Psyllid ID: psy9801

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130--
MMALWKAYDSSQVLTEDTDSFIIGDRVYVGGTKSGRIAFIGETKFAPGDWAGVVLDDPVGKNDGQVGQARYFQCEPRFGLFAPVHKVSKSPMSGTKRLSCAVHHGLRRSGSRESITSNFSNVTTTSVKSNLR
ccccHHcccccccccccccccccccEEEEcccccEEEEEEEEccccccEEEEEEEcccccccccEEccEEEEEcccccEEEEccccEEEccccccccccccccccccccccccccccccccccccccccccc
ccccccccccccccccccccEEEccEEEEEccEEEEEEEEEccccccccEEEEEEccccccEccEEccEEccccccccEEEEcccEEEEccccccccccccccccccccccccccccccccccccccccccc
MMALWkaydssqvltedtdsfiigdrvyvggtksgriafigetkfapgdwagvvlddpvgkndgqvgqaryfqceprfglfapvhkvskspmsgtkrlSCAVhhglrrsgsresitsnfsnvtttsvksnlr
mmalwkaydssqvltedtdsfiiGDRVYVGGTKSGRIAFIGETKFAPGDWAGVVLDDPVGKNDGQVGQARYFQCEPRFGLFAPVHKVskspmsgtkRLSCAVHhglrrsgsresitsnfsnvtttsvksnlr
MMALWKAYDSSQVLTEDTDSFIIGDRVYVGGTKSGRIAFIGETKFAPGDWAGVVLDDPVGKNDGQVGQARYFQCEPRFGLFAPVHKVSKSPMSGTKRLSCAVHHGLRRSGSRESItsnfsnvtttsvksnLR
***LWKAYDSSQVLTEDTDSFIIGDRVYVGGTKSGRIAFIGETKFAPGDWAGVVLDDPVGKNDGQVGQARYFQCEPRFGLFAPVHK**********************************************
***********************GDRVYVGGTKSGRIAFIGETKFAPGDWAGVVLDDPVGKNDGQVGQARYFQCEPRFGLFAP*************************************************
MMALWKAYDSSQVLTEDTDSFIIGDRVYVGGTKSGRIAFIGETKFAPGDWAGVVLDDPVGKNDGQVGQARYFQCEPRFGLFAPVHK**********RLSCAV***********SITSNFSN***********
******************DSFIIGDRVYVGGTKSGRIAFIGETKFAPGDWAGVVLDDPVGKNDGQVGQARYFQCEPRFGLFAPVHKVSKS******************************************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MMALWKAYDSSQVLTEDTDSFIIGDRVYVGGTKSGRIAFIGETKFAPGDWAGVVLDDPVGKNDGQVGQARYFQCEPRFGLFAPVHKVSKSPMSGTKRLSCAVHHGLRRSGSRESITSNFSNVTTTSVKSNLR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query132 2.2.26 [Sep-21-2011]
Q9VJE5 1690 Restin homolog OS=Drosoph yes N/A 0.575 0.044 0.568 3e-26
O42184 1433 CAP-Gly domain-containing yes N/A 0.507 0.046 0.701 6e-25
P30622 1438 CAP-Gly domain-containing yes N/A 0.507 0.046 0.686 1e-24
Q922J3 1391 CAP-Gly domain-containing yes N/A 0.507 0.048 0.671 3e-24
O55156 1046 CAP-Gly domain-containing no N/A 0.704 0.088 0.539 7e-24
Q9Z0H8 1047 CAP-Gly domain-containing no N/A 0.704 0.088 0.539 8e-24
Q9UDT6 1046 CAP-Gly domain-containing no N/A 0.704 0.088 0.529 2e-23
Q8N3C7 705 CAP-Gly domain-containing no N/A 0.469 0.087 0.529 2e-18
Q8CI96 704 CAP-Gly domain-containing no N/A 0.462 0.086 0.537 2e-18
Q66HD5 599 CAP-Gly domain-containing no N/A 0.462 0.101 0.522 4e-18
>sp|Q9VJE5|CL190_DROME Restin homolog OS=Drosophila melanogaster GN=CLIP-190 PE=1 SV=1 Back     alignment and function desciption
 Score =  117 bits (292), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 50/88 (56%), Positives = 70/88 (79%)

Query: 9   DSSQVLTEDTDSFIIGDRVYVGGTKSGRIAFIGETKFAPGDWAGVVLDDPVGKNDGQVGQ 68
           +SS VLT +T+ FIIG RV++GGT+ G+IAFIG+T FA G+WAGVVLD+P GKNDG V  
Sbjct: 111 NSSAVLTANTEQFIIGQRVWLGGTRPGQIAFIGDTHFAAGEWAGVVLDEPNGKNDGCVSG 170

Query: 69  ARYFQCEPRFGLFAPVHKVSKSPMSGTK 96
            RYFQCEP+ G+F+ + +++  P++G +
Sbjct: 171 KRYFQCEPKRGIFSRLTRLTTYPLAGAQ 198
Together CLIP-190 and jar may coordinate the interaction between the actin and microtubule cytoskeleton. May link endocytic vesicles to microtubules. May play a role in formation of furrows during cellularization.
Drosophila melanogaster (taxid: 7227)
>sp|O42184|CLIP1_CHICK CAP-Gly domain-containing linker protein 1 OS=Gallus gallus GN=CLIP1 PE=2 SV=1 Back     alignment and function description
>sp|P30622|CLIP1_HUMAN CAP-Gly domain-containing linker protein 1 OS=Homo sapiens GN=CLIP1 PE=1 SV=2 Back     alignment and function description
>sp|Q922J3|CLIP1_MOUSE CAP-Gly domain-containing linker protein 1 OS=Mus musculus GN=Clip1 PE=1 SV=1 Back     alignment and function description
>sp|O55156|CLIP2_RAT CAP-Gly domain-containing linker protein 2 OS=Rattus norvegicus GN=Clip2 PE=1 SV=1 Back     alignment and function description
>sp|Q9Z0H8|CLIP2_MOUSE CAP-Gly domain-containing linker protein 2 OS=Mus musculus GN=Clip2 PE=1 SV=2 Back     alignment and function description
>sp|Q9UDT6|CLIP2_HUMAN CAP-Gly domain-containing linker protein 2 OS=Homo sapiens GN=CLIP2 PE=1 SV=1 Back     alignment and function description
>sp|Q8N3C7|CLIP4_HUMAN CAP-Gly domain-containing linker protein 4 OS=Homo sapiens GN=CLIP4 PE=1 SV=1 Back     alignment and function description
>sp|Q8CI96|CLIP4_MOUSE CAP-Gly domain-containing linker protein 4 OS=Mus musculus GN=Clip4 PE=1 SV=1 Back     alignment and function description
>sp|Q66HD5|CLIP4_RAT CAP-Gly domain-containing linker protein 4 OS=Rattus norvegicus GN=Clip4 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query132
340711263 1639 PREDICTED: CAP-Gly domain-containing lin 0.590 0.047 0.648 2e-31
345494045 1659 PREDICTED: CAP-Gly domain-containing lin 0.886 0.070 0.516 4e-31
332027329 1584 CAP-Gly domain-containing linker protein 0.590 0.049 0.659 4e-31
307183845 1629 Restin-like protein [Camponotus floridan 0.628 0.050 0.662 6e-31
350411733 1609 PREDICTED: restin homolog [Bombus impati 0.545 0.044 0.670 1e-30
340711265 1609 PREDICTED: CAP-Gly domain-containing lin 0.545 0.044 0.670 1e-30
307197537 1595 Restin-like protein [Harpegnathos saltat 0.553 0.045 0.682 1e-30
328779692 1608 PREDICTED: restin homolog [Apis mellifer 0.590 0.048 0.648 1e-30
322790005 1584 hypothetical protein SINV_05857 [Solenop 0.575 0.047 0.662 2e-30
383860638 1566 PREDICTED: CAP-Gly domain-containing lin 0.537 0.045 0.678 3e-30
>gi|340711263|ref|XP_003394198.1| PREDICTED: CAP-Gly domain-containing linker protein 1-like isoform 1 [Bombus terrestris] Back     alignment and taxonomy information
 Score =  140 bits (353), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 59/91 (64%), Positives = 78/91 (85%)

