Psyllid ID: psy9852


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-
MFAFDAIFSDEPQSEICTSALSDVIQAVISGSDGCLFCFGHARLGKSYTMVGSPQSSATLGVIPSAISWLFRCISEQKHKTGARFSVRASAIEISSSSQHVKDLLSTYSNGKFFRLCFLKRFHAEEDEEMPCPVPPPLHSNLLTLSRDSLISNKRNDNSSLYSNSNERLHDPGGTGSIKSFRNFGFGSGIQYCKNDLETLEQYCKNDFNQSTWRNDRLEQLKREKRALLIELAATKTHLSQ
cccccccccccccHHHHHHHHHHHHHHHHccccEEEEccccccccccccccccccccccccccHHHHHHHHHHHHHcccccccEEEEEEEEEEEccccccccccccccccccEEEEEccccEEEccccEEEcccHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccEEEEEccccccccEEEccEEEEEccccccccccccccHHHHHHHHHHHHHHHHHHcccccccc
cccccccccccHHHHHHHHHHHHHHHHHHccccEEEEEEccccccccEcccccccccccccccHHHHHHHHHHHHHcccccccEEEEEEEEEEEEccHHHHHHHHccccccccEEccccccEEEccccEEEEEccHHHHHHHccccccEEEEEcccccccEEEEEEEEcccccccccHHHHHccccccccHHcHccccHHHHHccHHHHcccccccHHHHHHHHHHHHHHHHHHHcccccc
mfafdaifsdepqseiCTSALSDVIQAVIsgsdgclfcfgharlgksytmvgspqssatlgviPSAISWLFRCISEqkhktgarfsvRASAIEISSSSQHVKDLLStysngkffRLCFLKRfhaeedeempcpvppplhsnlltlsrdslisnkrndnsslysnsnerlhdpggtgsiksfrnfgfgsgiQYCKNDLETLEQYCKndfnqstwRNDRLEQLKREKRALLIELAATKTHLSQ
mfafdaifsdepqSEICTSALSDVIQAVISGSDGCLFCFGHARLGKSYTMVGSPQSSATLGVIPSAISWLFRCISEQKHKTGARFSVRASAIEISSSSQHVKDLLSTYSNGKFFRLCFLKRFHAEEDEEMPCPVPPPLHSNLLTLSRDSLISNkrndnsslysnsnerlhdpgGTGSIKSFRNFGFGSGIQYCKNDLETLEQYCKNdfnqstwrnDRLEQLKREKRALLIELaatkthlsq
MFAFDAIFSDEPQSEICTSALSDVIQAVISGSDGCLFCFGHARLGKSYTMVGSPQSSATLGVIPSAISWLFRCISEQKHKTGARFSVRASAIEISSSSQHVKDLLSTYSNGKFFRLCFLKRFHAEEDEEMPCPVPPPLHSNLLTLSRDSLISNKRNDNSSLYSNSNERLHDPGGTGSIKSFRNFGFGSGIQYCKNDLETLEQYCKNDFNQSTWRNDRLEQLKREKRALLIELAATKTHLSQ
**************EICTSALSDVIQAVISGSDGCLFCFGHARLGKSYTMVGSPQSSATLGVIPSAISWLFRCISEQKHKTGARFSVRASAIEI*****HVKDLLSTYSNGKFFRLCFLKRFHA*****************************************************IKSFRNFGFGSGIQYCKNDLETLEQYCKNDFNQSTWRNDRLEQL****RALLIEL*********
MFAFDAIFSDEPQSEICTSALSDVIQAVISGSDGCLFCFGHARLGKSYTMVGSPQSSATLGVIPSAISWLFRCISEQKHKTGARFSVRASAIEISSSSQHVKDLLST*************RFHAEEDEEMPCPVPPPLHSNLLTLSRD*******************RLHDPGGTGSIK*************CKNDLETLEQYCKNDF***********QLKREKRALLIELA********
MFAFDAIFSDEPQSEICTSALSDVIQAVISGSDGCLFCFGHARLGKSYTMVGSPQSSATLGVIPSAISWLFRCISEQKHKTGARFSVRASAIEISSSSQHVKDLLSTYSNGKFFRLCFLKRFHAEEDEEMPCPVPPPLHSNLLTLSRDSLISNKRNDNSSLYSNSNERLHDPGGTGSIKSFRNFGFGSGIQYCKNDLETLEQYCKNDFNQSTWRNDRLEQLKREKRALLIELAATKTHLSQ
MFAFDAIFSDEPQSEICTSALSDVIQAVISGSDGCLFCFGHARLGKSYTMVGSPQSSATLGVIPSAISWLFRCISEQKHKTGARFSVRASAIEISSSSQHVKDLLSTYSNGKFFRLCFLKRFHAEEDEEMPCPVPPPLHSNLLTLSRDSLISNKRNDNSSLYSNSNERLHDPGGTGSIKSFRNFGFGSGIQYCKNDLETLEQYCKNDFNQSTWRNDRLEQLKREKRALLIELAATK*****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFAFDAIFSDEPQSEICTSALSDVIQAVISGSDGCLFCFGHARLGKSYTMVGSPQSSATLGVIPSAISWLFRCISEQKHKTGARFSVRASAIEISSSSQHVKDLLSTYSNGKFFRLCFLKRFHAEEDEEMPCPVPPPLHSNLLTLSRDSLISNKRNDNSSLYSNSNERLHDPGGTGSIKSFRNFGFGSGIQYCKNDLETLEQYCKNDFNQSTWRNDRxxxxxxxxxxxxxxxxxxxxxLSQ
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query241 2.2.26 [Sep-21-2011]
Q2KJY2 2108 Kinesin-like protein KIF2 yes N/A 0.468 0.053 0.561 1e-34
Q7TNC6 2112 Kinesin-like protein KIF2 yes N/A 0.468 0.053 0.561 2e-34
Q9ULI4 1882 Kinesin-like protein KIF2 no N/A 0.468 0.060 0.526 1e-31
Q52KG5 1881 Kinesin-like protein KIF2 no N/A 0.468 0.060 0.526 4e-31
Q9VLW2 1131 Kinesin-like protein CG14 yes N/A 0.493 0.105 0.4 2e-20
Q29MB2 1171 Kinesin-like protein GA13 yes N/A 0.493 0.101 0.380 1e-19
Q6RZZ9 1265 Kinesin-related protein 1 yes N/A 0.369 0.070 0.351 4e-12
Q9HAQ2 790 Kinesin-like protein KIF9 no N/A 0.419 0.127 0.320 5e-11
Q07970793 Kinesin-1 OS=Arabidopsis yes N/A 0.427 0.129 0.311 7e-11
F4JGP4790 Kinesin-5 OS=Arabidopsis no N/A 0.427 0.130 0.311 1e-10
>sp|Q2KJY2|KI26B_HUMAN Kinesin-like protein KIF26B OS=Homo sapiens GN=KIF26B PE=2 SV=1 Back     alignment and function desciption
 Score =  146 bits (369), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 64/114 (56%), Positives = 88/114 (77%), Gaps = 1/114 (0%)

Query: 1   MFAFDAIFS-DEPQSEICTSALSDVIQAVISGSDGCLFCFGHARLGKSYTMVGSPQSSAT 59
           MFAFDA+F  D  Q+E+C   +++VIQ+V++G+DGC+FCFGHA+LGKSYTM+G   S   
Sbjct: 506 MFAFDAVFPQDASQAEVCAGTVAEVIQSVVNGADGCVFCFGHAKLGKSYTMIGKDDSMQN 565

Query: 60  LGVIPSAISWLFRCISEQKHKTGARFSVRASAIEISSSSQHVKDLLSTYSNGKF 113
           LG+IP AISWLF+ I+E+K KTGARFSVR SA+E+    ++++DLLS  + G  
Sbjct: 566 LGIIPCAISWLFKLINERKEKTGARFSVRVSAVEVWGKEENLRDLLSEVATGSL 619




Essential for embryonic kidney development. Plays an important role in the compact adhesion between mesenchymal cells adjacent to the ureteric buds, possibly by interacting with MYH10. This could lead to the establishment of the basolateral integrity of the mesenchyme and the polarized expression of ITGA8, which maintains the GDNF expression required for further ureteric bud attraction.
Homo sapiens (taxid: 9606)
>sp|Q7TNC6|KI26B_MOUSE Kinesin-like protein KIF26B OS=Mus musculus GN=Kif26b PE=1 SV=3 Back     alignment and function description
>sp|Q9ULI4|KI26A_HUMAN Kinesin-like protein KIF26A OS=Homo sapiens GN=KIF26A PE=2 SV=3 Back     alignment and function description
>sp|Q52KG5|KI26A_MOUSE Kinesin-like protein KIF26A OS=Mus musculus GN=Kif26a PE=1 SV=2 Back     alignment and function description
>sp|Q9VLW2|KI26L_DROME Kinesin-like protein CG14535 OS=Drosophila melanogaster GN=CG14535 PE=2 SV=2 Back     alignment and function description
>sp|Q29MB2|KI26L_DROPS Kinesin-like protein GA13060 OS=Drosophila pseudoobscura pseudoobscura GN=GA13060 PE=3 SV=3 Back     alignment and function description
>sp|Q6RZZ9|KIF13_DICDI Kinesin-related protein 13 OS=Dictyostelium discoideum GN=kif13 PE=1 SV=1 Back     alignment and function description
>sp|Q9HAQ2|KIF9_HUMAN Kinesin-like protein KIF9 OS=Homo sapiens GN=KIF9 PE=1 SV=4 Back     alignment and function description
>sp|Q07970|ATK1_ARATH Kinesin-1 OS=Arabidopsis thaliana GN=ATK1 PE=2 SV=1 Back     alignment and function description
>sp|F4JGP4|ATK5_ARATH Kinesin-5 OS=Arabidopsis thaliana GN=ATK5 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query241
357616829 1126 hypothetical protein KGM_08563 [Danaus p 0.456 0.097 0.702 2e-40
189236427 1267 PREDICTED: similar to CG14535 CG14535-PA 0.456 0.086 0.666 1e-38
270005919 1041 hypothetical protein TcasGA2_TC008042 [T 0.460 0.106 0.660 2e-38
242025241 1267 conserved hypothetical protein [Pediculu 0.456 0.086 0.666 2e-38
350409135 2004 PREDICTED: hypothetical protein LOC10074 0.456 0.054 0.639 3e-37
340712748 2010 PREDICTED: hypothetical protein LOC10065 0.456 0.054 0.639 3e-37
328787856 1260 PREDICTED: kinesin 11 [Apis mellifera] 0.456 0.087 0.639 4e-37
307207471 1260 Kinesin-like protein CG14535 [Harpegnath 0.456 0.087 0.639 4e-37
383847567 1254 PREDICTED: kinesin-like protein KIF26A-l 0.456 0.087 0.639 4e-37
345485236 1276 PREDICTED: kinesin-like protein CG14535- 0.456 0.086 0.639 2e-36
>gi|357616829|gb|EHJ70430.1| hypothetical protein KGM_08563 [Danaus plexippus] Back     alignment and taxonomy information
 Score =  171 bits (434), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 78/111 (70%), Positives = 95/111 (85%), Gaps = 1/111 (0%)

