Diaphorina citri psyllid: psy9801


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130--
MMALWKAYDSSQVLTEDTDSFIIGDRVYVGGTKSGRIAFIGETKFAPGDWAGVVLDDPVGKNDGQVGQARYFQCEPRFGLFAPVHKVSKSPMSGTKRLSCAVHHGLRRSGSRESITSNFSNVTTTSVKSNLR
ccccHccccccccccccccccccccEEEEcccccEEEEEEECccccccCEEEEEEcccccccccEEccEEEECcccccEEEEccccEEEccccccccccccccccccccccccccccccccccccccccccc
******************DSFIIGDRVYVGGTKSGRIAFIGETKFAPGDWAGVVLDDPVGKNDGQVGQARYFQCEPRFGLFAPVHK**********************************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MMALWKAYDSSQVLTEDTDSFIIGDRVYVGGTKSGRIAFIGETKFAPGDWAGVVLDDPVGKNDGQVGQARYFQCEPRFGLFAPVHKVSKSPMSGTKRLSCAVHHGLRRSGSRESITSNFSNVTTTSVKSNLR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
CAP-Gly domain-containing linker protein 1 Binds to the plus end of microtubules and regulates the dynamics of the microtubule cytoskeleton. Promotes microtubule growth and microtubule bundling. Links cytoplasmic vesicles to microtubules and thereby plays an important role in intracellular vesicle trafficking. Plays a role macropinocytosis and endosome trafficking.confidentO42184
Restin homolog Together CLIP-190 and jar may coordinate the interaction between the actin and microtubule cytoskeleton. May link endocytic vesicles to microtubules. May play a role in formation of furrows during cellularization.confidentQ9VJE5
CAP-Gly domain-containing linker protein 1 Binds to the plus end of microtubules and regulates the dynamics of the microtubule cytoskeleton. Promotes microtubule growth and microtubule bundling. Links cytoplasmic vesicles to microtubules and thereby plays an important role in intracellular vesicle trafficking. Plays a role macropinocytosis and endosome trafficking.confidentP30622