Query: 3   ALWKAYDSSQVLTEDTDSFIIGDRVYVGGTKSGRIAFIGETKFAPGDWAGVVLDDPVGKN 62
            L +  D+S VLTEDTDSFIIGDRV+VGGTK G IA+IGET+FAPGDWAGVVLD+P+GKN
Sbjct: 55  GLRRGSDNSVVLTEDTDSFIIGDRVWVGGTKPGSIAYIGETQFAPGDWAGVVLDEPIGKN 114

Query: 63  DGQVGQARYFQCEPRFGLFAPVHKVSKSPMS 93
           DG V  +RYFQCEP+ G+F+ + +++++P++
Sbjct: 115 DGSVAGSRYFQCEPKRGIFSRLTRLTRAPLT 145

Source: Bombus terrestris

Species: Bombus terrestris

Genus: Bombus

Family: Apidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|345494045|ref|XP_001606131.2| PREDICTED: CAP-Gly domain-containing linker protein 1-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|332027329|gb|EGI67413.1| CAP-Gly domain-containing linker protein 1 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|307183845|gb|EFN70480.1| Restin-like protein [Camponotus floridanus] Back     alignment and taxonomy information
>gi|350411733|ref|XP_003489438.1| PREDICTED: restin homolog [Bombus impatiens] Back     alignment and taxonomy information
>gi|340711265|ref|XP_003394199.1| PREDICTED: CAP-Gly domain-containing linker protein 1-like isoform 2 [Bombus terrestris] Back     alignment and taxonomy information
>gi|307197537|gb|EFN78767.1| Restin-like protein [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|328779692|ref|XP_396089.4| PREDICTED: restin homolog [Apis mellifera] Back     alignment and taxonomy information
>gi|322790005|gb|EFZ15081.1| hypothetical protein SINV_05857 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|383860638|ref|XP_003705796.1| PREDICTED: CAP-Gly domain-containing linker protein 1-like [Megachile rotundata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query132
UNIPROTKB|J9P0I9 702 CLIP2 "Uncharacterized protein 0.795 0.149 0.521 1.1e-22
FB|FBgn0020503 1690 CLIP-190 "Cytoplasmic linker p 0.666 0.052 0.568 1.3e-22
RGD|62019 1046 Clip2 "CAP-GLY domain containi 0.795 0.100 0.521 2.3e-22
UNIPROTKB|E1BGH3 1047 CLIP2 "Uncharacterized protein 0.795 0.100 0.521 2.3e-22
MGI|MGI:1313136 1047 Clip2 "CAP-GLY domain containi 0.795 0.100 0.521 2.3e-22
UNIPROTKB|O42184 1433 CLIP1 "CAP-Gly domain-containi 0.704 0.064 0.554 5.8e-22
UNIPROTKB|Q9UDT6 1046 CLIP2 "CAP-Gly domain-containi 0.795 0.100 0.513 6e-22
MGI|MGI:1928401 1391 Clip1 "CAP-GLY domain containi 0.704 0.066 0.514 1.2e-21
UNIPROTKB|E1BQI8 1040 CLIP2 "Uncharacterized protein 0.795 0.100 0.504 1.6e-21
RGD|67404 1320 Clip1 "CAP-GLY domain containi 0.507 0.050 0.686 1.8e-21
UNIPROTKB|J9P0I9 CLIP2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
 Score = 272 (100.8 bits), Expect = 1.1e-22, P = 1.1e-22
 Identities = 60/115 (52%), Positives = 72/115 (62%)

Query:     9 DSSQVLTEDTDSFIIGDRVYVGGTKSGRIAFIGETKFAPGDWAGVVLDDPVGKNDGQVGQ 68
             DS  V   D D   +GDRV VGGTK+G + ++GET FA G+W GV LD+P+GKNDG V  
Sbjct:   211 DSGSVKRGDKD-LRLGDRVLVGGTKTGVVRYVGETDFAKGEWCGVELDEPLGKNDGAVAG 269

Query:    69 ARYFQCEPRFGLFAPVHKV------SKSPMSG--TKRLSCAVHHGLRRSGSRESI 115
              RYFQC P+FGLFAP+HKV      S SP     TKR++  V   L  S S  SI
Sbjct:   270 TRYFQCPPKFGLFAPIHKVIRIGFPSTSPAKAKKTKRMAMGVS-ALTHSPSSSSI 323
GO:0043565 "sequence-specific DNA binding" evidence=IEA
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=IEA
FB|FBgn0020503 CLIP-190 "Cytoplasmic linker protein 190" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
RGD|62019 Clip2 "CAP-GLY domain containing linker protein 2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|E1BGH3 CLIP2 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
MGI|MGI:1313136 Clip2 "CAP-GLY domain containing linker protein 2" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|O42184 CLIP1 "CAP-Gly domain-containing linker protein 1" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q9UDT6 CLIP2 "CAP-Gly domain-containing linker protein 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:1928401 Clip1 "CAP-GLY domain containing linker protein 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|E1BQI8 CLIP2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
RGD|67404 Clip1 "CAP-GLY domain containing linker protein 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q922J3CLIP1_MOUSENo assigned EC number0.67160.50750.0481yesN/A
O42184CLIP1_CHICKNo assigned EC number0.70140.50750.0467yesN/A
Q9VJE5CL190_DROMENo assigned EC number0.56810.57570.0449yesN/A
P30622CLIP1_HUMANNo assigned EC number0.68650.50750.0465yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query132
pfam0130267 pfam01302, CAP_GLY, CAP-Gly domain 3e-25
smart0105268 smart01052, CAP_GLY, Cytoskeleton-associated prote 2e-22
COG5244 669 COG5244, NIP100, Dynactin complex subunit involved 3e-18
>gnl|CDD|216424 pfam01302, CAP_GLY, CAP-Gly domain Back     alignment and domain information 
 Score = 90.3 bits (225), Expect = 3e-25
 Identities = 34/67 (50%), Positives = 44/67 (65%), Gaps = 1/67 (1%)