Query: 1   MFAFDAIFS-DEPQSEICTSALSDVIQAVISGSDGCLFCFGHARLGKSYTMVGSPQSSAT 59
           MFAFDAIFS D+PQ+EIC+SAL+DVI AVI+G+DGCLFCFGHA LGKSYTM+G P SS+T
Sbjct: 52  MFAFDAIFSQDDPQTEICSSALTDVIHAVINGTDGCLFCFGHAGLGKSYTMLGRPDSSST 111

Query: 60  LGVIPSAISWLFRCISEQKHKTGARFSVRASAIEISSSSQHVKDLLSTYSN 110
           LG IP AISWLFR I+EQKHK G RFSVR SA+E+ +++  ++DLL+ Y N
Sbjct: 112 LGAIPCAISWLFRGIAEQKHKCGTRFSVRVSAVELCTNTNQIRDLLAPYHN 162




Source: Danaus plexippus

Species: Danaus plexippus

Genus: Danaus

Family: Nymphalidae

Order: Lepidoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|189236427|ref|XP_972268.2| PREDICTED: similar to CG14535 CG14535-PA [Tribolium castaneum] Back     alignment and taxonomy information
>gi|270005919|gb|EFA02367.1| hypothetical protein TcasGA2_TC008042 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|242025241|ref|XP_002433034.1| conserved hypothetical protein [Pediculus humanus corporis] gi|212518550|gb|EEB20296.1| conserved hypothetical protein [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|350409135|ref|XP_003488623.1| PREDICTED: hypothetical protein LOC100745168 [Bombus impatiens] Back     alignment and taxonomy information
>gi|340712748|ref|XP_003394917.1| PREDICTED: hypothetical protein LOC100651674 [Bombus terrestris] Back     alignment and taxonomy information
>gi|328787856|ref|XP_394491.4| PREDICTED: kinesin 11 [Apis mellifera] Back     alignment and taxonomy information
>gi|307207471|gb|EFN85182.1| Kinesin-like protein CG14535 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|383847567|ref|XP_003699424.1| PREDICTED: kinesin-like protein KIF26A-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|345485236|ref|XP_001599402.2| PREDICTED: kinesin-like protein CG14535-like [Nasonia vitripennis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query241
UNIPROTKB|F1NW72 1629 Gga.54622 "Uncharacterized pro 0.460 0.068 0.553 2.1e-34
UNIPROTKB|F1MNK8 1525 KIF26B "Uncharacterized protei 0.460 0.072 0.571 2.2e-34
UNIPROTKB|G3MZ58 1595 KIF26B "Uncharacterized protei 0.460 0.069 0.571 2.7e-34
UNIPROTKB|F1S8L6 1612 KIF26B "Uncharacterized protei 0.460 0.068 0.571 2.8e-34
RGD|1560022 2111 Kif26b "kinesin family member 0.460 0.052 0.571 5.2e-34
UNIPROTKB|I3LQA2 1771 KIF26B "Uncharacterized protei 0.460 0.062 0.571 5.3e-34
UNIPROTKB|B7WPD9 1727 KIF26B "Kinesin-like protein K 0.460 0.064 0.571 9.2e-33
UNIPROTKB|Q2KJY2 2108 KIF26B "Kinesin-like protein K 0.460 0.052 0.571 1.6e-32
MGI|MGI:2447076 2112 Kif26b "kinesin family member 0.460 0.052 0.571 2.6e-32
UNIPROTKB|E1C4G2 2072 E1C4G2 "Uncharacterized protei 0.460 0.053 0.571 1.9e-31
UNIPROTKB|F1NW72 Gga.54622 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
 Score = 362 (132.5 bits), Expect = 2.1e-34, Sum P(2) = 2.1e-34
 Identities = 62/112 (55%), Positives = 90/112 (80%)

Query:     1 MFAFDAIF-SDEPQSEICTSALSDVIQAVISGSDGCLFCFGHARLGKSYTMVGSPQSSAT 59
             MFAFDA+F  D  Q+E+C+  +++VIQ+V++G+DGC+FCFGH +LGKS+TM+G   S+ +
Sbjct:   117 MFAFDAVFPQDASQAEVCSGTVAEVIQSVVNGADGCIFCFGHVKLGKSFTMIGKDSSTQS 176

Query:    60 LGVIPSAISWLFRCISEQKHKTGARFSVRASAIEISSSSQHVKDLLSTYSNG 111
             LG+IP AISWLF+ I+E+K KTG RFS+R SA+EIS   +++KDLL+  + G
Sbjct:   177 LGIIPCAISWLFKLINERKEKTGTRFSIRVSAVEISGKDENLKDLLAEVATG 228


GO:0003777 "microtubule motor activity" evidence=IEA
GO:0005875 "microtubule associated complex" evidence=IEA
GO:0007018 "microtubule-based movement" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0005874 "microtubule" evidence=IEA
GO:0001560 "regulation of cell growth by extracellular stimulus" evidence=IEA
GO:0008017 "microtubule binding" evidence=IEA
GO:0009968 "negative regulation of signal transduction" evidence=IEA
GO:0048484 "enteric nervous system development" evidence=IEA
UNIPROTKB|F1MNK8 KIF26B "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|G3MZ58 KIF26B "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1S8L6 KIF26B "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
RGD|1560022 Kif26b "kinesin family member 26B" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|I3LQA2 KIF26B "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|B7WPD9 KIF26B "Kinesin-like protein KIF26B" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q2KJY2 KIF26B "Kinesin-like protein KIF26B" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:2447076 Kif26b "kinesin family member 26B" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|E1C4G2 E1C4G2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q7TNC6KI26B_MOUSENo assigned EC number0.56140.46880.0535yesN/A
Q2KJY2KI26B_HUMANNo assigned EC number0.56140.46880.0536yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query241
cd00106328 cd00106, KISc, Kinesin motor domain 3e-20
pfam00225326 pfam00225, Kinesin, Kinesin motor domain 6e-20
smart00129335 smart00129, KISc, Kinesin motor, catalytic domain 8e-16
cd01371333 cd01371, KISc_KIF3, Kinesin motor domain, kinesins 4e-13
cd01374321 cd01374, KISc_CENP_E, Kinesin motor domain, CENP-E 1e-12
cd01375334 cd01375, KISc_KIF9_like, Kinesin motor domain, KIF 3e-12
cd01366329 cd01366, KISc_C_terminal, Kinesin motor domain, KI 6e-12
cd01364352 cd01364, KISc_BimC_Eg5, Kinesin motor domain, BimC 2e-11
cd01369325 cd01369, KISc_KHC_KIF5, Kinesin motor domain, kine 6e-11
cd01370338 cd01370, KISc_KIP3_like, Kinesin motor domain, KIP 9e-11
cd01373337 cd01373, KISc_KLP2_like, Kinesin motor domain, KLP 2e-10
cd01372341 cd01372, KISc_KIF4, Kinesin motor domain, KIF4-lik 3e-09
cd01365356 cd01365, KISc_KIF1A_KIF1B, Kinesin motor domain, K 6e-09
cd01376319 cd01376, KISc_KID_like, Kinesin motor domain, KIF2 2e-08
cd01368345 cd01368, KISc_KIF23_like, Kinesin motor domain, KI 6e-07
cd01367322 cd01367, KISc_KIF2_like, Kinesin motor domain, KIF 2e-05
COG5059 568 COG5059, KIP1, Kinesin-like protein [Cytoskeleton] 0.001
cd01363186 cd01363, Motor_domain, Myosin and Kinesin motor do 0.003
>gnl|CDD|238054 cd00106, KISc, Kinesin motor domain Back     alignment and domain information
 Score = 87.3 bits (217), Expect = 3e-20
 Identities = 39/113 (34%), Positives = 61/113 (53%), Gaps = 7/113 (6%)

Query: 1   MFAFDAIF-SDEPQSEICTSALSDVIQAVISGSDGCLFCFGHARLGKSYTMVGSPQSSAT 59
            F FD +F  +  Q ++  +    ++++V+ G +G +F +G    GK+YTM GSP+    
Sbjct: 46  SFTFDHVFDPNSTQEDVYETTAKPLVESVLEGYNGTIFAYGQTGSGKTYTMFGSPKD--- 102

Query: 60  LGVIPSAISWLFRCISEQKHKTGARFSVRASAIEISSSSQHVKDLLSTYSNGK 112
            G+IP A+  LF  I E+K +    FSV  S +EI   ++ V DLLS     K
Sbjct: 103 PGIIPRALEDLFNLIDERK-EKNKSFSVSVSYLEI--YNEKVYDLLSPEPPSK 152


This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Kinesins are microtubule-dependent molecular motors that play important roles in intracellular transport and in cell division. In most kinesins, the motor domain is found at the N-terminus (N-type), in some its is found in the middle (M-type), or C-terminal (C-type). N-type and M-type kinesins are (+) end-directed motors, while C-type kinesins are (-) end-directed motors, i.e. they transport cargo towards the (-) end of the microtubule. Kinesin motor domains hydrolyze ATP at a rate of about 80 per second, and move along the microtubule at a speed of about 6400 Angstroms per second. To achieve that, kinesin head groups work in pairs. Upon replacing ADP with ATP, a kinesin motor domain increases its affinity for microtubule binding and locks in place. Also, the neck linker binds to the motor domain, which repositions the other head domain through the coiled-coil domain close to a second tubulin dimer, about 80 Angstroms along the microtubule. Meanwhile, ATP hydrolysis takes place, and when the second head domain binds to the microtubule, the first domain again replaces ADP with ATP, triggering a conformational change that pulls the first domain forward. Length = 328

