Diaphorina citri psyllid: psy9852


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-
MFAFDAIFSDEPQSEICTSALSDVIQAVISGSDGCLFCFGHARLGKSYTMVGSPQSSATLGVIPSAISWLFRCISEQKHKTGARFSVRASAIEISSSSQHVKDLLSTYSNGKFFRLCFLKRFHAEEDEEMPCPVPPPLHSNLLTLSRDSLISNKRNDNSSLYSNSNERLHDPGGTGSIKSFRNFGFGSGIQYCKNDLETLEQYCKNDFNQSTWRNDRLEQLKREKRALLIELAATKTHLSQ
cccccccccccccHHHHHHHHHHHHHHHHccccEEEEccccccccccccccccccccccccccHHHHHHHHHHHHHcccccccEEEEEEEEEEEccccccccccccccccccCEEEEccccEEEccccEEEccccHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccEEEECccccccccEEEccEEEEEccccccccccccccHHHHHHHHHHHHHHHHHHcccccccc
MFAFDAIFSDEPQSEICTSALSDVIQAVISGSDGCLFCFGHARLGKSYTMVGSPQSSATLGVIPSAISWLFRCISEQKHKTGARFSVRASAIEISSSSQHVKDLLSTYSNGKFFRLCFLKRFHAEEDEEMPCPVPPPLHSNLLTLSRD*******************RLHDPGGTGSIKSFRNFGFGSGIQYCKNDLETLEQYCKNDFNQSTWRNDRLEQLKREKRALLIELA********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFAFDAIFSDEPQSEICTSALSDVIQAVISGSDGCLFCFGHARLGKSYTMVGSPQSSATLGVIPSAISWLFRCISEQKHKTGARFSVRASAIEISSSSQHVKDLLSTYSNGKFFRLCFLKRFHAEEDEEMPCPVPPPLHSNLLTLSRDSLISNKRNDNSSLYSNSNERLHDPGGTGSIKSFRNFGFGSGIQYCKNDLETLEQYCKNDFNQSTWRNDRxxxxxxxxxxxxxxxxxxxxxLSQ

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Kinesin-like protein KIF26B Essential for embryonic kidney development. Plays an important role in the compact adhesion between mesenchymal cells adjacent to the ureteric buds, possibly by interacting with MYH10. This could lead to the establishment of the basolateral integrity of the mesenchyme and the polarized expression of ITGA8, which maintains the GDNF expression required for further ureteric bud attraction.confidentQ2KJY2
Kinesin-like protein KIF26B Essential for embryonic kidney development. Plays an important role in the compact adhesion between mesenchymal cells adjacent to the ureteric buds, possibly by interacting with MYH10. This could lead to the establishment of the basolateral integrity of the mesenchyme and the polarized expression of ITGA8, which maintains the GDNF expression required for further ureteric bud attraction.confidentQ7TNC6

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005871 [CC]kinesin complexprobableGO:0043234, GO:0005856, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0043226, GO:0044446, GO:0043229, GO:0044430, GO:0044424, GO:0043228, GO:0005622, GO:0005875, GO:0044422
GO:0005876 [CC]spindle microtubuleprobableGO:0043234, GO:0005856, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0005819, GO:0044430, GO:0044424, GO:0043228, GO:0005874, GO:0043226, GO:0044422
GO:0005929 [CC]ciliumprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0042995, GO:0043227, GO:0043226
GO:0016887 [MF]ATPase activityprobableGO:0016787, GO:0016818, GO:0003824, GO:0017111, GO:0016817, GO:0016462, GO:0003674
GO:0005813 [CC]centrosomeprobableGO:0005856, GO:0005575, GO:0015630, GO:0043232, GO:0044464, GO:0005623, GO:0005815, GO:0044446, GO:0043229, GO:0043228, GO:0044430, GO:0044424, GO:0005622, GO:0043226, GO:0044422
GO:0044707 [BP]single-multicellular organism processprobableGO:0032501, GO:0008150, GO:0044699
GO:0043005 [CC]neuron projectionprobableGO:0005575, GO:0097458, GO:0042995, GO:0044464, GO:0005623
GO:0008574 [MF]plus-end-directed microtubule motor activityprobableGO:0016787, GO:0016818, GO:0003824, GO:0016817, GO:0017111, GO:0016462, GO:0003674, GO:0003774, GO:0003777
GO:0008017 [MF]microtubule bindingprobableGO:0015631, GO:0003674, GO:0005488, GO:0005515, GO:0008092
GO:0005881 [CC]cytoplasmic microtubuleprobableGO:0005737, GO:0043234, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0005856, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0044446, GO:0044444, GO:0044430, GO:0044424, GO:0043228, GO:0005874, GO:0043226, GO:0044422
GO:0007018 [BP]microtubule-based movementprobableGO:0007017, GO:0009987, GO:0006928, GO:0008150, GO:0044763, GO:0044699

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2WBE, chain C
Confidence level:very confident
Coverage over the Query: 1-200,215-228
View the alignment between query and template
View the model in PyMOL