Query: 23 IGDRVYV-GGTKSGRIAFIGETKFAPGDWAGVVLDDPVGKNDGQVGQARYFQCEPRFGLF 81
          +GDRV V GG + G + ++G   FAPG W GV LD+P GKNDG V   RYF+C P++G+F
Sbjct: 1  VGDRVEVLGGGRRGTVRYVGPVPFAPGLWVGVELDEPRGKNDGSVDGVRYFECPPKYGIF 60

Query: 82 APVHKVS 88
              KV 
Sbjct: 61 VRPSKVE 67

Cytoskeleton-associated proteins (CAPs) are involved in the organisation of microtubules and transportation of vesicles and organelles along the cytoskeletal network. A conserved motif, CAP-Gly, has been identified in a number of CAPs, including CLIP-170 and dynactins. The crystal structure of Caenorhabditis elegans F53F4.3 protein CAP-Gly domain was recently solved. The domain contains three beta-strands. The most conserved sequence, GKNDG, is located in two consecutive sharp turns on the surface, forming the entrance to a groove. Length = 67
>gnl|CDD|214997 smart01052, CAP_GLY, Cytoskeleton-associated proteins (CAPs) are involved in the organisation of microtubules and transportation of vesicles and organelles along the cytoskeletal network Back     alignment and domain information
>gnl|CDD|227569 COG5244, NIP100, Dynactin complex subunit involved in mitotic spindle partitioning in anaphase B [Cell division and chromosome partitioning] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 132
PF0130269 CAP_GLY: CAP-Gly domain; InterPro: IPR000938 Cytos 99.96
KOG3206|consensus234 99.88
KOG0971|consensus 1243 99.86
COG5244 669 NIP100 Dynactin complex subunit involved in mitoti 99.82
KOG4568|consensus 664 99.76
KOG3207|consensus 505 99.73
KOG4568|consensus 664 99.35
KOG0241|consensus1714 99.24
KOG3556|consensus 724 99.21
PTZ00243 1560 ABC transporter; Provisional 96.11
PRK1070862 hypothetical protein; Provisional 93.09
PF1078162 DSRB: Dextransucrase DSRB; InterPro: IPR019717 DSR 93.05
>PF01302 CAP_GLY: CAP-Gly domain; InterPro: IPR000938 Cytoskeleton-associated proteins (CAP) are made of three distinct parts, an N-terminal section that is most probably globular and contains the CAP-Gly domain, a large central region predicted to be in an alpha-helical coiled-coil conformation and, finally, a short C-terminal globular domain Back     alignment and domain information 
Probab=99.96  E-value=1.2e-28  Score=165.94  Aligned_cols=66  Identities=48%  Similarity=0.956  Sum_probs=59.5

Q ss_pred             cccEEEE--CCCceEEEEEEeecC-CCCCcEEEEEEcCCCCCCCcEECCEEeeecCCCCeeEEecCCee
Q psy9801          23 IGDRVYV--GGTKSGRIAFIGETK-FAPGDWAGVVLDDPVGKNDGQVGQARYFQCEPRFGLFAPVHKVS   88 (132)
Q Consensus        23 vGdRV~V--~g~~~GtVRyiG~v~-~~~g~wvGVELDep~GknDGt~~G~rYF~C~p~~GiFv~~~kv~   88 (132)
                      |||||.|  .....|+|||+|+++ ...|+|+|||||++.|+|||+++|+|||+|+|+||+||++++|+
T Consensus         1 VG~rV~v~~~~~~~G~vryiG~~~~~~~g~~vGVEld~~~G~~dGt~~G~rYF~c~~~~G~Fv~~~~v~   69 (69)
T PF01302_consen    1 VGDRVRVDDPGGRRGTVRYIGPVPGFKSGIWVGVELDEPRGKNDGTVKGKRYFECPPNHGIFVRPSKVE   69 (69)
T ss_dssp             TTSEEEESSTTTEEEEEEEEEE-SSSSSSEEEEEEESSSTSSBSSEETTEESS-SSTTTEEEEEGGGE-
T ss_pred             CCCEEEEeeCCCCEEEEEEEeeCCCCCCCEEEEEEEcCCCCCCCcEECCEEEeeeCCCCEEEecHHHCC
Confidence            7999999  346899999999999 67789999999999999999999999999999999999999985