>gnl|CDD|215803 pfam00225, Kinesin, Kinesin motor domain Back     alignment and domain information
>gnl|CDD|214526 smart00129, KISc, Kinesin motor, catalytic domain Back     alignment and domain information
>gnl|CDD|238667 cd01371, KISc_KIF3, Kinesin motor domain, kinesins II or KIF3_like proteins Back     alignment and domain information
>gnl|CDD|238670 cd01374, KISc_CENP_E, Kinesin motor domain, CENP-E/KIP2-like subgroup, involved in chromosome movement and/or spindle elongation during mitosis Back     alignment and domain information
>gnl|CDD|238671 cd01375, KISc_KIF9_like, Kinesin motor domain, KIF9-like subgroup; might play a role in cell shape remodeling Back     alignment and domain information
>gnl|CDD|238662 cd01366, KISc_C_terminal, Kinesin motor domain, KIFC2/KIFC3/ncd-like carboxy-terminal kinesins Back     alignment and domain information
>gnl|CDD|238660 cd01364, KISc_BimC_Eg5, Kinesin motor domain, BimC/Eg5 spindle pole proteins, participate in spindle assembly and chromosome segregation during cell division Back     alignment and domain information
>gnl|CDD|238665 cd01369, KISc_KHC_KIF5, Kinesin motor domain, kinesin heavy chain (KHC) or KIF5-like subgroup Back     alignment and domain information
>gnl|CDD|238666 cd01370, KISc_KIP3_like, Kinesin motor domain, KIP3-like subgroup Back     alignment and domain information
>gnl|CDD|238669 cd01373, KISc_KLP2_like, Kinesin motor domain, KLP2-like subgroup Back     alignment and domain information
>gnl|CDD|238668 cd01372, KISc_KIF4, Kinesin motor domain, KIF4-like subfamily Back     alignment and domain information
>gnl|CDD|238661 cd01365, KISc_KIF1A_KIF1B, Kinesin motor domain, KIF1_like proteins Back     alignment and domain information
>gnl|CDD|238672 cd01376, KISc_KID_like, Kinesin motor domain, KIF22/Kid-like subgroup Back     alignment and domain information
>gnl|CDD|238664 cd01368, KISc_KIF23_like, Kinesin motor domain, KIF23-like subgroup Back     alignment and domain information
>gnl|CDD|238663 cd01367, KISc_KIF2_like, Kinesin motor domain, KIF2-like group Back     alignment and domain information
>gnl|CDD|227392 COG5059, KIP1, Kinesin-like protein [Cytoskeleton] Back     alignment and domain information
>gnl|CDD|238659 cd01363, Motor_domain, Myosin and Kinesin motor domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 241
KOG4280|consensus 574 100.0
cd01373337 KISc_KLP2_like Kinesin motor domain, KLP2-like sub 100.0
cd01370338 KISc_KIP3_like Kinesin motor domain, KIP3-like sub 100.0
KOG0243|consensus 1041 100.0
KOG0245|consensus 1221 100.0
KOG0242|consensus 675 100.0
cd01368345 KISc_KIF23_like Kinesin motor domain, KIF23-like s 100.0
PLN03188 1320 kinesin-12 family protein; Provisional 100.0
cd01367322 KISc_KIF2_like Kinesin motor domain, KIF2-like gro 100.0
cd01371333 KISc_KIF3 Kinesin motor domain, kinesins II or KIF 100.0
cd01365356 KISc_KIF1A_KIF1B Kinesin motor domain, KIF1_like p 100.0
cd01369325 KISc_KHC_KIF5 Kinesin motor domain, kinesin heavy 100.0
KOG0240|consensus 607 100.0
cd01375334 KISc_KIF9_like Kinesin motor domain, KIF9-like sub 100.0
cd01376319 KISc_KID_like Kinesin motor domain, KIF22/Kid-like 100.0
cd01374321 KISc_CENP_E Kinesin motor domain, CENP-E/KIP2-like 100.0
cd01372341 KISc_KIF4 Kinesin motor domain, KIF4-like subfamil 100.0
cd01364352 KISc_BimC_Eg5 Kinesin motor domain, BimC/Eg5 spind 100.0
KOG0239|consensus670 100.0
cd01366329 KISc_C_terminal Kinesin motor domain, KIFC2/KIFC3/ 100.0
PF00225335 Kinesin: Kinesin motor domain; InterPro: IPR001752 100.0
smart00129335 KISc Kinesin motor, catalytic domain. ATPase. Micr 100.0
cd00106328 KISc Kinesin motor domain. This catalytic (head) d 100.0
KOG0241|consensus 1714 100.0
KOG0247|consensus 809 100.0
KOG0246|consensus 676 100.0
COG5059 568 KIP1 Kinesin-like protein [Cytoskeleton] 100.0
KOG0244|consensus 913 99.98
cd01363186 Motor_domain Myosin and Kinesin motor domain. Thes 99.89
PF00308219 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 94.9
PRK06620214 hypothetical protein; Validated 92.99
PRK06893229 DNA replication initiation factor; Validated 92.98
COG2805353 PilT Tfp pilus assembly protein, pilus retraction 91.94
COG0556 663 UvrB Helicase subunit of the DNA excision repair c 91.19
PRK09087226 hypothetical protein; Validated 91.15
cd01377 693 MYSc_type_II Myosin motor domain, type II myosins. 91.04
PRK14086617 dnaA chromosomal replication initiation protein; P 90.83
cd01378 674 MYSc_type_I Myosin motor domain, type I myosins. M 90.33
PRK14088 440 dnaA chromosomal replication initiation protein; P 90.18
PRK12377248 putative replication protein; Provisional 90.02
PRK05642234 DNA replication initiation factor; Validated 89.94
TIGR02928 365 orc1/cdc6 family replication initiation protein. M 89.81
cd01384 674 MYSc_type_XI Myosin motor domain, plant-specific t 89.44
PRK08116268 hypothetical protein; Validated 89.31
PRK00149450 dnaA chromosomal replication initiation protein; R 89.24
cd00124 679 MYSc Myosin motor domain. This catalytic (head) do 89.21
PRK08084235 DNA replication initiation factor; Provisional 89.15
cd01382 717 MYSc_type_VI Myosin motor domain, type VI myosins. 89.05
PRK00411 394 cdc6 cell division control protein 6; Reviewed 89.05
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 88.98
COG2804500 PulE Type II secretory pathway, ATPase PulE/Tfp pi 88.95
cd01380 691 MYSc_type_V Myosin motor domain, type V myosins. M 88.67
TIGR00362405 DnaA chromosomal replication initiator protein Dna 88.65
cd01386 767 MYSc_type_XVIII Myosin motor domain, type XVIII my 88.53
PRK07952244 DNA replication protein DnaC; Validated 86.71
PF04851184 ResIII: Type III restriction enzyme, res subunit; 86.53
PRK06526254 transposase; Provisional 85.98
COG1474 366 CDC6 Cdc6-related protein, AAA superfamily ATPase 85.84
PRK14087 450 dnaA chromosomal replication initiation protein; P 85.73
COG0593408 DnaA ATPase involved in DNA replication initiation 85.54
PRK08903227 DnaA regulatory inactivator Hda; Validated 83.81
PRK08181269 transposase; Validated 82.48
PF1324576 AAA_19: Part of AAA domain 82.47
cd00046144 DEXDc DEAD-like helicases superfamily. A diverse f 82.44
PRK06835329 DNA replication protein DnaC; Validated 82.34
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 82.29
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 81.8
PRK08939306 primosomal protein DnaI; Reviewed 81.66
smart00382148 AAA ATPases associated with a variety of cellular 81.36
PRK12422445 chromosomal replication initiation protein; Provis 81.2
COG1484254 DnaC DNA replication protein [DNA replication, rec 80.75
PRK10436462 hypothetical protein; Provisional 80.35
PF01695178 IstB_IS21: IstB-like ATP binding protein; InterPro 80.29
>KOG4280|consensus Back     alignment and domain information
Probab=100.00  E-value=9.4e-52  Score=396.47  Aligned_cols=214  Identities=30%  Similarity=0.429  Sum_probs=185.2

Q ss_pred             CeecceecC-CCChHHHHHHHHHHHHHHHhcCCCEEEEcccccCCCcceeeccCCCCCCCCCchHHHHHHHHHHHHhccc
Q psy9852           1 MFAFDAIFS-DEPQSEICTSALSDVIQAVISGSDGCLFCFGHARLGKSYTMVGSPQSSATLGVIPSAISWLFRCISEQKH   79 (241)
Q Consensus         1 tF~FD~VF~-~a~Qe~Vy~~~v~plV~~vl~G~n~ti~aYGqtgSGKTyTm~G~~~~~~~~GIipr~~~~LF~~i~~~~~   79 (241)
                      +|+||.||+ +++|++||+.++.|+|+++++|||+||||||||||||||||+|++  +...|||||++++||..|+..++
T Consensus        53 ~ftfD~vf~~~stQ~dvy~~~~~~lV~svl~GyNgtvFaYGQTGsGKTyTM~G~~--~~~~GiiPraf~~LF~~I~~~~~  130 (574)
T KOG4280|consen   53 SFTFDAVFDSDSTQDDVYQETVAPLVESVLEGYNGTVFAYGQTGSGKTYTMIGPD--PELRGLIPRAFEHLFRHIDERKE  130 (574)
T ss_pred             CceeeeeecCCCCHHHHHHHHhHHHHHHHhcccCceEEEeccCCCCCceEeeCCC--hhhCCchhHHHHHHHHHHHhccc
Confidence            599999999 999999999999999999999999999999999999999999994  56899999999999999999875


Q ss_pred             CCCcEEEEEEEEEEEeCCCCeEEEcCCCCC-CCceEEEccCCcEEecCcEEEeCCCHHHHHHHHH-HhcCCCccccCCCC
Q psy9852          80 KTGARFSVRASAIEISSSSQHVKDLLSTYS-NGKFFRLCFLKRFHAEEDEEMPCPVPPPLHSNLL-TLSRDSLISNKRND  157 (241)
Q Consensus        80 ~~~~~~~V~vS~lEIY~~nE~v~DLL~~~~-~~~~l~~~~~~g~~v~glt~v~V~s~~d~~~ll~-g~~~R~~~~T~~N~  157 (241)
                      .  .+|.|+|||+|||  ||+|+|||++.. +.+.++++|+.|+||+|++++.|.+++++..+|. |..+|++++|.||.
T Consensus       131 ~--~~f~vrvS~lEiY--nE~i~DLL~~~~~~~l~lre~p~~Gv~V~nlse~~v~s~~d~~~~l~~G~~nR~vgat~mn~  206 (574)
T KOG4280|consen  131 K--TRFLVRVSYLEIY--NESIRDLLSPVNPKGLELREDPKCGVYVENLSEMDVESAEDAQQLLVVGLANRRVGATSMNE  206 (574)
T ss_pred             c--ceEEEEeehHHHH--hHHHHHHhCccCcCCceeeEcCCCceEecCcceeecCCHHHHHHHHHHHHhhcchhhccCCc
Confidence            4  3899999999999  999999999987 5889999999999999999999999999999999 99999999999999


Q ss_pred             CCch----hhhhceeeeCCCCCCccccccccccccccccccccchhhhhhhhcc-----ccccccchhhHHHHHHhhHHH
Q psy9852         158 NSSL----YSNSNERLHDPGGTGSIKSFRNFGFGSGIQYCKNDLETLEQYCKND-----FNQSTWRNDRLEQLKREKRAL  228 (241)
Q Consensus       158 ~SSr----f~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~-----~~~~~~~~~~~~~~~~~~~~~  228 (241)
                      .|||    ||+..+..  ..+.+...+++    .|.|+  =+||||||||.|++     ..+++.+|.+|+.|+..=.+|
T Consensus       207 ~SsRSH~ift~~i~~~--~~~~~~~~~~~----~~rln--lvDLagsEr~~~tga~G~rlkEa~~IN~SLs~LG~vI~aL  278 (574)
T KOG4280|consen  207 ESSRSHAIFTIHIESS--EKSDGGLMSGR----SSKLN--LVDLAGSERQSKTGAEGERLKEATNINLSLSALGNVISAL  278 (574)
T ss_pred             ccccceEEEEEEEEee--cccCCCccccc----cceee--eeeccchhhhcccCccchhhhhhcccchhHHHHHHHHHHH
Confidence            9999    77776661  22222333333    11233  37999999999997     677777777777777654443



