Diaphorina citri psyllid: psy9845


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-
MISLSSRTGLFIFPNLQFQAAFREPRLLVVTDPHTDHQPITEAAYVNIPVIAFCNTESPLRFVDIAIPCNNKSPHSIGLMWWLLAREVLRFRGTIPREPKWDVVVDLFFYRDPEEAEKEEQAGKESAAAIADKPADEFAAHAPTESWNDTPILSVSCGGCWLVKFCVSEAEKEEQAGKESAAAIADKPVDEFAAHAPTESWNDTVVPSADLAPQSWAEESASIPQYAPAPQAAAAPVADDWTTPVGADDWGQDWSNSTSQW
cccccccccccccccHHHHHHcccccEEEEEccccccccHHHHHHccccEEEEEcccccccccEEEEcccccccccHHHHHHHHHHHHHHHcccccccccccccccccccccHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
*ISLSSRTGLFIFPNLQFQAAFREPRLLVVTDPHTDHQPITEAAYVNIPVIAFCNTESPLRFVDIAIPCNNKSPHSIGLMWWLLAREVLRFRGTIPREPKWDVVVDLFFYRD*****************IADKPADEFAAHAPTESWNDTPILSVSCGGCWLVKFCVSE*************AIADKPVDEFAAHAPTESWNDTVVPSADLAPQSWAEESASIPQ************ADDWTTPVGADDWGQDWSN*****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MISLSSRTGLFIFPNLQFQAAFREPRLLVVTDPHTDHQPITEAAYVNIPVIAFCNTESPLRFVDIAIPCNNKSPHSIGLMWWLLAREVLRFRGTIPREPKWDVVVDLFFYRDPEEAEKEEQAGKESAAAIADKPADEFAAHAPTESWNDTPILSVSCGGCWLVKFCVSEAEKEEQAGKESAAAIADKPVDEFAAHAPTESWNDTVVPSADLAPQSWAEESASIPQYAPAPQAAAAPVADDWTTPVGADDWGQDWSNSTSQW

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
40S ribosomal protein SA Required for the assembly and/or stability of the 40S ribosomal subunit. Required for the processing of the 20S rRNA-precursor to mature 18S rRNA in a late step of the maturation of 40S ribosomal subunits. Also functions as a cell surface receptor for laminin. Plays a role in cell adhesion to the basement membrane and in the consequent activation of signaling transduction pathways. May play a role in cell fate determination and tissue morphogenesis.confidentQ803F6
40S ribosomal protein SA Required for the assembly and/or stability of the 40S ribosomal subunit. Required for the processing of the 20S rRNA-precursor to mature 18S rRNA in a late step of the maturation of 40S ribosomal subunits. Also functions as a cell surface receptor for laminin. Plays a role in cell adhesion to the basement membrane and in the consequent activation of signaling transduction pathways. May play a role in cell fate determination and tissue morphogenesis.confidentB5FXT6
40S ribosomal protein SA Required for the assembly and/or stability of the 40S ribosomal subunit. Required for the processing of the 20S rRNA-precursor to mature 18S rRNA in a late step of the maturation of 40S ribosomal subunits.confidentQ7PZ81

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0022626 [CC]cytosolic ribosomeprobableGO:0005737, GO:0032991, GO:0005840, GO:0043232, GO:0005829, GO:0044464, GO:0043229, GO:0005623, GO:0030529, GO:0005575, GO:0044444, GO:0044445, GO:0044424, GO:0043228, GO:0005622, GO:0043226
GO:0003735 [MF]structural constituent of ribosomeprobableGO:0003674, GO:0005198
GO:0015935 [CC]small ribosomal subunitprobableGO:0005737, GO:0005575, GO:0005622, GO:0032991, GO:0005840, GO:0043232, GO:0044464, GO:0043229, GO:0005623, GO:0030529, GO:0044446, GO:0044444, GO:0043228, GO:0044424, GO:0044391, GO:0043226, GO:0044422
GO:0042256 [BP]mature ribosome assemblyprobableGO:0006996, GO:0071826, GO:0022607, GO:0043933, GO:0009987, GO:0042255, GO:0042254, GO:0016043, GO:0065003, GO:0022618, GO:0044763, GO:0071840, GO:0034622, GO:0022613, GO:0008150, GO:0070925, GO:0044699, GO:0044085
GO:0045335 [CC]phagocytic vesicleprobableGO:0005737, GO:0005575, GO:0043231, GO:0016023, GO:0031410, GO:0044464, GO:0044444, GO:0005623, GO:0031988, GO:0030139, GO:0043229, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0031982
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623
GO:0009506 [CC]plasmodesmaprobableGO:0055044, GO:0005575, GO:0030054, GO:0005911
GO:0009507 [CC]chloroplastprobableGO:0005737, GO:0009536, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0006412 [BP]translationprobableGO:0071704, GO:0044267, GO:0008152, GO:0044260, GO:0044238, GO:0019538, GO:0009987, GO:0009058, GO:0044237, GO:0043170, GO:0044249, GO:0010467, GO:0009059, GO:0008150, GO:0034645, GO:1901576

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2ZKQ, chain b
Confidence level:very confident
Coverage over the Query: 4-111
View the alignment between query and template
View the model in PyMOL