The CAP-Gly domain is a conserved, glycine-rich domain of about 42 residues found in some CAPs []. Proteins known to contain this domain include restin (also known as cytoplasmic linker protein-170 or CLIP-170), a 160 kDa protein associated with intermediate filaments and that links endocytic vesicles to microtubules; vertebrate dynactin (150 kDa dynein-associated polypeptide; DAP) and Drosophila glued, a major component of activator I; yeast protein BIK1, which seems to be required for the formation or stabilisation of microtubules during mitosis and for spindle pole body fusion during conjugation; yeast protein NIP100 (NIP80); human protein CKAP1/TFCB; Schizosaccharomyces pombe protein alp11 and Caenorhabditis elegans hypothetical protein F53F4.3. The latter proteins contain a N-terminal ubiquitin domain and a C-terminal CAP-Gly domain. The crystal structure of the CAP-Gly domain of C. elegans F53F4.3 protein, solved by single wavelength sulphur-anomalous phasing, revealed a novel protein fold containing three beta-sheets. The most conserved sequence, GKNDG, is located in two consecutive sharp turns on the surface, forming the entrance to a groove. Residues in the groove are highly conserved as measured from the information content of the aligned sequences. The C-terminal tail of another molecule in the crystal is bound in this groove []. ; PDB: 2CP6_A 2E4H_A 2E3H_A 3E2U_B 2HL3_B 3TQ7_Q 2HKQ_B 2HQH_A 2HKN_B 2HL5_C ....
>KOG3206|consensus Back     alignment and domain information
>KOG0971|consensus Back     alignment and domain information
>COG5244 NIP100 Dynactin complex subunit involved in mitotic spindle partitioning in anaphase B [Cell division and chromosome partitioning] Back     alignment and domain information
>KOG4568|consensus Back     alignment and domain information
>KOG3207|consensus Back     alignment and domain information
>KOG4568|consensus Back     alignment and domain information
>KOG0241|consensus Back     alignment and domain information
>KOG3556|consensus Back     alignment and domain information
>PTZ00243 ABC transporter; Provisional Back     alignment and domain information
>PRK10708 hypothetical protein; Provisional Back     alignment and domain information
>PF10781 DSRB: Dextransucrase DSRB; InterPro: IPR019717 DSRB is a novel dextransucrase which produces a dextran different from the typical dextran, as it contains (1-6) and (1-2) linkages, when this strain is grown in the presence of sucrose [] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query132
2cp6_A172 Solution Structure Of The 2nd Cap-Gly Domain In Hum 1e-24
2e4h_A98 Solution Structure Of Cytoskeletal Protein In Compl 9e-24
2e3h_A90 Crystal Structure Of The Clip-170 Cap-Gly Domain 2 1e-23
2cp3_A84 Solution Structure Of The 2nd Cap-Gly Domain In Hum 4e-22
2cp5_A141 Solution Structure Of The 1st Cap-Gly Domain In Hum 7e-22
2e3i_A86 Crystal Structure Of The Clip-170 Cap-Gly Domain 1 2e-20
3rdv_A72 Structure Of The Slain2c-Clipcg1 Complex Length = 7 3e-20
2cp7_A84 Solution Structure Of The 1st Cap-Gly Domain In Mou 7e-20
2cp2_A95 Solution Structure Of The 1st Cap-Gly Domain In Hum 1e-19
2qk0_A74 Structural Basis Of Microtubule Plus End Tracking B 3e-19
1whj_A102 Solution Structure Of The 1st Cap-Gly Domain In Mou 6e-19
2cp0_A95 Solution Structure Of The 1st Cap-Gly Domain In Hum 2e-17
2z0w_A96 Crystal Structure Of The 2nd Cap-Gly Domain In Huma 6e-16
1whh_A102 Solution Structure Of The 2nd Cap-Gly Domain In Mou 2e-15
2coz_A122 Solution Structure Of The Cap-Gly Domain In Human C 3e-14
1tov_A98 Structural Genomics Of Caenorhabditis Elegans: Cap- 2e-12
1lpl_A95 Structural Genomics Of Caenorhabditis Elegans: Cap- 4e-12
2cow_A100 Solution Structure Of The Cap-Gly Domain In Human K 6e-11
1whg_A113 Solution Structure Of The Cap-Gly Domain In Mouse T 3e-10
2coy_A112 Solution Structure Of The Cap-Gly Domain In Human D 2e-09
1txq_A93 Crystal Structure Of The Eb1 C-Terminal Domain Comp 2e-09
2hkn_A97 Crystal Structure Of The Cap-Gly Domain Of Human Dy 2e-09
2hl3_A97 Crystal Structure Of The A49m Mutant Cap-Gly Domain 3e-09
3tq7_P71 Eb1cEB3C HETERODIMER IN COMPLEX WITH THE CAP-Gly Do 3e-09
1whk_A91 Solution Structure Of The 3rd Cap-Gly Domain In Mou 1e-08
4b6m_A84 Trypansoma Brucei Tubulin Binding Cofactor B Cap-Gl 1e-07
>pdb|2CP6|A Chain A, Solution Structure Of The 2nd Cap-Gly Domain In Human Clip- 170RESTIN Length = 172 Back     alignment and structure 
Iteration: 1

 Score =  108 bits (269), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 46/67 (68%), Positives = 56/67 (83%)
Query: 23  IGDRVYVGGTKSGRIAFIGETKFAPGDWAGVVLDDPVGKNDGQVGQARYFQCEPRFGLFA 82
           IGDRV VGGTK+G + F+GET FA G+W GV LD+P+GKNDG V   RYFQC+P++GLFA
Sbjct: 41  IGDRVLVGGTKAGVVRFLGETDFAKGEWCGVELDEPLGKNDGAVAGTRYFQCQPKYGLFA 100
Query: 83  PVHKVSK 89
           PVHKV+K
Sbjct: 101 PVHKVTK 107
>pdb|2E4H|A Chain A, Solution Structure Of Cytoskeletal Protein In Complex With Tubulin Tail Length = 98 Back     alignment and structure
>pdb|2E3H|A Chain A, Crystal Structure Of The Clip-170 Cap-Gly Domain 2 Length = 90 Back     alignment and structure
>pdb|2CP3|A Chain A, Solution Structure Of The 2nd Cap-Gly Domain In Human Clip- 115CYLN2 Length = 84 Back     alignment and structure
>pdb|2CP5|A Chain A, Solution Structure Of The 1st Cap-Gly Domain In Human Clip- 170RESTIN Length = 141 Back     alignment and structure
>pdb|2E3I|A Chain A, Crystal Structure Of The Clip-170 Cap-Gly Domain 1 Length = 86 Back     alignment and structure
>pdb|3RDV|A Chain A, Structure Of The Slain2c-Clipcg1 Complex Length = 72 Back     alignment and structure
>pdb|2CP7|A Chain A, Solution Structure Of The 1st Cap-Gly Domain In Mouse Clip- 170RESTIN Length = 84 Back     alignment and structure
>pdb|2CP2|A Chain A, Solution Structure Of The 1st Cap-Gly Domain In Human Clip- 115CYLN2 Length = 95 Back     alignment and structure
>pdb|2QK0|A Chain A, Structural Basis Of Microtubule Plus End Tracking By Xmap215, Clip-170 And Eb1 Length = 74 Back     alignment and structure
>pdb|1WHJ|A Chain A, Solution Structure Of The 1st Cap-Gly Domain In Mouse 1700024k14rik Hypothetical Protein Length = 102 Back     alignment and structure
>pdb|2CP0|A Chain A, Solution Structure Of The 1st Cap-Gly Domain In Human Clip- 170-Related Protein Clipr59 Length = 95 Back     alignment and structure
>pdb|2Z0W|A Chain A, Crystal Structure Of The 2nd Cap-Gly Domain In Human Restin- Like Protein 2 Reveals A Swapped-Dimer Length = 96 Back     alignment and structure
>pdb|1WHH|A Chain A, Solution Structure Of The 2nd Cap-Gly Domain In Mouse Clip170-Related 59kda Protein Clipr-59 Length = 102 Back     alignment and structure
>pdb|2COZ|A Chain A, Solution Structure Of The Cap-Gly Domain In Human Centrosome-Associated Protein Cap350 Length = 122 Back     alignment and structure
>pdb|1TOV|A Chain A, Structural Genomics Of Caenorhabditis Elegans: Cap-Gly Domain Of F53f4.3 Length = 98 Back     alignment and structure
>pdb|1LPL|A Chain A, Structural Genomics Of Caenorhabditis Elegans: Cap-Gly Domain Of F53f4.3 Length = 95 Back     alignment and structure
>pdb|2COW|A Chain A, Solution Structure Of The Cap-Gly Domain In Human Kinesin- Like Protein Kif13b Length = 100 Back     alignment and structure
>pdb|1WHG|A Chain A, Solution Structure Of The Cap-Gly Domain In Mouse Tubulin Specific Chaperone B Length = 113 Back     alignment and structure
>pdb|2COY|A Chain A, Solution Structure Of The Cap-Gly Domain In Human Dynactin 1 Length = 112 Back     alignment and structure
>pdb|1TXQ|A Chain A, Crystal Structure Of The Eb1 C-Terminal Domain Complexed With The Cap-Gly Domain Of P150glued Length = 93 Back     alignment and structure
>pdb|2HKN|A Chain A, Crystal Structure Of The Cap-Gly Domain Of Human Dynactin-1 (P150- Glued) Length = 97 Back     alignment and structure
>pdb|2HL3|A Chain A, Crystal Structure Of The A49m Mutant Cap-Gly Domain Of Human Dynactin-1 (P150-Glued) In Complex With Human Eb1 C- Terminal Hexapeptide Length = 97 Back     alignment and structure
>pdb|3TQ7|P Chain P, Eb1cEB3C HETERODIMER IN COMPLEX WITH THE CAP-Gly Domain Of P150glued Length = 71 Back     alignment and structure
>pdb|1WHK|A Chain A, Solution Structure Of The 3rd Cap-Gly Domain In Mouse 1700024k14rik Hypothetical Protein Length = 91 Back     alignment and structure
>pdb|4B6M|A Chain A, Trypansoma Brucei Tubulin Binding Cofactor B Cap-Gly Domain Length = 84 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query132
2cp2_A95 CLIP-115, KIAA0291; microtubule binding, cytoskele 6e-32
3rdv_A72 CAP-Gly domain-containing linker protein 1; cytosk 1e-31
2e3i_A86 Restin; CAP-Gly, cytoplasmic linker, tubulin bindi 1e-31
2cp3_A84 CLIP-115, KIAA0291; microtubule binding, cytoskele 8e-31
2cp5_A141 Restin; microtubule binding, cytoskeleton associat 2e-30
2cow_A100 Kinesin-like protein KIF13B; microtubule binding, 5e-30
2e3h_A90 Restin; CAP-Gly, cytoplasmic linker, tubulin bindi 9e-30
1whj_A102 1700024K14RIK, riken cDNA 1700024K14; structural g 1e-29
2coz_A122 CAP350, centrosome-associated protein 350; microtu 1e-29
2cp0_A95 Clipr-59 protein, clipr59; microtubule binding, cy 1e-29
2z0w_A96 CAP-Gly domain-containing linker protein 4; altern 2e-29
1whk_A91 1700024K14RIK, riken cDNA 1700024K14; structural g 3e-29
1whh_A102 Clipr-59; microtubule binding, trans-golgi network 3e-29
2cp6_A172 Restin; microtubule binding, cytoskeleton associat 9e-29
1txq_A93 Dynactin 1; protein complex, structural protein/pr 2e-28
1lpl_A95 Hypothetical 25.4 kDa protein F53F4.3 in chromosom 3e-28
2coy_A112 Dynactin-1; microtubule binding, cytoskeleton asso 1e-27
1ixd_A104 Cylindromatosis tumour-suppressor CYLD; structural 2e-24
1whg_A113 Tubulin specific chaperone B; microtubule binding, 9e-24
1whl_A95 Cylindromatosis tumor suppressor CYLD; deubiquitin 1e-19
1whm_A92 Cylindromatosis tumor suppressor CYLD; deubiquitin 6e-11
>2cp2_A CLIP-115, KIAA0291; microtubule binding, cytoskeleton associated protein, CYLN2, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.34.10.1 PDB: 2cp7_A Length = 95 Back     alignment and structure
 Score =  107 bits (270), Expect = 6e-32
 Identities = 41/82 (50%), Positives = 58/82 (70%)

Query: 10 SSQVLTEDTDSFIIGDRVYVGGTKSGRIAFIGETKFAPGDWAGVVLDDPVGKNDGQVGQA 69
          +++V  +    F++G+RV+V G K G + ++GET+FAPG WAGVVLDDPVGKNDG VG  
Sbjct: 8  AAEVGDDFLGDFVVGERVWVNGVKPGVVQYLGETQFAPGQWAGVVLDDPVGKNDGAVGGV 67