>cd01373 KISc_KLP2_like Kinesin motor domain, KLP2-like subgroup Back     alignment and domain information
>cd01370 KISc_KIP3_like Kinesin motor domain, KIP3-like subgroup Back     alignment and domain information
>KOG0243|consensus Back     alignment and domain information
>KOG0245|consensus Back     alignment and domain information
>KOG0242|consensus Back     alignment and domain information
>cd01368 KISc_KIF23_like Kinesin motor domain, KIF23-like subgroup Back     alignment and domain information
>PLN03188 kinesin-12 family protein; Provisional Back     alignment and domain information
>cd01367 KISc_KIF2_like Kinesin motor domain, KIF2-like group Back     alignment and domain information
>cd01371 KISc_KIF3 Kinesin motor domain, kinesins II or KIF3_like proteins Back     alignment and domain information
>cd01365 KISc_KIF1A_KIF1B Kinesin motor domain, KIF1_like proteins Back     alignment and domain information
>cd01369 KISc_KHC_KIF5 Kinesin motor domain, kinesin heavy chain (KHC) or KIF5-like subgroup Back     alignment and domain information
>KOG0240|consensus Back     alignment and domain information
>cd01375 KISc_KIF9_like Kinesin motor domain, KIF9-like subgroup; might play a role in cell shape remodeling Back     alignment and domain information
>cd01376 KISc_KID_like Kinesin motor domain, KIF22/Kid-like subgroup Back     alignment and domain information
>cd01374 KISc_CENP_E Kinesin motor domain, CENP-E/KIP2-like subgroup, involved in chromosome movement and/or spindle elongation during mitosis Back     alignment and domain information
>cd01372 KISc_KIF4 Kinesin motor domain, KIF4-like subfamily Back     alignment and domain information
>cd01364 KISc_BimC_Eg5 Kinesin motor domain, BimC/Eg5 spindle pole proteins, participate in spindle assembly and chromosome segregation during cell division Back     alignment and domain information
>KOG0239|consensus Back     alignment and domain information
>cd01366 KISc_C_terminal Kinesin motor domain, KIFC2/KIFC3/ncd-like carboxy-terminal kinesins Back     alignment and domain information
>PF00225 Kinesin: Kinesin motor domain; InterPro: IPR001752 Kinesin [, , ] is a microtubule-associated force-producing protein that may play a role in organelle transport Back     alignment and domain information
>smart00129 KISc Kinesin motor, catalytic domain Back     alignment and domain information
>cd00106 KISc Kinesin motor domain Back     alignment and domain information
>KOG0241|consensus Back     alignment and domain information
>KOG0247|consensus Back     alignment and domain information
>KOG0246|consensus Back     alignment and domain information
>COG5059 KIP1 Kinesin-like protein [Cytoskeleton] Back     alignment and domain information
>KOG0244|consensus Back     alignment and domain information
>cd01363 Motor_domain Myosin and Kinesin motor domain Back     alignment and domain information
>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication Back     alignment and domain information
>PRK06620 hypothetical protein; Validated Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>COG2805 PilT Tfp pilus assembly protein, pilus retraction ATPase PilT [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>COG0556 UvrB Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK09087 hypothetical protein; Validated Back     alignment and domain information
>cd01377 MYSc_type_II Myosin motor domain, type II myosins Back     alignment and domain information
>PRK14086 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>cd01378 MYSc_type_I Myosin motor domain, type I myosins Back     alignment and domain information
>PRK14088 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK12377 putative replication protein; Provisional Back     alignment and domain information
>PRK05642 DNA replication initiation factor; Validated Back     alignment and domain information
>TIGR02928 orc1/cdc6 family replication initiation protein Back     alignment and domain information
>cd01384 MYSc_type_XI Myosin motor domain, plant-specific type XI myosin, involved in organelle transport Back     alignment and domain information
>PRK08116 hypothetical protein; Validated Back     alignment and domain information
>PRK00149 dnaA chromosomal replication initiation protein; Reviewed Back     alignment and domain information
>cd00124 MYSc Myosin motor domain Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>cd01382 MYSc_type_VI Myosin motor domain, type VI myosins Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>COG2804 PulE Type II secretory pathway, ATPase PulE/Tfp pilus assembly pathway, ATPase PilB [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>cd01380 MYSc_type_V Myosin motor domain, type V myosins Back     alignment and domain information
>TIGR00362 DnaA chromosomal replication initiator protein DnaA Back     alignment and domain information
>cd01386 MYSc_type_XVIII Myosin motor domain, type XVIII myosins Back     alignment and domain information
>PRK07952 DNA replication protein DnaC; Validated Back     alignment and domain information
>PF04851 ResIII: Type III restriction enzyme, res subunit; InterPro: IPR006935 This entry represents a domain found in the N terminus of several proteins, including helicases, the R subunit (HsdR) of type I restriction endonucleases (3 Back     alignment and domain information
>PRK06526 transposase; Provisional Back     alignment and domain information
>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14087 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK08903 DnaA regulatory inactivator Hda; Validated Back     alignment and domain information
>PRK08181 transposase; Validated Back     alignment and domain information
>PF13245 AAA_19: Part of AAA domain Back     alignment and domain information
>cd00046 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>PRK06835 DNA replication protein DnaC; Validated Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>PRK08939 primosomal protein DnaI; Reviewed Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>PRK12422 chromosomal replication initiation protein; Provisional Back     alignment and domain information
>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK10436 hypothetical protein; Provisional Back     alignment and domain information
>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query241
3nwn_A359 Crystal Structure Of The Human Kif9 Motor Domain In 8e-12
3b6v_A395 Crystal Structure Of The Motor Domain Of Human Kine 2e-10
4h1g_A715 Structure Of Candida Albicans Kar3 Motor Domain Fus 4e-10
3b6u_A372 Crystal Structure Of The Motor Domain Of Human Kine 7e-10
1cz7_A406 The Crystal Structure Of A Minus-End Directed Micro 3e-09
3l1c_A383 Kinesin-14 Protein Ncd, T436s Mutant Length = 383 3e-09
2ncd_A420 Ncd (Non-Claret Disjunctional) Dimer From D. Melano 3e-09
3u06_A412 Crystal Structure Of The Kinesin-14 Ncdg347d Length 3e-09
1n6m_A409 Rotation Of The StalkNECK AND ONE HEAD IN A NEW CRY 3e-09
2rep_A376 Crystal Structure Of The Motor Domain Of Human Kine 1e-08
1f9t_A358 Crystal Structures Of Kinesin Mutants Reveal A Sign 2e-08
3kar_A346 The Motor Domain Of Kinesin-Like Protein Kar3, A Sa 3e-08
1f9v_A347 Crystal Structures Of Mutants Reveal A Signalling P 3e-08
1f9u_A347 Crystal Structures Of Mutants Reveal A Signalling P 3e-08
1f9w_A347 Crystal Structures Of Mutants Reveal A Signalling P 3e-08
1t5c_A349 Crystal Structure Of The Motor Domain Of Human Kine 5e-08
4etp_A403 C-Terminal Motor And Motor Homology Domain Of Kar3v 5e-08
1goj_A355 Structure Of A Fast Kinesin: Implications For Atpas 5e-07
2wbe_C373 Kinesin-5-Tubulin Complex With Amppnp Length = 373 7e-07
2y5w_A365 Crystal Structure Of Drosophila Melanogaster Kinesi 7e-07
1bg2_A325 Human Ubiquitous Kinesin Motor Domain Length = 325 1e-06
1mkj_A349 Human Kinesin Motor Domain With Docked Neck Linker 1e-06
4atx_C340 Rigor Kinesin Motor Domain With An Ordered Neck-Lin 1e-06
4aqv_C373 Model Of Human Kinesin-5 Motor Domain (3hqd) And Ma 1e-06
4gkr_A371 Structure Of The C-Terminal Motor Domain Of Kar3 Fr 2e-06
2owm_A 443 Motor Domain Of Neurospora Crassa Kinesin-3 (Nckin3 3e-06
3t0q_A349 Motor Domain Structure Of The Kar3-Like Kinesin Fro 3e-06
1x88_A359 Human Eg5 Motor Domain Bound To Mg-Adp And Monastro 5e-06
3hqd_A369 Human Kinesin Eg5 Motor Domain In Complex With Ampp 6e-06
1ii6_A368 Crystal Structure Of The Mitotic Kinesin Eg5 In Com 6e-06
1q0b_A367 Crystal Structure Of The Motor Protein Ksp In Compl 6e-06
3zcw_A348 Eg5 - New Allosteric Binding Site Length = 348 6e-06
4ap0_A370 The Mitotic Kinesin Eg5 In Complex With Mg-Adp And 6e-06
4a28_A368 Eg5-2 Length = 368 6e-06
4a1z_A368 Eg5-1 Length = 368 7e-06
3bfn_A388 Crystal Structure Of The Motor Domain Of Human Kine 7e-06
1vfv_A366 Crystal Structure Of The Kif1a Motor Domain Complex 1e-05
1ia0_K394 Kif1a Head-Microtubule Complex Structure In Atp-For 1e-05
1i5s_A367 Crystal Structure Of The Kif1a Motor Domain Complex 1e-05
1i6i_A366 Crystal Structure Of The Kif1a Motor Domain Complex 1e-05
2h58_A330 Crystal Structure Of The Kifc3 Motor Domain In Comp 1e-05
3gbj_A354 Crystal Structure Of The Motor Domain Of Kinesin Ki 2e-05
1sdm_A369 Crystal Structure Of Kinesin-Like Calmodulin Bindin 4e-05
2kin_A238 Kinesin (Monomeric) From Rattus Norvegicus Length = 4e-05
3lre_A355 Crystal Structure Analysis Of Human Kinesin-8 Motor 7e-05
2vvg_A350 Crystal Structure Of The G.Intestinalis Kinesin 2 G 3e-04
>pdb|3NWN|A Chain A, Crystal Structure Of The Human Kif9 Motor Domain In Complex With Adp Length = 359 Back     alignment and structure

Iteration: 1

Score = 67.0 bits (162), Expect = 8e-12, Method: Compositional matrix adjust. Identities = 34/106 (32%), Positives = 56/106 (52%), Gaps = 5/106 (4%) Query: 2 FAFDAIFSDEPQSEICTSALSDVIQAVISGSDGCLFCFGHARLGKSYTMVGSPQSSATLG 61 F D + D Q + + DV+ + G +G + C+G GK+YTM+G+ ++ G Sbjct: 74 FKLDGVLHDASQDLVYETVAKDVVSQALDGYNGTIMCYGQTGAGKTYTMMGATENYKHRG 133 Query: 62 VIPSAISWLFRCISEQKHKTGARFSVRASAIEISSSSQHVKDLLST 107 ++P A+ +FR I E+ +VR S +EI + S + DLLST Sbjct: 134 ILPRALQQVFRMIEERPTHA---ITVRVSYLEIYNES--LFDLLST 174
>pdb|3B6V|A Chain A, Crystal Structure Of The Motor Domain Of Human Kinesin Family Member 3c In Complex With Adp Length = 395 Back     alignment and structure
>pdb|4H1G|A Chain A, Structure Of Candida Albicans Kar3 Motor Domain Fused To Maltose- Binding Protein Length = 715 Back     alignment and structure
>pdb|3B6U|A Chain A, Crystal Structure Of The Motor Domain Of Human Kinesin Family Member 3b In Complex With Adp Length = 372 Back     alignment and structure
>pdb|1CZ7|A Chain A, The Crystal Structure Of A Minus-End Directed Microtubule Motor Protein Ncd Reveals Variable Dimer Conformations Length = 406 Back     alignment and structure
>pdb|3L1C|A Chain A, Kinesin-14 Protein Ncd, T436s Mutant Length = 383 Back     alignment and structure
>pdb|2NCD|A Chain A, Ncd (Non-Claret Disjunctional) Dimer From D. Melanogaster Length = 420 Back     alignment and structure
>pdb|3U06|A Chain A, Crystal Structure Of The Kinesin-14 Ncdg347d Length = 412 Back     alignment and structure
>pdb|1N6M|A Chain A, Rotation Of The StalkNECK AND ONE HEAD IN A NEW CRYSTAL Structure Of The Kinesin Motor Protein, Ncd Length = 409 Back     alignment and structure
>pdb|2REP|A Chain A, Crystal Structure Of The Motor Domain Of Human Kinesin Family Member C1 Length = 376 Back     alignment and structure
>pdb|1F9T|A Chain A, Crystal Structures Of Kinesin Mutants Reveal A Signalling Pathway For Activation Of The Motor Atpase Length = 358 Back     alignment and structure
>pdb|3KAR|A Chain A, The Motor Domain Of Kinesin-Like Protein Kar3, A Saccharomyces Cerevisiae Kinesin-Related Protein Length = 346 Back     alignment and structure
>pdb|1F9V|A Chain A, Crystal Structures Of Mutants Reveal A Signalling Pathway For Activation Of The Kinesin Motor Atpase Length = 347 Back     alignment and structure
>pdb|1F9U|A Chain A, Crystal Structures Of Mutants Reveal A Signalling Pathway For Activation Of The Kinesin Motor Atpase Length = 347 Back     alignment and structure
>pdb|1F9W|A Chain A, Crystal Structures Of Mutants Reveal A Signalling Pathway For Activation Of The Kinesin Motor Atpase Length = 347 Back     alignment and structure
>pdb|1T5C|A Chain A, Crystal Structure Of The Motor Domain Of Human Kinetochore Protein Cenp-E Length = 349 Back     alignment and structure
>pdb|4ETP|A Chain A, C-Terminal Motor And Motor Homology Domain Of Kar3vik1 Fused To A Synthetic Heterodimeric Coiled Coil Length = 403 Back     alignment and structure
>pdb|1GOJ|A Chain A, Structure Of A Fast Kinesin: Implications For Atpase Mechanism And Interactions With Microtubules Length = 355 Back     alignment and structure
>pdb|2WBE|C Chain C, Kinesin-5-Tubulin Complex With Amppnp Length = 373 Back     alignment and structure
>pdb|2Y5W|A Chain A, Crystal Structure Of Drosophila Melanogaster Kinesin-1 Motor Domain Dimer Length = 365 Back     alignment and structure
>pdb|1BG2|A Chain A, Human Ubiquitous Kinesin Motor Domain Length = 325 Back     alignment and structure
>pdb|1MKJ|A Chain A, Human Kinesin Motor Domain With Docked Neck Linker Length = 349 Back     alignment and structure
>pdb|4ATX|C Chain C, Rigor Kinesin Motor Domain With An Ordered Neck-Linker, Docked On Tubulin Dimer, Modelled Into The 8a Cryo-Em Map Of Doublecortin-Microtubules Decorated With Kinesin Length = 340 Back     alignment and structure
>pdb|4AQV|C Chain C, Model Of Human Kinesin-5 Motor Domain (3hqd) And Mammalian Tubulin Heterodimer (1jff) Docked Into The 9.7-angstrom Cryo-em Map Of Microtubule-bound Kinesin-5 Motor Domain In The Ampppnp State. Length = 373 Back     alignment and structure
>pdb|4GKR|A Chain A, Structure Of The C-Terminal Motor Domain Of Kar3 From Candida Glabrata Length = 371 Back     alignment and structure
>pdb|2OWM|A Chain A, Motor Domain Of Neurospora Crassa Kinesin-3 (Nckin3) Length = 443 Back     alignment and structure
>pdb|3T0Q|A Chain A, Motor Domain Structure Of The Kar3-Like Kinesin From Ashbya Gossypii Length = 349 Back     alignment and structure
>pdb|1X88|A Chain A, Human Eg5 Motor Domain Bound To Mg-Adp And Monastrol Length = 359 Back     alignment and structure
>pdb|3HQD|A Chain A, Human Kinesin Eg5 Motor Domain In Complex With Amppnp And Mg2+ Length = 369 Back     alignment and structure
>pdb|1II6|A Chain A, Crystal Structure Of The Mitotic Kinesin Eg5 In Complex With Mg-Adp. Length = 368 Back     alignment and structure
>pdb|1Q0B|A Chain A, Crystal Structure Of The Motor Protein Ksp In Complex With Adp And Monastrol Length = 367 Back     alignment and structure
>pdb|3ZCW|A Chain A, Eg5 - New Allosteric Binding Site Length = 348 Back     alignment and structure
>pdb|4AP0|A Chain A, The Mitotic Kinesin Eg5 In Complex With Mg-Adp And Ispinesib Length = 370 Back     alignment and structure
>pdb|4A28|A Chain A, Eg5-2 Length = 368 Back     alignment and structure
>pdb|4A1Z|A Chain A, Eg5-1 Length = 368 Back     alignment and structure
>pdb|3BFN|A Chain A, Crystal Structure Of The Motor Domain Of Human Kinesin Family Member 22 Length = 388 Back     alignment and structure
>pdb|1VFV|A Chain A, Crystal Structure Of The Kif1a Motor Domain Complexed With Mg-Amppnp Length = 366 Back     alignment and structure
>pdb|1IA0|K Chain K, Kif1a Head-Microtubule Complex Structure In Atp-Form Length = 394 Back     alignment and structure
>pdb|1I5S|A Chain A, Crystal Structure Of The Kif1a Motor Domain Complexed With Mg-Adp Length = 367 Back     alignment and structure
>pdb|1I6I|A Chain A, Crystal Structure Of The Kif1a Motor Domain Complexed With Mg-Amppcp Length = 366 Back     alignment and structure
>pdb|2H58|A Chain A, Crystal Structure Of The Kifc3 Motor Domain In Complex With Adp Length = 330 Back     alignment and structure
>pdb|3GBJ|A Chain A, Crystal Structure Of The Motor Domain Of Kinesin Kif13b Bound With Adp Length = 354 Back     alignment and structure
>pdb|1SDM|A Chain A, Crystal Structure Of Kinesin-Like Calmodulin Binding Protein Length = 369 Back     alignment and structure
>pdb|2KIN|A Chain A, Kinesin (Monomeric) From Rattus Norvegicus Length = 238 Back     alignment and structure
>pdb|3LRE|A Chain A, Crystal Structure Analysis Of Human Kinesin-8 Motor Domain Length = 355 Back     alignment and structure
>pdb|2VVG|A Chain A, Crystal Structure Of The G.Intestinalis Kinesin 2 Gikin2a Motor Domain Length = 350 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query241
2nr8_A358 Kinesin-like protein KIF9; motor domain, ADP, stru 2e-18
1bg2_A325 Kinesin; motor protein, ATPase, microtubule associ 1e-17
3b6u_A372 Kinesin-like protein KIF3B; structural genomics co 2e-17
1t5c_A349 CENP-E protein, centromeric protein E; kinesin mot 5e-17
2y65_A365 Kinesin, kinesin heavy chain; motor protein; HET: 6e-17
2vvg_A350 Kinesin-2; motor protein, nucleotide-binding, micr 2e-16
3dc4_A344 Kinesin-like protein NOD; catalytic domain, ATPase 2e-16
1goj_A355 Kinesin, kinesin heavy chain; motor protein, ATPas 4e-16
3bfn_A388 Kinesin-like protein KIF22; limited proteolysis, s 1e-15
3lre_A355 Kinesin-like protein KIF18A; motor protein, nucleo 1e-15
3cob_A369 Kinesin heavy chain-like protein; motor, switch II 2e-15
3u06_A412 Protein claret segregational; motor domain, stalk 4e-15
1f9v_A347 Kinesin-like protein KAR3; kinesin-related protein 6e-15
2h58_A330 Kinesin-like protein KIFC3 variant; motor domain, 7e-15
3t0q_A349 AGR253WP; kinesin, alpha and beta proteins, P-loop 7e-15
4a14_A344 Kinesin, kinesin-like protein KIF7; motor protein, 9e-15
1x88_A359 Kinesin-like protein KIF11; switch II, motor domai 1e-14
4etp_A403 Kinesin-like protein KAR3; kinesin motor protein, 2e-14
2wbe_C373 Bipolar kinesin KRP-130; EG5, KLP61F, tubulin, mit 2e-14
2rep_A376 Kinesin-like protein KIFC1; structural genomics co 3e-14
2owm_A 443 Nckin3-434, related to kinesin-like protein KIF1C; 1e-13
2zfi_A366 Kinesin-like protein KIF1A, kinesin heavy chain is 5e-13
2heh_A387 KIF2C protein; kinesin, motor domain, ADP, structu 6e-13
3gbj_A354 KIF13B protein; kinesin, motor domain, ADP, struct 7e-13
1v8k_A410 Kinesin-like protein KIF2C; microtubule destabiliz 2e-12
1ry6_A360 Internal kinesin; kinesin motor domain, nucleotide 5e-11
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-05
>1bg2_A Kinesin; motor protein, ATPase, microtubule associated; HET: ADP; 1.80A {Homo sapiens} SCOP: c.37.1.9 PDB: 2p4n_K* 1mkj_A* 2kin_A* 3kin_A* Length = 325 Back     alignment and structure
>3b6u_A Kinesin-like protein KIF3B; structural genomics consortium, motor domain, ADP, SGC, ATP-binding, coiled coil, microtubule, motor protein; HET: ADP; 1.80A {Homo sapiens} PDB: 3b6v_A* Length = 372 Back     alignment and structure
>1t5c_A CENP-E protein, centromeric protein E; kinesin motor-domain-ADP complex, stranded beta-sheet core with solvent exposed alpha-helices; HET: ADP PIN; 2.50A {Homo sapiens} Length = 349 Back     alignment and structure
>2y65_A Kinesin, kinesin heavy chain; motor protein; HET: ADP; 2.20A {Drosophila melanogaster} PDB: 2y5w_A* Length = 365 Back     alignment and structure
>2vvg_A Kinesin-2; motor protein, nucleotide-binding, microtubule, ATP-binding; HET: ADP; 1.60A {Giardia intestinalis} Length = 350 Back     alignment and structure
>3dc4_A Kinesin-like protein NOD; catalytic domain, ATPase, microtubule, ADP, nucleotide-binding protein, ATP-binding, coiled coil, motor protein; HET: ADP; 1.90A {Drosophila melanogaster} PDB: 3dcb_A* 3dco_N* 3pxn_A* Length = 344 Back     alignment and structure
>1goj_A Kinesin, kinesin heavy chain; motor protein, ATPase; HET: ADP; 2.3A {Neurospora crassa} SCOP: c.37.1.9 Length = 355 Back     alignment and structure
>3bfn_A Kinesin-like protein KIF22; limited proteolysis, structural genomics consortium domain, ADP, SGC, ATP-binding, DNA-binding, microtubule, MO protein; HET: ADP; 2.30A {Homo sapiens} Length = 388 Back     alignment and structure
>3lre_A Kinesin-like protein KIF18A; motor protein, nucleotide binding, microtubule binding, ATP- cell projection, cytoskeleton, glycoprotein, microtubule; HET: ADP; 2.20A {Homo sapiens} Length = 355 Back     alignment and structure
>3cob_A Kinesin heavy chain-like protein; motor, switch II, loop L11, conformation, nucleotide, ATP-binding, microtubule, motor protein; HET: ADP; 2.20A {Solanum tuberosum} SCOP: c.37.1.9 PDB: 3cnz_A* 1sdm_A* 3h4s_A* Length = 369 Back     alignment and structure
>3u06_A Protein claret segregational; motor domain, stalk rotation, power stroke, kinesin-14, MICR binding, NCD, transport, molecular motor; HET: ADP GOL; 2.35A {Drosophila melanogaster} PDB: 2ncd_A* 1n6m_A* 1cz7_A* 3l1c_A* Length = 412 Back     alignment and structure
>1f9v_A Kinesin-like protein KAR3; kinesin-related protein, motor protein, microtubinding proteinbule, contractIle protein; HET: ADP; 1.30A {Saccharomyces cerevisiae} SCOP: c.37.1.9 PDB: 1f9t_A* 1f9w_A* 1f9u_A* 3kar_A* Length = 347 Back     alignment and structure
>2h58_A Kinesin-like protein KIFC3 variant; motor domain, ADP, structural genomics, structur Al genomics consortium, SGC; HET: ADP; 1.85A {Homo sapiens} Length = 330 Back     alignment and structure
>3t0q_A AGR253WP; kinesin, alpha and beta proteins, P-loop containing nucleosi triphosphate hydrolases, microtubule motor protein; HET: ADP; 2.35A {Ashbya gossypii} Length = 349 Back     alignment and structure
>4a14_A Kinesin, kinesin-like protein KIF7; motor protein, motor domain; HET: ADP; 1.60A {Homo sapiens} PDB: 2xt3_A* Length = 344 Back     alignment and structure
>1x88_A Kinesin-like protein KIF11; switch II, motor domain, NECK linker, cell cycle; HET: ADP NAT; 1.80A {Homo sapiens} SCOP: c.37.1.9 PDB: 3hqd_A* 3ken_A* 2pg2_A* 1yrs_A* 2fme_A* 2g1q_A* 2gm1_A* 1ii6_A* 2uyi_A* 2uym_A* 2wog_A* 2x2r_A* 2x7c_A* 2x7d_A* 2x7e_A* 2xae_A* 3k3b_A* 3k5e_A* 3l9h_A* 1q0b_A* ... Length = 359 Back     alignment and structure
>4etp_A Kinesin-like protein KAR3; kinesin motor protein, kinesin motor homology domain, karyog mitosis, microtubules; HET: ADP EBC; 2.30A {Saccharomyces cerevisiae} Length = 403 Back     alignment and structure
>2wbe_C Bipolar kinesin KRP-130; EG5, KLP61F, tubulin, mitosis, GTP-binding, motor protein, cell division, cell cycle, microtubule, ATP-binding; HET: GTP ANP GDP TA1; 9.40A {Drosophila melanogaster} Length = 373 Back     alignment and structure
>2rep_A Kinesin-like protein KIFC1; structural genomics consortium, motor domain, ADP, binding, cell cycle, cell division, endosome, microtubule; HET: ADP; 2.60A {Homo sapiens} Length = 376 Back     alignment and structure
>2owm_A Nckin3-434, related to kinesin-like protein KIF1C; motor domain, ADP, NECK linker, motor PR; HET: ADP; 3.25A {Neurospora crassa} Length = 443 Back     alignment and structure
>2zfi_A Kinesin-like protein KIF1A, kinesin heavy chain isoform 5C; alpha and beta protein, enzyme, ATPase, P-loop, motor protein, ATP-binding, coiled coil; HET: ADP; 1.55A {Mus musculus} SCOP: c.37.1.9 PDB: 1vfw_A* 1vfx_A* 1vfz_A* 1vfv_A* 2zfj_A* 2zfk_A* 2zfl_A* 2zfm_A* 1i5s_A* 1i6i_A* 2hxf_C* 1ia0_K* 2hxh_C* Length = 366 Back     alignment and structure
>2heh_A KIF2C protein; kinesin, motor domain, ADP, structural genomics, structural genomics consortium, SGC, structural protein; HET: ADP; 2.15A {Homo sapiens} PDB: 3edl_D* Length = 387 Back     alignment and structure
>3gbj_A KIF13B protein; kinesin, motor domain, ADP, structural genomics, structural genomics consortium, SGC, ATP-binding, microtubule, motor protein; HET: ADP; 2.10A {Homo sapiens} Length = 354 Back     alignment and structure
>1v8k_A Kinesin-like protein KIF2C; microtubule destabilizer, structural P; HET: ANP; 2.25A {Mus musculus} SCOP: c.37.1.9 PDB: 1v8j_A* 2gry_A* Length = 410 Back     alignment and structure
>1ry6_A Internal kinesin; kinesin motor domain, nucleotide-free, transport protein; 1.60A {Plasmodium falciparum} SCOP: c.37.1.9 Length = 360 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query241
2y65_A365 Kinesin, kinesin heavy chain; motor protein; HET: 100.0
1bg2_A325 Kinesin; motor protein, ATPase, microtubule associ 100.0
2owm_A 443 Nckin3-434, related to kinesin-like protein KIF1C; 100.0
2zfi_A366 Kinesin-like protein KIF1A, kinesin heavy chain is 100.0
3lre_A355 Kinesin-like protein KIF18A; motor protein, nucleo 100.0
3bfn_A388 Kinesin-like protein KIF22; limited proteolysis, s 100.0
1t5c_A349 CENP-E protein, centromeric protein E; kinesin mot 100.0
2vvg_A350 Kinesin-2; motor protein, nucleotide-binding, micr 100.0
1goj_A355 Kinesin, kinesin heavy chain; motor protein, ATPas 100.0
3b6u_A372 Kinesin-like protein KIF3B; structural genomics co 100.0
2h58_A330 Kinesin-like protein KIFC3 variant; motor domain, 100.0
3cob_A369 Kinesin heavy chain-like protein; motor, switch II 100.0
1f9v_A347 Kinesin-like protein KAR3; kinesin-related protein 100.0
4a14_A344 Kinesin, kinesin-like protein KIF7; motor protein, 100.0
3gbj_A354 KIF13B protein; kinesin, motor domain, ADP, struct 100.0
2rep_A376 Kinesin-like protein KIFC1; structural genomics co 100.0
3nwn_A359 Kinesin-like protein KIF9; motor domain, ADP, stru 100.0
2nr8_A358 Kinesin-like protein KIF9; motor domain, ADP, stru 100.0
1x88_A359 Kinesin-like protein KIF11; switch II, motor domai 100.0
3t0q_A349 AGR253WP; kinesin, alpha and beta proteins, P-loop 100.0
2wbe_C373 Bipolar kinesin KRP-130; EG5, KLP61F, tubulin, mit 100.0
2heh_A387 KIF2C protein; kinesin, motor domain, ADP, structu 100.0
4etp_A403 Kinesin-like protein KAR3; kinesin motor protein, 100.0
1v8k_A410 Kinesin-like protein KIF2C; microtubule destabiliz 100.0
3u06_A412 Protein claret segregational; motor domain, stalk 100.0
1ry6_A360 Internal kinesin; kinesin motor domain, nucleotide 100.0
3dc4_A344 Kinesin-like protein NOD; catalytic domain, ATPase 100.0
4h1g_A715 Maltose binding protein-cakar3 motor domain fusio; 100.0
2o0a_A298 S.cerevisiae chromosome XVI reading frame ORF YPL2 99.85
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 94.52
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 93.18
2qgz_A308 Helicase loader, putative primosome component; str 91.67
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 89.94
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 89.15
3te6_A318 Regulatory protein SIR3; heterochromatin, gene sil 87.76
4b4t_K428 26S protease regulatory subunit 6B homolog; hydrol 87.21
3t15_A293 Ribulose bisphosphate carboxylase/oxygenase activ 86.94
4b4t_M434 26S protease regulatory subunit 6A; hydrolase, AAA 86.92
4anj_A 1052 Unconventional myosin-VI, green fluorescent prote; 86.15
1l8q_A324 Chromosomal replication initiator protein DNAA; AA 85.48
2bjv_A265 PSP operon transcriptional activator; AAA, transcr 84.58
2r62_A268 Cell division protease FTSH homolog; ATPase domain 84.55
3cf0_A301 Transitional endoplasmic reticulum ATPase; AAA, P9 83.48
2chg_A226 Replication factor C small subunit; DNA-binding pr 82.79
3h4m_A285 Proteasome-activating nucleotidase; ATPase, PAN, A 82.76
4b4t_J405 26S protease regulatory subunit 8 homolog; hydrola 82.72
2v1u_A 387 Cell division control protein 6 homolog; DNA repli 82.48
1d2n_A272 N-ethylmaleimide-sensitive fusion protein; hexamer 82.42
3bos_A242 Putative DNA replication factor; P-loop containing 81.89
1g8p_A350 Magnesium-chelatase 38 kDa subunit; parallel beta 81.07
4b4t_L437 26S protease subunit RPT4; hydrolase, AAA-atpases, 80.52
1ixz_A254 ATP-dependent metalloprotease FTSH; AAA domain fol 80.5
1fnn_A 389 CDC6P, cell division control protein 6; ORC1, AAA 80.03
>2y65_A Kinesin, kinesin heavy chain; motor protein; HET: ADP; 2.20A {Drosophila melanogaster} PDB: 2y5w_A* Back     alignment and structure
Probab=100.00  E-value=3.6e-52  Score=384.75  Aligned_cols=209  Identities=20%  Similarity=0.277  Sum_probs=166.7

Q ss_pred             CeecceecC-CCChHHHHHHHHHHHHHHHhcCCCEEEEcccccCCCcceeeccCCCCCCCCCchHHHHHHHHHHHHhccc
Q psy9852           1 MFAFDAIFS-DEPQSEICTSALSDVIQAVISGSDGCLFCFGHARLGKSYTMVGSPQSSATLGVIPSAISWLFRCISEQKH   79 (241)
Q Consensus         1 tF~FD~VF~-~a~Qe~Vy~~~v~plV~~vl~G~n~ti~aYGqtgSGKTyTm~G~~~~~~~~GIipr~~~~LF~~i~~~~~   79 (241)
                      +|.||+||+ +++|++||+.++.|+|+++++|||+||||||||||||||||+|...++..+|||||++++||+.+.....
T Consensus        52 ~f~FD~Vf~~~~~Q~~Vy~~~~~plv~~~l~G~n~tifAYGqTGSGKTyTm~G~~~~~~~~Giipr~~~~lF~~i~~~~~  131 (365)
T 2y65_A           52 VYLFDKVFKPNASQEKVYNEAAKSIVTDVLAGYNGTIFAYGQTSSGKTHTMEGVIGDSVKQGIIPRIVNDIFNHIYAMEV  131 (365)
T ss_dssp             EEECSEEECTTCCHHHHHHHHTHHHHHHHHTTCCEEEEEECSTTSSHHHHHTBSTTCTTTBCHHHHHHHHHHHHHHHCCS
T ss_pred             EEeCceEecCCCCHHHHHHHhhhhHHHHHhCCCceEEEeecCCCCCCceEEecCCCCcccCChHHHHHHHHHHHHHhccC
Confidence            499999999 9999999999999999999999999999999999999999999887767899999999999999987543


Q ss_pred             CCCcEEEEEEEEEEEeCCCCeEEEcCCCCCCCceEEEccCCcEEecCcEEEeCCCHHHHHHHHH-HhcCCCccccCCCCC
Q psy9852          80 KTGARFSVRASAIEISSSSQHVKDLLSTYSNGKFFRLCFLKRFHAEEDEEMPCPVPPPLHSNLL-TLSRDSLISNKRNDN  158 (241)
Q Consensus        80 ~~~~~~~V~vS~lEIY~~nE~v~DLL~~~~~~~~l~~~~~~g~~v~glt~v~V~s~~d~~~ll~-g~~~R~~~~T~~N~~  158 (241)
                        ++.|.|.+||+|||  ||+|+|||++....+.+++++.++++|+|++++.|.+++|++++|+ |.++|++++|.||+.
T Consensus       132 --~~~~~v~vS~~EIY--nE~i~DLL~~~~~~l~i~e~~~~~~~v~gl~~~~V~s~~e~~~ll~~g~~~R~~~~T~~N~~  207 (365)
T 2y65_A          132 --NLEFHIKVSYYEIY--MDKIRDLLDVSKVNLSVHEDKNRVPYVKGATERFVSSPEDVFEVIEEGKSNRHIAVTNMNEH  207 (365)
T ss_dssp             --CEEEEEEEEEEEEE--TTEEEETTCTTCCSBCEEECSSSCEEETTCCCEEECSHHHHHHHHHHHHHHHTTTCSCHHHH
T ss_pred             --CceEEEEEEEEEEE--CCeeeecccCCcCCceEEECCCCCEEecCCEEEecCCHHHHHHHHHHHHhhcccccccCCCC
Confidence              57999999999999  9999999999888899999999999999999999999999999999 999999999999999


Q ss_pred             Cch----hhhhceeeeCCCCCCccccccccccccccccccccchhhhhhhhccccccccchhhHHHHHHhhHHHH
Q psy9852         159 SSL----YSNSNERLHDPGGTGSIKSFRNFGFGSGIQYCKNDLETLEQYCKNDFNQSTWRNDRLEQLKREKRALL  229 (241)
Q Consensus       159 SSr----f~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  229 (241)
                      |||    |++..++.....+  ..       ..|-|..  +|||||||+.+++     ..+.|+.|...||+||+
T Consensus       208 SSRSH~if~i~v~~~~~~~~--~~-------~~skL~l--VDLAGSEr~~~t~-----~~g~rl~E~~~INkSL~  266 (365)
T 2y65_A          208 SSRSHSVFLINVKQENLENQ--KK-------LSGKLYL--VDLAGSEKVSKTG-----AEGTVLDEAKNINKSLS  266 (365)
T ss_dssp             HHTSEEEEEEEEEEEETTTC--CE-------EEEEEEE--EECCCCCC---------------------CCHHHH
T ss_pred             CCCceEEEEEEEEEEecCCC--CE-------eEEEEEE--EECCCCCcchhcC-----CcchhHHHHHHHHHHHH
Confidence            999    4444333322111  00       0011222  6999999987764     34556666666666654



>1bg2_A Kinesin; motor protein, ATPase, microtubule associated; HET: ADP; 1.80A {Homo sapiens} SCOP: c.37.1.9 PDB: 2p4n_K* 1mkj_A* 2kin_A* 3kin_A* Back     alignment and structure
>2owm_A Nckin3-434, related to kinesin-like protein KIF1C; motor domain, ADP, NECK linker, motor PR; HET: ADP; 3.25A {Neurospora crassa} Back     alignment and structure
>2zfi_A Kinesin-like protein KIF1A, kinesin heavy chain isoform 5C; alpha and beta protein, enzyme, ATPase, P-loop, motor protein, ATP-binding, coiled coil; HET: ADP; 1.55A {Mus musculus} SCOP: c.37.1.9 PDB: 1vfw_A* 1vfx_A* 1vfz_A* 1vfv_A* 2zfj_A* 2zfk_A* 2zfl_A* 2zfm_A* 1i5s_A* 1i6i_A* 2hxf_C* 1ia0_K* 2hxh_C* Back     alignment and structure
>3lre_A Kinesin-like protein KIF18A; motor protein, nucleotide binding, microtubule binding, ATP- cell projection, cytoskeleton, glycoprotein, microtubule; HET: ADP; 2.20A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>3bfn_A Kinesin-like protein KIF22; limited proteolysis, structural genomics consortium domain, ADP, SGC, ATP-binding, DNA-binding, microtubule, MO protein; HET: ADP; 2.30A {Homo sapiens} Back     alignment and structure
>1t5c_A CENP-E protein, centromeric protein E; kinesin motor-domain-ADP complex, stranded beta-sheet core with solvent exposed alpha-helices; HET: ADP PIN; 2.50A {Homo sapiens} Back     alignment and structure
>2vvg_A Kinesin-2; motor protein, nucleotide-binding, microtubule, ATP-binding; HET: ADP; 1.60A {Giardia intestinalis} Back     alignment and structure
>1goj_A Kinesin, kinesin heavy chain; motor protein, ATPase; HET: ADP; 2.3A {Neurospora crassa} SCOP: c.37.1.9 Back     alignment and structure
>3b6u_A Kinesin-like protein KIF3B; structural genomics consortium, motor domain, ADP, SGC, ATP-binding, coiled coil, microtubule, motor protein; HET: ADP; 1.80A {Homo sapiens} PDB: 3b6v_A* Back     alignment and structure
>2h58_A Kinesin-like protein KIFC3 variant; motor domain, ADP, structural genomics, structur Al genomics consortium, SGC; HET: ADP; 1.85A {Homo sapiens} Back     alignment and structure
>3cob_A Kinesin heavy chain-like protein; motor, switch II, loop L11, conformation, nucleotide, ATP-binding, microtubule, motor protein; HET: ADP; 2.20A {Solanum tuberosum} SCOP: c.37.1.9 PDB: 3cnz_A* 1sdm_A* 3h4s_A* Back     alignment and structure
>1f9v_A Kinesin-like protein KAR3; kinesin-related protein, motor protein, microtubinding proteinbule, contractIle protein; HET: ADP; 1.30A {Saccharomyces cerevisiae} SCOP: c.37.1.9 PDB: 1f9t_A* 1f9w_A* 1f9u_A* 3kar_A* Back     alignment and structure
>4a14_A Kinesin, kinesin-like protein KIF7; motor protein, motor domain; HET: ADP; 1.60A {Homo sapiens} SCOP: c.37.1.0 PDB: 2xt3_A* Back     alignment and structure
>3gbj_A KIF13B protein; kinesin, motor domain, ADP, structural genomics, structural genomics consortium, SGC, ATP-binding, microtubule, motor protein; HET: ADP; 2.10A {Homo sapiens} SCOP: c.37.1.9 Back     alignment and structure
>2rep_A Kinesin-like protein KIFC1; structural genomics consortium, motor domain, ADP, binding, cell cycle, cell division, endosome, microtubule; HET: ADP; 2.60A {Homo sapiens} Back     alignment and structure
>3nwn_A Kinesin-like protein KIF9; motor domain, ADP, structural genomics, structural consortium, SGC, contractIle protein; HET: ADP; 2.00A {Homo sapiens} Back     alignment and structure
>1x88_A Kinesin-like protein KIF11; switch II, motor domain, NECK linker, cell cycle; HET: ADP NAT; 1.80A {Homo sapiens} SCOP: c.37.1.9 PDB: 3hqd_A* 3ken_A* 2pg2_A* 1yrs_A* 2fme_A* 2g1q_A* 2gm1_A* 1ii6_A* 2uyi_A* 2uym_A* 2wog_A* 2x2r_A* 2x7c_A* 2x7d_A* 2x7e_A* 2xae_A* 3k3b_A* 3k5e_A* 3l9h_A* 1q0b_A* ... Back     alignment and structure
>3t0q_A AGR253WP; kinesin, alpha and beta proteins, P-loop containing nucleosi triphosphate hydrolases, microtubule motor protein; HET: ADP; 2.35A {Ashbya gossypii} Back     alignment and structure
>2wbe_C Bipolar kinesin KRP-130; EG5, KLP61F, tubulin, mitosis, GTP-binding, motor protein, cell division, cell cycle, microtubule, ATP-binding; HET: GTP ANP GDP TA1; 9.40A {Drosophila melanogaster} Back     alignment and structure
>2heh_A KIF2C protein; kinesin, motor domain, ADP, structural genomics, structural genomics consortium, SGC, structural protein; HET: ADP; 2.15A {Homo sapiens} PDB: 3edl_D* Back     alignment and structure
>4etp_A Kinesin-like protein KAR3; kinesin motor protein, kinesin motor homology domain, karyog mitosis, microtubules; HET: ADP EBC; 2.30A {Saccharomyces cerevisiae} Back     alignment and structure
>1v8k_A Kinesin-like protein KIF2C; microtubule destabilizer, structural P; HET: ANP; 2.25A {Mus musculus} SCOP: c.37.1.9 PDB: 1v8j_A* 2gry_A* Back     alignment and structure
>3u06_A Protein claret segregational; motor domain, stalk rotation, power stroke, kinesin-14, MICR binding, NCD, transport, molecular motor; HET: ADP GOL; 2.35A {Drosophila melanogaster} PDB: 2ncd_A* 1n6m_A* 1cz7_A* 3l1c_A* Back     alignment and structure
>1ry6_A Internal kinesin; kinesin motor domain, nucleotide-free, transport protein; 1.60A {Plasmodium falciparum} SCOP: c.37.1.9 Back     alignment and structure
>3dc4_A Kinesin-like protein NOD; catalytic domain, ATPase, microtubule, ADP, nucleotide-binding protein, ATP-binding, coiled coil, motor protein; HET: ADP; 1.90A {Drosophila melanogaster} PDB: 3dcb_A* 3dco_N* 3pxn_A* Back     alignment and structure
>4h1g_A Maltose binding protein-cakar3 motor domain fusio; kinesin motor domain, motor protein, chimera; HET: MTT ADP EDO; 2.15A {Escherichia coli} Back     alignment and structure
>2o0a_A S.cerevisiae chromosome XVI reading frame ORF YPL253C; VIK1, motor homology domain, kinesin, motor domain, microtubule-binding; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Back     alignment and structure
>4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4anj_A Unconventional myosin-VI, green fluorescent prote; motor protein-metal-bindng protein complex, molecular motor, metal-binding protein, transition state; HET: CR2 ADP; 2.60A {Sus scrofa} Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* Back     alignment and structure
>2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 PDB: 2x31_G Back     alignment and structure
>4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 241
d1bg2a_323 c.37.1.9 (A:) Kinesin {Human (Homo sapiens) [TaxId 6e-11
d1x88a1345 c.37.1.9 (A:18-362) Kinesin {Human (Homo sapiens), 1e-08
d1goja_354 c.37.1.9 (A:) Kinesin {Neurospora crassa [TaxId: 5 7e-06
d1f9va_342 c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjun 3e-05
d1sdma_364 c.37.1.9 (A:) Kinesin heavy chain-like protein {Po 3e-04
>d1bg2a_ c.37.1.9 (A:) Kinesin {Human (Homo sapiens) [TaxId: 9606]} Length = 323 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Motor proteins
domain: Kinesin
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 59.1 bits (142), Expect = 6e-11
 Identities = 29/133 (21%), Positives = 53/133 (39%), Gaps = 5/133 (3%)

Query: 2   FAFDAIF-SDEPQSEICTSALSDVIQAVISGSDGCLFCFGHARLGKSYTMVGSPQSSATL 60
           +AFD +F S   Q ++       +++ V+ G +G +F +G    GK++TM G       +
Sbjct: 44  YAFDRVFQSSTSQEQVYNDCAKKIVKDVLEGYNGTIFAYGQTSSGKTHTMEGKLHDPEGM 103

Query: 61  GVIPSAISWLFRCISEQKHKTGARFSVRASAIEISSSSQHVKDLLSTYSNGKFFRLCFLK 120
           G+IP  +  +F  I          F ++ S  EI      ++DLL              +
Sbjct: 104 GIIPRIVQDIFNYIYSMDENL--EFHIKVSYFEI--YLDKIRDLLDVSKTNLSVHEDKNR 159

Query: 121 RFHAEEDEEMPCP 133
             + +   E    
Sbjct: 160 VPYVKGCTERFVC 172


>d1x88a1 c.37.1.9 (A:18-362) Kinesin {Human (Homo sapiens), mitotic kinesin eg5 [TaxId: 9606]} Length = 345 Back     information, alignment and structure
>d1goja_ c.37.1.9 (A:) Kinesin {Neurospora crassa [TaxId: 5141]} Length = 354 Back     information, alignment and structure
>d1f9va_ c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjunctional) {Baker's yeast (Saccharomyces cerevisiae), Kar [TaxId: 4932]} Length = 342 Back     information, alignment and structure
>d1sdma_ c.37.1.9 (A:) Kinesin heavy chain-like protein {Potato (Solanum tuberosum) [TaxId: 4113]} Length = 364 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query241
d1bg2a_323 Kinesin {Human (Homo sapiens) [TaxId: 9606]} 100.0
d2zfia1349 Kinesin {Mouse (Mus musculus), kif1a [TaxId: 10090 100.0
d1goja_354 Kinesin {Neurospora crassa [TaxId: 5141]} 100.0
d1sdma_364 Kinesin heavy chain-like protein {Potato (Solanum 100.0
d1v8ka_362 Kinesin {Mouse (Mus musculus), kif2c [TaxId: 10090 100.0
d1ry6a_330 Kinesin {Malaria parasite (Plasmodium falciparum) 100.0
d1x88a1345 Kinesin {Human (Homo sapiens), mitotic kinesin eg5 100.0
d1f9va_342 Kinesin motor Ncd (non-claret disjunctional) {Bake 100.0
d2ncda_368 Kinesin motor Ncd (non-claret disjunctional) {Frui 100.0
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 95.64
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 92.93
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 92.56
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 89.92
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 89.23
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 85.97
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 85.49
d1p9ra_401 Extracellular secretion NTPase EpsE {Vibrio choler 85.43
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 83.75
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 83.17
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 81.81
d1szpa2251 DNA repair protein Rad51, catalytic domain {Baker' 81.7
>d1bg2a_ c.37.1.9 (A:) Kinesin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Motor proteins
domain: Kinesin
species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00  E-value=8.3e-46  Score=333.95  Aligned_cols=216  Identities=20%  Similarity=0.262  Sum_probs=183.8

Q ss_pred             CeecceecC-CCChHHHHHHHHHHHHHHHhcCCCEEEEcccccCCCcceeeccCCCCCCCCCchHHHHHHHHHHHHhccc
Q psy9852           1 MFAFDAIFS-DEPQSEICTSALSDVIQAVISGSDGCLFCFGHARLGKSYTMVGSPQSSATLGVIPSAISWLFRCISEQKH   79 (241)
Q Consensus         1 tF~FD~VF~-~a~Qe~Vy~~~v~plV~~vl~G~n~ti~aYGqtgSGKTyTm~G~~~~~~~~GIipr~~~~LF~~i~~~~~   79 (241)
                      .|+||+||+ +++|++||+.++.|+|+++++|+|+||||||||||||||||+|+..++...||+||++.+||+.+.....
T Consensus        43 ~f~FD~vf~~~~~q~~vf~~~~~~lv~~~l~G~n~~i~aYGqtgSGKTyT~~G~~~~~~~~gii~r~l~~l~~~~~~~~~  122 (323)
T d1bg2a_          43 PYAFDRVFQSSTSQEQVYNDCAKKIVKDVLEGYNGTIFAYGQTSSGKTHTMEGKLHDPEGMGIIPRIVQDIFNYIYSMDE  122 (323)
T ss_dssp             EEECSEEECTTCCHHHHHHHHTHHHHHHHHTTCCEEEEEECSTTSSHHHHHTBSTTCTTTBCHHHHHHHHHHHHHHHHCS
T ss_pred             eeECCEEECCCCCHHHHHHHHHHHHHHHHHcCCCcceeeecccCCCCceeccCCcccccccchhhhHHHHHHhhhhcccc
Confidence            499999999 9999999999999999999999999999999999999999999998877899999999999999987654


Q ss_pred             CCCcEEEEEEEEEEEeCCCCeEEEcCCCCCCCceEEEccCCcEEecCcEEEeCCCHHHHHHHHH-HhcCCCccccCCCCC
Q psy9852          80 KTGARFSVRASAIEISSSSQHVKDLLSTYSNGKFFRLCFLKRFHAEEDEEMPCPVPPPLHSNLL-TLSRDSLISNKRNDN  158 (241)
Q Consensus        80 ~~~~~~~V~vS~lEIY~~nE~v~DLL~~~~~~~~l~~~~~~g~~v~glt~v~V~s~~d~~~ll~-g~~~R~~~~T~~N~~  158 (241)
                        ..++.|.|||+|||  ||++||||.+....+.+++++.++++++|++++.|.+++++..++. |.++|++++|.+|+.
T Consensus       123 --~~~~~v~~S~~EIy--ne~i~DLL~~~~~~~~~~~~~~~~~~v~~l~~~~v~s~~~~~~~l~~~~~~R~~~~t~~n~~  198 (323)
T d1bg2a_         123 --NLEFHIKVSYFEIY--LDKIRDLLDVSKTNLSVHEDKNRVPYVKGCTERFVCSPDEVMDTIDEGKSNRHVAVTNMNEH  198 (323)
T ss_dssp             --SEEEEEEEEEEEEE--TTEEEESSCTTCCSBCEEECTTSCEEETTCCCEEECSHHHHHHHHHHHHHHTTTTCSCHHHH
T ss_pred             --ccceEEEEEEEEEE--cCcccccccccccceeEeeccccceeecCCEEEEEeccHhHhHHhhhcccceeecccCCCCC
Confidence              47899999999999  9999999999999999999999999999999999999999999999 999999999999999


Q ss_pred             Cch-hhhhceeeeCCCCCCccccccccccccccccccccchhhhhhhhc-----cccccccchhhHHHHHHhhHHH
Q psy9852         159 SSL-YSNSNERLHDPGGTGSIKSFRNFGFGSGIQYCKNDLETLEQYCKN-----DFNQSTWRNDRLEQLKREKRAL  228 (241)
Q Consensus       159 SSr-f~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~-----~~~~~~~~~~~~~~~~~~~~~~  228 (241)
                      ||| +.++...+.........      ...|.|  .-+||||+|+..++     ...++..+|.+|..|++.=++|
T Consensus       199 ssRsh~i~~i~v~~~~~~~~~------~~~s~l--~~vDLAGse~~~~~~~~~~~~~e~~~iN~SL~~L~~vi~al  266 (323)
T d1bg2a_         199 SSRSHSIFLINVKQENTQTEQ------KLSGKL--YLVDLAGSEKVSKTGAEGAVLDEAKNINKSLSALGNVISAL  266 (323)
T ss_dssp             HHHSEEEEEEEEEEEETTTCC------EEEEEE--EEEECCCSCCCCCCSSSCTTSCCCCCCCHHHHHHHHHHHHH
T ss_pred             CCccceEEEEEEEEEeCCCCc------EEEEEE--EEEecccccccccccchhhhhhhhhcccccHHHHHHHHHHH
Confidence            999 44333333211110000      011112  23799999987664     4577888899999888876665



>d2zfia1 c.37.1.9 (A:4-352) Kinesin {Mouse (Mus musculus), kif1a [TaxId: 10090]} Back     information, alignment and structure
>d1goja_ c.37.1.9 (A:) Kinesin {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d1sdma_ c.37.1.9 (A:) Kinesin heavy chain-like protein {Potato (Solanum tuberosum) [TaxId: 4113]} Back     information, alignment and structure
>d1v8ka_ c.37.1.9 (A:) Kinesin {Mouse (Mus musculus), kif2c [TaxId: 10090]} Back     information, alignment and structure
>d1ry6a_ c.37.1.9 (A:) Kinesin {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1x88a1 c.37.1.9 (A:18-362) Kinesin {Human (Homo sapiens), mitotic kinesin eg5 [TaxId: 9606]} Back     information, alignment and structure
>d1f9va_ c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjunctional) {Baker's yeast (Saccharomyces cerevisiae), Kar [TaxId: 4932]} Back     information, alignment and structure
>d2ncda_ c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjunctional) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure