Diaphorina citri psyllid: psy9815


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------12
AHPDWKDSDIIANLVGYCSDQAHSSVERAGLLGGVTIRGLPADDSYKLRGDALEAAIEEDLKKGKIPFYVNQAHSSVERAGLLGGVTIRGLPADDSYKLRGDALEAAIEEDLKKGKIPF
cccccccccccccEEEEEcccccHHHHHHHHHccccEEECcccccccccHHHHHHHHHHHHHcccccEEECccccccccccccccccccEECcccccccccHHHHHHHHHHHHcccccc
*HPDWKDSDIIANLVGYCSDQAHSSVERAGLLGGVTIRGLPADDSYKLRGDALEAAIEEDLKKGKIPFYVNQAHSSVERAGLLGGVTIRGLPADDSYKLRGDALEAAIEEDLKKGKIPF
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
AHPDWKDSDIIANLVGYCSDQAHSSVERAGLLGGVTIRGLPADDSYKLRGDALEAAIEEDLKKGKIPFYVNQAHSSVERAGLLGGVTIRGLPADDSYKLRGDALEAAIEEDLKKGKIPF

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Histidine decarboxylase confidentP16453
Histidine decarboxylase confidentP19113
Aromatic-L-amino-acid decarboxylase Catalyzes the decarboxylation of L-3,4-dihydroxyphenylalanine (DOPA) to dopamine, L-5-hydroxytryptophan to serotonin and L-tryptophan to tryptamine. Variation in the synthesis of bioamines may be a factor contributing to natural variation in life span.confidentP05031

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0007615 [BP]anesthesia-resistant memoryprobableGO:0032501, GO:0044707, GO:0044708, GO:0050896, GO:0050890, GO:0007613, GO:0007610, GO:0007611, GO:0008150, GO:0050877, GO:0044699, GO:0003008
GO:0006547 [BP]histidine metabolic processprobableGO:0044238, GO:0044710, GO:0009987, GO:1901564, GO:0006082, GO:0006520, GO:0006725, GO:0034641, GO:0044237, GO:0044281, GO:0071704, GO:0052803, GO:0006807, GO:0008150, GO:0019752, GO:0008152, GO:0043436, GO:1901605, GO:1901360, GO:0046483
GO:0015842 [BP]synaptic vesicle amine transportprobableGO:0019226, GO:0035637, GO:0007268, GO:0032501, GO:0023052, GO:0015837, GO:0051656, GO:0051650, GO:0044699, GO:0048489, GO:0071705, GO:0051640, GO:0071702, GO:0097479, GO:0051641, GO:0009987, GO:0050877, GO:0006810, GO:0044765, GO:0008150, GO:0051648, GO:0051649, GO:0007267, GO:0007154, GO:0051234, GO:0051179, GO:0097480, GO:0003008, GO:0044700, GO:0016192, GO:0044707, GO:0044763
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0001692 [BP]histamine metabolic processprobableGO:1901564, GO:0009308, GO:0006576, GO:0071704, GO:0009987, GO:0006725, GO:0034641, GO:0044237, GO:0044106, GO:0052803, GO:0006807, GO:0008150, GO:0008152, GO:1901360, GO:0046483
GO:0042427 [BP]serotonin biosynthetic processprobableGO:0044249, GO:0034641, GO:0006807, GO:0042428, GO:1901362, GO:1901360, GO:1901576, GO:0071704, GO:1901160, GO:1901162, GO:0018130, GO:0009987, GO:0006725, GO:0009058, GO:0008150, GO:0008152, GO:0042435, GO:1901564, GO:0042430, GO:0046483, GO:0044271, GO:1901566, GO:0044237, GO:0019438
GO:0016597 [MF]amino acid bindingprobableGO:0043168, GO:0003674, GO:0031406, GO:0005488, GO:0043167
GO:0043025 [CC]neuronal cell bodyprobableGO:0005575, GO:0097458, GO:0044297, GO:0005623, GO:0044464
GO:0003824 [MF]catalytic activityprobableGO:0003674
GO:0008021 [CC]synaptic vesicleprobableGO:0043227, GO:0005737, GO:0043231, GO:0016023, GO:0031410, GO:0044444, GO:0044464, GO:0031982, GO:0005623, GO:0031988, GO:0005575, GO:0043229, GO:0044456, GO:0045202, GO:0044424, GO:0005622, GO:0030135, GO:0043226, GO:0030136
GO:0042417 [BP]dopamine metabolic processprobableGO:0009987, GO:1901564, GO:0009712, GO:0006725, GO:0006584, GO:0044237, GO:0071704, GO:0006807, GO:0008150, GO:0008152, GO:0018958, GO:1901360, GO:1901615
GO:0030425 [CC]dendriteprobableGO:0044464, GO:0005623, GO:0005575, GO:0097458, GO:0043005, GO:0042995
GO:0042423 [BP]catecholamine biosynthetic processprobableGO:0044249, GO:0006807, GO:1901362, GO:1901360, GO:1901576, GO:0009713, GO:0009712, GO:0071704, GO:0046189, GO:0009987, GO:0006725, GO:0006584, GO:0009058, GO:0008150, GO:0008152, GO:0018958, GO:1901564, GO:1901566, GO:0044237, GO:0019438, GO:1901617, GO:1901615
GO:0030424 [CC]axonprobableGO:0044464, GO:0005623, GO:0005575, GO:0097458, GO:0043005, GO:0042995

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 4E1O, chain A
Confidence level:very confident
Coverage over the Query: 3-80
View the alignment between query and template
View the model in PyMOL
Template: 4E1O, chain A
Confidence level:very confident
Coverage over the Query: 63-119
View the alignment between query and template
View the model in PyMOL