Query: 70 RYFQCEPRFGLFAPVHKVSKSP 91
          RYF+C    G+F    K+++ P
Sbjct: 68 RYFECPALQGIFTRPSKLTRQP 89
>3rdv_A CAP-Gly domain-containing linker protein 1; cytoskeletal protein, CAP Gly protein complex, structural PR; HET: BME; 1.75A {Homo sapiens} PDB: 2qk0_A Length = 72 Back     alignment and structure
>2e3i_A Restin; CAP-Gly, cytoplasmic linker, tubulin binding, structural protein; 2.00A {Homo sapiens} SCOP: b.34.10.1 Length = 86 Back     alignment and structure
>2cp3_A CLIP-115, KIAA0291; microtubule binding, cytoskeleton associated protein, CYLN2, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.34.10.1 Length = 84 Back     alignment and structure
>2cp5_A Restin; microtubule binding, cytoskeleton associated protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.34.10.1 Length = 141 Back     alignment and structure
>2cow_A Kinesin-like protein KIF13B; microtubule binding, cytoskeleton associated protein, KIAA0639, kinesin-like protein gakin, structural genomics; NMR {Homo sapiens} SCOP: b.34.10.1 Length = 100 Back     alignment and structure
>2e3h_A Restin; CAP-Gly, cytoplasmic linker, tubulin binding, structural protein; 1.45A {Homo sapiens} SCOP: b.34.10.1 PDB: 2e4h_A Length = 90 Back     alignment and structure
>1whj_A 1700024K14RIK, riken cDNA 1700024K14; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.34.10.1 Length = 102 Back     alignment and structure
>2coz_A CAP350, centrosome-associated protein 350; microtubule binding, cytoskeleton associated protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.34.10.1 Length = 122 Back     alignment and structure
>2cp0_A Clipr-59 protein, clipr59; microtubule binding, cytoskeleton associated protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.34.10.1 Length = 95 Back     alignment and structure
>2z0w_A CAP-Gly domain-containing linker protein 4; alternative splicing, ANK repeat, protein binding, structural genomics, NPPSFA; 2.50A {Homo sapiens} Length = 96 Back     alignment and structure
>1whk_A 1700024K14RIK, riken cDNA 1700024K14; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.34.10.1 Length = 91 Back     alignment and structure
>1whh_A Clipr-59; microtubule binding, trans-golgi network, structural genomics, riken structural genomics/proteomics initiative, RSGI, structural protein; NMR {Mus musculus} SCOP: b.34.10.1 Length = 102 Back     alignment and structure
>2cp6_A Restin; microtubule binding, cytoskeleton associated protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.34.10.1 Length = 172 Back     alignment and structure
>1txq_A Dynactin 1; protein complex, structural protein/protein binding complex; 1.80A {Homo sapiens} SCOP: b.34.10.1 PDB: 2hqh_A 2hkq_B 2hkn_A 2pzo_A 3e2u_A 2hl5_C 2hl3_A 3tq7_P Length = 93 Back     alignment and structure
>1lpl_A Hypothetical 25.4 kDa protein F53F4.3 in chromosome V; structural genomics, CAP-Gly domain, cytoskeleton, tubulin, PSI; 1.77A {Caenorhabditis elegans} SCOP: b.34.10.1 PDB: 1tov_A Length = 95 Back     alignment and structure
>2coy_A Dynactin-1; microtubule binding, cytoskeleton associated protein, P150- glued, DAP-150, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.34.10.1 Length = 112 Back     alignment and structure
>1ixd_A Cylindromatosis tumour-suppressor CYLD; structural genomics, riken structural genomics/proteomics initiative, RSGI, antitumor protein; NMR {Homo sapiens} SCOP: b.34.10.1 Length = 104 Back     alignment and structure
>1whg_A Tubulin specific chaperone B; microtubule binding, cytoskeleton associated protein, ckapi, structural genomics; NMR {Mus musculus} SCOP: b.34.10.1 Length = 113 Back     alignment and structure
>1whl_A Cylindromatosis tumor suppressor CYLD; deubiquitinating enzyme, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.10.1 Length = 95 Back     alignment and structure
>1whm_A Cylindromatosis tumor suppressor CYLD; deubiquitinating enzyme, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.10.1 Length = 92 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query132
2cp6_A172 Restin; microtubule binding, cytoskeleton associat 99.98
2cp2_A95 CLIP-115, KIAA0291; microtubule binding, cytoskele 99.97
3rdv_A72 CAP-Gly domain-containing linker protein 1; cytosk 99.97
2cp3_A84 CLIP-115, KIAA0291; microtubule binding, cytoskele 99.97
2cp0_A95 Clipr-59 protein, clipr59; microtubule binding, cy 99.97
1whh_A102 Clipr-59; microtubule binding, trans-golgi network 99.97
1whj_A102 1700024K14RIK, riken cDNA 1700024K14; structural g 99.97
1txq_A93 Dynactin 1; protein complex, structural protein/pr 99.97
2e3h_A90 Restin; CAP-Gly, cytoplasmic linker, tubulin bindi 99.97
2e3i_A86 Restin; CAP-Gly, cytoplasmic linker, tubulin bindi 99.97
1whk_A91 1700024K14RIK, riken cDNA 1700024K14; structural g 99.97
2z0w_A96 CAP-Gly domain-containing linker protein 4; altern 99.97
4b6m_A84 Tubulin-specific chaperone, putative; structural p 99.97
2coz_A122 CAP350, centrosome-associated protein 350; microtu 99.96
2coy_A112 Dynactin-1; microtubule binding, cytoskeleton asso 99.96
2cow_A100 Kinesin-like protein KIF13B; microtubule binding, 99.96
1whl_A95 Cylindromatosis tumor suppressor CYLD; deubiquitin 99.96
1lpl_A95 Hypothetical 25.4 kDa protein F53F4.3 in chromosom 99.96
2cp5_A141 Restin; microtubule binding, cytoskeleton associat 99.96
1ixd_A104 Cylindromatosis tumour-suppressor CYLD; structural 99.96
1whg_A113 Tubulin specific chaperone B; microtubule binding, 99.96
1whm_A92 Cylindromatosis tumor suppressor CYLD; deubiquitin 99.94
>2cp6_A Restin; microtubule binding, cytoskeleton associated protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.34.10.1 Back     alignment and structure
Probab=99.98  E-value=3.5e-32  Score=210.52  Aligned_cols=111  Identities=50%  Similarity=0.868  Sum_probs=91.7

Q ss_pred             CCCCcccccEEEECCCceEEEEEEeecCCCCCcEEEEEEcCCCCCCCcEECCEEeeecCCCCeeEEecCCeeeCCCCCCC
Q psy9801          17 DTDSFIIGDRVYVGGTKSGRIAFIGETKFAPGDWAGVVLDDPVGKNDGQVGQARYFQCEPRFGLFAPVHKVSKSPMSGTK   96 (132)
Q Consensus        17 ~~~~l~vGdRV~V~g~~~GtVRyiG~v~~~~g~wvGVELDep~GknDGt~~G~rYF~C~p~~GiFv~~~kv~~~~~~~~~   96 (132)
                      ...+|+|||||+|.+.++|+|||||++++.+|.|+|||||+|.|||||+++|+|||+|+|+||+||++++|....-+..+
T Consensus        35 ~~~~l~VG~RV~V~g~~~GtVRyvG~v~~~~G~WvGVELDeP~GKnDGsv~G~rYF~C~p~~GiFVr~~kV~~~dfP~~~  114 (172)
T 2cp6_A           35 GERELKIGDRVLVGGTKAGVVRFLGETDFAKGEWCGVELDEPLGKNDGAVAGTRYFQCQPKYGLFAPVHKVTKIGFPSTT  114 (172)
T ss_dssp             CSSCCCSSCEEEETTTEEEEEEEEEECSSSSSEEEEEEESSSCCSBSSEETTEECCCCCTTTEEEEEGGGCEECCCSSCC
T ss_pred             CCccCccCCEEEECCCceEEEEEeCcCCCCCCcEEEEEecCCCCccCCEECCEEeeeeCCCeEEEechHHeEECCcCCCC
Confidence            45689999999999888999999999999999999999999999999999999999999999999999999986433211


Q ss_pred             c----------ccceeeCCCCCCCCcccccccccceeeeee
Q psy9801          97 R----------LSCAVHHGLRRSGSRESITSNFSNVTTTSV  127 (132)
Q Consensus        97 ~----------~~~~~~~~~~r~~~~~~~~~~~~~~~~~s~  127 (132)
                      +          ....+++...|++|.++.+|-++..|+.+.
T Consensus       115 p~~~~~~~~~~~~~~~~~~~~rs~s~~s~ss~~s~~ss~~~  155 (172)
T 2cp6_A          115 PAKAKANAVRRVMATTSASLKRSPSASSLSSMSSVASSVSS  155 (172)
T ss_dssp             SCCCCCCSSSSCCCCCCCSCSSCSSCCCSSCCCCCCCCCCC
T ss_pred             ccccccccccccccccccccccCCCcCcccccccccccCCC
Confidence            1          122345677898888887776666555443
>2cp2_A CLIP-115, KIAA0291; microtubule binding, cytoskeleton associated protein, CYLN2, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.34.10.1 PDB: 2cp7_A Back     alignment and structure
>3rdv_A CAP-Gly domain-containing linker protein 1; cytoskeletal protein, CAP Gly protein complex, structural PR; HET: BME; 1.75A {Homo sapiens} PDB: 2qk0_A Back     alignment and structure
>2cp3_A CLIP-115, KIAA0291; microtubule binding, cytoskeleton associated protein, CYLN2, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.34.10.1 Back     alignment and structure
>2cp0_A Clipr-59 protein, clipr59; microtubule binding, cytoskeleton associated protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.34.10.1 Back     alignment and structure
>1whh_A Clipr-59; microtubule binding, trans-golgi network, structural genomics, riken structural genomics/proteomics initiative, RSGI, structural protein; NMR {Mus musculus} SCOP: b.34.10.1 Back     alignment and structure
>1whj_A 1700024K14RIK, riken cDNA 1700024K14; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.34.10.1 Back     alignment and structure
>1txq_A Dynactin 1; protein complex, structural protein/protein binding complex; 1.80A {Homo sapiens} SCOP: b.34.10.1 PDB: 2hqh_A 2hkq_B 2hkn_A 2pzo_A 3e2u_A 2hl5_C 2hl3_A 3tq7_P Back     alignment and structure
>2e3h_A Restin; CAP-Gly, cytoplasmic linker, tubulin binding, structural protein; 1.45A {Homo sapiens} SCOP: b.34.10.1 PDB: 2e4h_A Back     alignment and structure
>2e3i_A Restin; CAP-Gly, cytoplasmic linker, tubulin binding, structural protein; 2.00A {Homo sapiens} SCOP: b.34.10.1 Back     alignment and structure
>1whk_A 1700024K14RIK, riken cDNA 1700024K14; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.34.10.1 Back     alignment and structure
>2z0w_A CAP-Gly domain-containing linker protein 4; alternative splicing, ANK repeat, protein binding, structural genomics, NPPSFA; 2.50A {Homo sapiens} Back     alignment and structure
>4b6m_A Tubulin-specific chaperone, putative; structural protein; 1.59A {Trypanosoma brucei} Back     alignment and structure
>2coz_A CAP350, centrosome-associated protein 350; microtubule binding, cytoskeleton associated protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.34.10.1 Back     alignment and structure
>2coy_A Dynactin-1; microtubule binding, cytoskeleton associated protein, P150- glued, DAP-150, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.34.10.1 Back     alignment and structure
>2cow_A Kinesin-like protein KIF13B; microtubule binding, cytoskeleton associated protein, KIAA0639, kinesin-like protein gakin, structural genomics; NMR {Homo sapiens} SCOP: b.34.10.1 Back     alignment and structure
>1whl_A Cylindromatosis tumor suppressor CYLD; deubiquitinating enzyme, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.10.1 Back     alignment and structure
>1lpl_A Hypothetical 25.4 kDa protein F53F4.3 in chromosome V; structural genomics, CAP-Gly domain, cytoskeleton, tubulin, PSI; 1.77A {Caenorhabditis elegans} SCOP: b.34.10.1 PDB: 1tov_A Back     alignment and structure
>2cp5_A Restin; microtubule binding, cytoskeleton associated protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.34.10.1 Back     alignment and structure
>1ixd_A Cylindromatosis tumour-suppressor CYLD; structural genomics, riken structural genomics/proteomics initiative, RSGI, antitumor protein; NMR {Homo sapiens} SCOP: b.34.10.1 Back     alignment and structure
>1whg_A Tubulin specific chaperone B; microtubule binding, cytoskeleton associated protein, ckapi, structural genomics; NMR {Mus musculus} SCOP: b.34.10.1 Back     alignment and structure
>1whm_A Cylindromatosis tumor suppressor CYLD; deubiquitinating enzyme, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.10.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 132
d2coza1109 b.34.10.1 (A:8-116) Centrosome-associated protein 2e-29
d2e3ia171 b.34.10.1 (A:58-128) Restin {Human (Homo sapiens) 2e-27
d1tova_98 b.34.10.1 (A:) Cytoskeleton-associated protein F53 3e-26
d2e3ha171 b.34.10.1 (A:212-282) CLIP-115 {Human (Homo sapien 3e-26
d2cowa188 b.34.10.1 (A:7-94) Kinesin-like protein kif13b {Hu 3e-26
d1whha_102 b.34.10.1 (A:) CLIP170-related 59kda protein CLIPR 4e-26
d2cp0a183 b.34.10.1 (A:7-89) CLIP170-related 59kda protein C 5e-26
d1whja_102 b.34.10.1 (A:) Restin-like protein 2, Rsnl2 {Mouse 4e-25
d2cp6a1160 b.34.10.1 (A:8-167) Restin {Human (Homo sapiens) [ 3e-24
d1whka_91 b.34.10.1 (A:) Restin-like protein 2, Rsnl2 {Mouse 8e-24
d1ixda_104 b.34.10.1 (A:) Cylindromatosis tumour-suppressor C 6e-23
d2hqha172 b.34.10.1 (A:26-97) Dynactin 1 {Human (Homo sapien 1e-22
d1whga_113 b.34.10.1 (A:) Tubulin-specific chaperone B (SKAP1 1e-21
d1whma_92 b.34.10.1 (A:) Cylindromatosis tumour-suppressor C 3e-18
d1whla_95 b.34.10.1 (A:) Cylindromatosis tumour-suppressor C 1e-16
>d2coza1 b.34.10.1 (A:8-116) Centrosome-associated protein 350 {Human (Homo sapiens) [TaxId: 9606]} Length = 109 Back     information, alignment and structure

class: All beta proteins
fold: SH3-like barrel
superfamily: Cap-Gly domain
family: Cap-Gly domain
domain: Centrosome-associated protein 350
species: Human (Homo sapiens) [TaxId: 9606]

 Score =  101 bits (252), Expect = 2e-29
 Identities = 36/82 (43%), Positives = 48/82 (58%)

Query: 10 SSQVLTEDTDSFIIGDRVYVGGTKSGRIAFIGETKFAPGDWAGVVLDDPVGKNDGQVGQA 69
          +S    ++   F IGDRV +G  + G + F GET FA G WAGV LD P G N+G     
Sbjct: 14 ASVPTADELFDFHIGDRVLIGNVQPGILRFKGETSFAKGFWAGVELDKPEGNNNGTYDGI 73

Query: 70 RYFQCEPRFGLFAPVHKVSKSP 91
           YF+C+ + G+FAP  K+S  P
Sbjct: 74 AYFECKEKHGIFAPPQKISHIP 95
>d2e3ia1 b.34.10.1 (A:58-128) Restin {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d1tova_ b.34.10.1 (A:) Cytoskeleton-associated protein F53F4.3 {Caenorhabditis elegans [TaxId: 6239]} Length = 98 Back     information, alignment and structure
>d2e3ha1 b.34.10.1 (A:212-282) CLIP-115 {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d2cowa1 b.34.10.1 (A:7-94) Kinesin-like protein kif13b {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1whha_ b.34.10.1 (A:) CLIP170-related 59kda protein CLIPR-59 (1500005P14Rik) {Mouse (Mus musculus) [TaxId: 10090]} Length = 102 Back     information, alignment and structure
>d2cp0a1 b.34.10.1 (A:7-89) CLIP170-related 59kda protein CLIPR-59 (1500005P14Rik) {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d1whja_ b.34.10.1 (A:) Restin-like protein 2, Rsnl2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 102 Back     information, alignment and structure
>d2cp6a1 b.34.10.1 (A:8-167) Restin {Human (Homo sapiens) [TaxId: 9606]} Length = 160 Back     information, alignment and structure
>d1whka_ b.34.10.1 (A:) Restin-like protein 2, Rsnl2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 91 Back     information, alignment and structure
>d1ixda_ b.34.10.1 (A:) Cylindromatosis tumour-suppressor Cyld {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d2hqha1 b.34.10.1 (A:26-97) Dynactin 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 72 Back     information, alignment and structure
>d1whga_ b.34.10.1 (A:) Tubulin-specific chaperone B (SKAP1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 113 Back     information, alignment and structure
>d1whma_ b.34.10.1 (A:) Cylindromatosis tumour-suppressor Cyld {Human (Homo sapiens) [TaxId: 9606]} Length = 92 Back     information, alignment and structure
>d1whla_ b.34.10.1 (A:) Cylindromatosis tumour-suppressor Cyld {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query132
d2cp6a1160 Restin {Human (Homo sapiens) [TaxId: 9606]} 99.97
d2e3ha171 CLIP-115 {Human (Homo sapiens) [TaxId: 9606]} 99.97
d2cp0a183 CLIP170-related 59kda protein CLIPR-59 (1500005P14 99.97
d2e3ia171 Restin {Human (Homo sapiens) [TaxId: 9606]} 99.97
d1whja_102 Restin-like protein 2, Rsnl2 {Mouse (Mus musculus) 99.97
d2coza1109 Centrosome-associated protein 350 {Human (Homo sap 99.97
d2cowa188 Kinesin-like protein kif13b {Human (Homo sapiens) 99.97
d1whha_102 CLIP170-related 59kda protein CLIPR-59 (1500005P14 99.97
d2hqha172 Dynactin 1 {Human (Homo sapiens) [TaxId: 9606]} 99.97
d1whka_91 Restin-like protein 2, Rsnl2 {Mouse (Mus musculus) 99.97
d1ixda_104 Cylindromatosis tumour-suppressor Cyld {Human (Hom 99.96
d1tova_98 Cytoskeleton-associated protein F53F4.3 {Caenorhab 99.96
d1whga_113 Tubulin-specific chaperone B (SKAP1) {Mouse (Mus m 99.95
d1whla_95 Cylindromatosis tumour-suppressor Cyld {Human (Hom 99.95
d1whma_92 Cylindromatosis tumour-suppressor Cyld {Human (Hom 99.94
>d2cp6a1 b.34.10.1 (A:8-167) Restin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All beta proteins
fold: SH3-like barrel
superfamily: Cap-Gly domain
family: Cap-Gly domain
domain: Restin
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.97  E-value=5.3e-32  Score=204.77  Aligned_cols=77  Identities=60%  Similarity=1.146  Sum_probs=72.6

Q ss_pred             cCCCCcccccEEEECCCceEEEEEEeecCCCCCcEEEEEEcCCCCCCCcEECCEEeeecCCCCeeEEecCCeeeCCC
Q psy9801          16 EDTDSFIIGDRVYVGGTKSGRIAFIGETKFAPGDWAGVVLDDPVGKNDGQVGQARYFQCEPRFGLFAPVHKVSKSPM   92 (132)
Q Consensus        16 ~~~~~l~vGdRV~V~g~~~GtVRyiG~v~~~~g~wvGVELDep~GknDGt~~G~rYF~C~p~~GiFv~~~kv~~~~~   92 (132)
                      ....+|+|||||.|.+...|+|||||++++++|.|+|||||+|.|||||+|+|+|||+|+|+||+||++++|.++..
T Consensus        27 ~~~~~~~vGdrV~v~g~~~G~vr~iG~~~~~~G~wvGVELd~p~GKNdGsv~G~~YF~c~~~~G~Fv~~s~v~~~~~  103 (160)
T d2cp6a1          27 KGERELKIGDRVLVGGTKAGVVRFLGETDFAKGEWCGVELDEPLGKNDGAVAGTRYFQCQPKYGLFAPVHKVTKIGF  103 (160)
T ss_dssp             CCSSCCCSSCEEEETTTEEEEEEEEEECSSSSSEEEEEEESSSCCSBSSEETTEECCCCCTTTEEEEEGGGCEECCC
T ss_pred             ccCCCCccCCEEEECCCCeEEEEEecccCCCCCCEEEEEeCCCCCCCCCEECCEEeeecCCCceEEecHhHceEcCC
Confidence            34568999999999988899999999999999999999999999999999999999999999999999999998754
>d2e3ha1 b.34.10.1 (A:212-282) CLIP-115 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cp0a1 b.34.10.1 (A:7-89) CLIP170-related 59kda protein CLIPR-59 (1500005P14Rik) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2e3ia1 b.34.10.1 (A:58-128) Restin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whja_ b.34.10.1 (A:) Restin-like protein 2, Rsnl2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2coza1 b.34.10.1 (A:8-116) Centrosome-associated protein 350 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cowa1 b.34.10.1 (A:7-94) Kinesin-like protein kif13b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whha_ b.34.10.1 (A:) CLIP170-related 59kda protein CLIPR-59 (1500005P14Rik) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2hqha1 b.34.10.1 (A:26-97) Dynactin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whka_ b.34.10.1 (A:) Restin-like protein 2, Rsnl2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ixda_ b.34.10.1 (A:) Cylindromatosis tumour-suppressor Cyld {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tova_ b.34.10.1 (A:) Cytoskeleton-associated protein F53F4.3 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1whga_ b.34.10.1 (A:) Tubulin-specific chaperone B (SKAP1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1whla_ b.34.10.1 (A:) Cylindromatosis tumour-suppressor Cyld {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whma_ b.34.10.1 (A:) Cylindromatosis tumour-suppressor Cyld {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure