGLLVLAQGQLFGEIDADEEVSPDTEDPEAVGDAGAKAAASEATANGDVVRTSTRAWASACGYDPRKLFAKFFDADIRYLISMSDLWKTRKAPQPLVWDTLSDAVAGSSKETDGGGLKDQRVWSVAECARVFERSVRELKTKFDVSRPGLDKSFYGDRLTVARNSALNFNPDANIVAHHTSIISADFGVNYFKQFTLVMNALDNRVSKFSALLLCV
ccccccccEEcccccccccEEEEEccccccccccccccccccccccccccccccccHHHHHHHHHHHHHcccccHHHHHHcccccccccccccccccccHHHHHHHHHHHHHHHHHHccccccccccccHHHcccHHHHHHHHHcHHHHHHHHcccccccccccccccccccccHHHcccccccccccccccccccHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHccccccccccHHHHHHHccccccccccccccccEEEEccccHHHHHHHHHccc
MCLASEVPLIESGTAGYEGQVELIKKGETKCYECDPKPAAKTYPGCTIRNTPSEPIHCIVWAKHLFNLEGSAPGLLVLAQGQLFGEIDAD******TEDPEAVGDAGAKAAASEATANGDVVRTSTRAWASACGYDPRKLFAKFFDADIRYLISMSDLWKTRKAPQPLVWDTLSDAV**********GLKDQRVWSVAECARVFERSVRELKTKFDVSRPGLDKSFYGDRLTVARNSALNFNPDANIVAHHTSIISADFGVNYFKQFTLVMNALDNRVSKFSALLLCV
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MCLASEVPLIESGTAGYEGQVELIKKGETKCYECDPKPAAKTYPGCTIRNTPSEPIHCIVWAKHLFNLEGSAPGLLVLAQGQLFGEIDADEEVSPDTEDPEAVGDAGAKAAASEATANGDVVRTSTRAWASACGYDPRKLFAKFFDADIRYLISMSDLWKTRKAPQPLVWDTLSDAVAGSSKETDGGGLKDQRVWSVAECARVFERSVRELKTKFDVSRPGLDKSFYGDRLTVARNSALNFNPDANIVAHHTSIISADFGVNYFKQFTLVMNALDNRVSKFSALLLCV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
SUMO-activating enzyme subunit 2 The heterodimer acts as a E1 ligase for sumo1, sumo2, and sumo3. It mediates ATP-dependent activation of sumo proteins followed by formation of a thioester bond between a sumo protein and a conserved active site cysteine residue on uba2/sae2.confidentQ7SXG4
SUMO-activating enzyme subunit 2 The heterodimer acts as a E1 ligase for SUMO1, SUMO2, SUMO3, and probably SUMO4. It mediates ATP-dependent activation of SUMO proteins followed by formation of a thioester bond between a SUMO protein and a conserved active site cysteine residue on UBA2/SAE2.confidentQ9UBT2
SUMO-activating enzyme subunit 2 The heterodimer acts as a E1 ligase for SUMO1, SUMO2, SUMO3, and probably SUMO4. It mediates ATP-dependent activation of SUMO proteins followed by formation of a thioester bond between a SUMO protein and a conserved active site cysteine residue on UBA2/SAE2.confidentQ9Z1F9

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0008150 [BP]biological_processprobable
GO:0019948 [MF]SUMO activating enzyme activityprobableGO:0003824, GO:0003674, GO:0008641

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1Y8Q, chain B
Confidence level:very confident
Coverage over the Query: 1-67,82-104,125-176,187-286
View the alignment between query and template
View the model in PyMOL