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0051010 [MF]microtubule plus-end bindingprobableGO:0015631, GO:0008092, GO:0008017, GO:0003674, GO:0005488, GO:0005515
GO:0035371 [CC]microtubule plus endprobableGO:0005856, GO:0043234, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0044424, GO:0043228, GO:0005874, GO:0043226, GO:0044422
GO:0044354 [CC]macropinosomeprobableGO:0005737, GO:0043231, GO:0044352, GO:0043227, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0005768, GO:0043226
GO:0003779 [MF]actin bindingprobableGO:0003674, GO:0005488, GO:0005515, GO:0008092
GO:0005875 [CC]microtubule associated complexprobableGO:0043234, GO:0005856, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0044424, GO:0043228, GO:0043226, GO:0044422
GO:0005876 [CC]spindle microtubuleprobableGO:0043234, GO:0005856, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0005819, GO:0044430, GO:0044424, GO:0043228, GO:0005874, GO:0043226, GO:0044422
GO:0048856 [BP]anatomical structure developmentprobableGO:0032502, GO:0008150
GO:0090004 [BP]positive regulation of establishment of protein localization to plasma membraneprobableGO:0051130, GO:0070201, GO:0032879, GO:0060341, GO:0051128, GO:0032880, GO:0065007, GO:0048518, GO:0008150, GO:0050794, GO:0090003, GO:0050789, GO:0048522
GO:0042995 [CC]cell projectionprobableGO:0005575, GO:0044464, GO:0005623
GO:0044267 [BP]cellular protein metabolic processprobableGO:0044238, GO:0044260, GO:0019538, GO:0009987, GO:0044237, GO:0043170, GO:0071704, GO:0008150, GO:0008152
GO:0035594 [MF]ganglioside bindingprobableGO:0043208, GO:0046625, GO:0008289, GO:0097001, GO:0003674, GO:0005488, GO:0051861
GO:0031115 [BP]negative regulation of microtubule polymerizationprobableGO:0031110, GO:0031111, GO:0031113, GO:0033043, GO:0051129, GO:0051128, GO:0032886, GO:0050789, GO:0044699, GO:0051494, GO:0051493, GO:0065007, GO:0032271, GO:0032272, GO:0048519, GO:0031333, GO:0009987, GO:0050794, GO:0044763, GO:0043254, GO:0010639, GO:0044087, GO:0008150, GO:0070507, GO:0048523
GO:0000922 [CC]spindle poleprobableGO:0043234, GO:0005856, GO:0005819, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0044422, GO:0044424, GO:0043228, GO:0043226, GO:0015630
GO:0031901 [CC]early endosome membraneprobableGO:0005737, GO:0005575, GO:0043226, GO:0031090, GO:0043227, GO:0016020, GO:0044464, GO:0043229, GO:0005623, GO:0043231, GO:0044446, GO:0044444, GO:0044440, GO:0044424, GO:0005622, GO:0005768, GO:0005769, GO:0044422, GO:0010008
GO:0001578 [BP]microtubule bundle formationprobableGO:0006996, GO:0007017, GO:0007010, GO:0009987, GO:0016043, GO:0008150, GO:0044763, GO:0071840, GO:0000226, GO:0044699
GO:0005938 [CC]cell cortexprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0071944, GO:0044424
GO:0042803 [MF]protein homodimerization activityprobableGO:0046983, GO:0003674, GO:0005515, GO:0042802, GO:0005488
GO:0000776 [CC]kinetochoreprobableGO:0043234, GO:0005575, GO:0005622, GO:0032991, GO:0043232, GO:0044464, GO:0005623, GO:0043226, GO:0044446, GO:0043229, GO:0043228, GO:0044424, GO:0044427, GO:0005694, GO:0000775, GO:0044422
GO:0005802 [CC]trans-Golgi networkprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0005813 [CC]centrosomeprobableGO:0005856, GO:0005575, GO:0015630, GO:0043232, GO:0044464, GO:0005623, GO:0005815, GO:0044446, GO:0043229, GO:0043228, GO:0044430, GO:0044424, GO:0005622, GO:0043226, GO:0044422
GO:0031116 [BP]positive regulation of microtubule polymerizationprobableGO:0031110, GO:0031112, GO:0031113, GO:0033043, GO:0051128, GO:0032886, GO:0050789, GO:0051495, GO:0051493, GO:0065007, GO:0032271, GO:0032273, GO:0048518, GO:0051130, GO:0031334, GO:0050794, GO:0008150, GO:0043254, GO:0010638, GO:0044087, GO:0070507, GO:0048522
GO:0008270 [MF]zinc ion bindingprobableGO:0043169, GO:0046914, GO:0043167, GO:0003674, GO:0005488, GO:0046872
GO:0031981 [CC]nuclear lumenprobableGO:0005575, GO:0043231, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422
GO:0005794 [CC]Golgi apparatusprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0045121 [CC]membrane raftprobableGO:0005575, GO:0044425, GO:0016020
GO:0045169 [CC]fusomeprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0055038 [CC]recycling endosome membraneprobableGO:0005737, GO:0005575, GO:0031090, GO:0043227, GO:0055037, GO:0016020, GO:0044464, GO:0043229, GO:0005623, GO:0043231, GO:0044446, GO:0044444, GO:0044440, GO:0044424, GO:0005622, GO:0005768, GO:0043226, GO:0044422, GO:0010008
GO:0005881 [CC]cytoplasmic microtubuleprobableGO:0005737, GO:0043234, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0005856, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0044446, GO:0044444, GO:0044430, GO:0044424, GO:0043228, GO:0005874, GO:0043226, GO:0044422
GO:0044085 [BP]cellular component biogenesisprobableGO:0008150, GO:0071840
GO:0001934 [BP]positive regulation of protein phosphorylationprobableGO:0019220, GO:0009893, GO:0019222, GO:0031325, GO:0031323, GO:0050789, GO:0080090, GO:0010604, GO:0010562, GO:0051246, GO:0051247, GO:0032270, GO:0031399, GO:0048518, GO:0065007, GO:0045937, GO:0060255, GO:0050794, GO:0051174, GO:0008150, GO:0042325, GO:0042327, GO:0032268, GO:0031401, GO:0001932, GO:0048522

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2E3H, chain A
Confidence level:very confident
Coverage over the Query: 20-94
View the alignment between query and template
View the model in PyMOL
Template: 2CP6, chain A
Confidence level:very confident
Coverage over the Query: 17-102
View the alignment between query and template
View the model in PyMOL