Psyllid ID: psy9852
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 241 | ||||||
| 357616829 | 1126 | hypothetical protein KGM_08563 [Danaus p | 0.456 | 0.097 | 0.702 | 2e-40 | |
| 189236427 | 1267 | PREDICTED: similar to CG14535 CG14535-PA | 0.456 | 0.086 | 0.666 | 1e-38 | |
| 270005919 | 1041 | hypothetical protein TcasGA2_TC008042 [T | 0.460 | 0.106 | 0.660 | 2e-38 | |
| 242025241 | 1267 | conserved hypothetical protein [Pediculu | 0.456 | 0.086 | 0.666 | 2e-38 | |
| 350409135 | 2004 | PREDICTED: hypothetical protein LOC10074 | 0.456 | 0.054 | 0.639 | 3e-37 | |
| 340712748 | 2010 | PREDICTED: hypothetical protein LOC10065 | 0.456 | 0.054 | 0.639 | 3e-37 | |
| 328787856 | 1260 | PREDICTED: kinesin 11 [Apis mellifera] | 0.456 | 0.087 | 0.639 | 4e-37 | |
| 307207471 | 1260 | Kinesin-like protein CG14535 [Harpegnath | 0.456 | 0.087 | 0.639 | 4e-37 | |
| 383847567 | 1254 | PREDICTED: kinesin-like protein KIF26A-l | 0.456 | 0.087 | 0.639 | 4e-37 | |
| 345485236 | 1276 | PREDICTED: kinesin-like protein CG14535- | 0.456 | 0.086 | 0.639 | 2e-36 |
| >gi|357616829|gb|EHJ70430.1| hypothetical protein KGM_08563 [Danaus plexippus] | Back alignment and taxonomy information |
|---|
Score = 171 bits (434), Expect = 2e-40, Method: Compositional matrix adjust.
Identities = 78/111 (70%), Positives = 95/111 (85%), Gaps = 1/111 (0%)
Query: 1 MFAFDAIFS-DEPQSEICTSALSDVIQAVISGSDGCLFCFGHARLGKSYTMVGSPQSSAT 59
MFAFDAIFS D+PQ+EIC+SAL+DVI AVI+G+DGCLFCFGHA LGKSYTM+G P SS+T
Sbjct: 52 MFAFDAIFSQDDPQTEICSSALTDVIHAVINGTDGCLFCFGHAGLGKSYTMLGRPDSSST 111
Query: 60 LGVIPSAISWLFRCISEQKHKTGARFSVRASAIEISSSSQHVKDLLSTYSN 110
LG IP AISWLFR I+EQKHK G RFSVR SA+E+ +++ ++DLL+ Y N
Sbjct: 112 LGAIPCAISWLFRGIAEQKHKCGTRFSVRVSAVELCTNTNQIRDLLAPYHN 162
|
Source: Danaus plexippus Species: Danaus plexippus Genus: Danaus Family: Nymphalidae Order: Lepidoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|189236427|ref|XP_972268.2| PREDICTED: similar to CG14535 CG14535-PA [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|270005919|gb|EFA02367.1| hypothetical protein TcasGA2_TC008042 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|242025241|ref|XP_002433034.1| conserved hypothetical protein [Pediculus humanus corporis] gi|212518550|gb|EEB20296.1| conserved hypothetical protein [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
| >gi|350409135|ref|XP_003488623.1| PREDICTED: hypothetical protein LOC100745168 [Bombus impatiens] | Back alignment and taxonomy information |
|---|
| >gi|340712748|ref|XP_003394917.1| PREDICTED: hypothetical protein LOC100651674 [Bombus terrestris] | Back alignment and taxonomy information |
|---|
| >gi|328787856|ref|XP_394491.4| PREDICTED: kinesin 11 [Apis mellifera] | Back alignment and taxonomy information |
|---|
| >gi|307207471|gb|EFN85182.1| Kinesin-like protein CG14535 [Harpegnathos saltator] | Back alignment and taxonomy information |
|---|
| >gi|383847567|ref|XP_003699424.1| PREDICTED: kinesin-like protein KIF26A-like [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|345485236|ref|XP_001599402.2| PREDICTED: kinesin-like protein CG14535-like [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 241 | ||||||
| UNIPROTKB|F1NW72 | 1629 | Gga.54622 "Uncharacterized pro | 0.460 | 0.068 | 0.553 | 2.1e-34 | |
| UNIPROTKB|F1MNK8 | 1525 | KIF26B "Uncharacterized protei | 0.460 | 0.072 | 0.571 | 2.2e-34 | |
| UNIPROTKB|G3MZ58 | 1595 | KIF26B "Uncharacterized protei | 0.460 | 0.069 | 0.571 | 2.7e-34 | |
| UNIPROTKB|F1S8L6 | 1612 | KIF26B "Uncharacterized protei | 0.460 | 0.068 | 0.571 | 2.8e-34 | |
| RGD|1560022 | 2111 | Kif26b "kinesin family member | 0.460 | 0.052 | 0.571 | 5.2e-34 | |
| UNIPROTKB|I3LQA2 | 1771 | KIF26B "Uncharacterized protei | 0.460 | 0.062 | 0.571 | 5.3e-34 | |
| UNIPROTKB|B7WPD9 | 1727 | KIF26B "Kinesin-like protein K | 0.460 | 0.064 | 0.571 | 9.2e-33 | |
| UNIPROTKB|Q2KJY2 | 2108 | KIF26B "Kinesin-like protein K | 0.460 | 0.052 | 0.571 | 1.6e-32 | |
| MGI|MGI:2447076 | 2112 | Kif26b "kinesin family member | 0.460 | 0.052 | 0.571 | 2.6e-32 | |
| UNIPROTKB|E1C4G2 | 2072 | E1C4G2 "Uncharacterized protei | 0.460 | 0.053 | 0.571 | 1.9e-31 |
| UNIPROTKB|F1NW72 Gga.54622 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
Score = 362 (132.5 bits), Expect = 2.1e-34, Sum P(2) = 2.1e-34
Identities = 62/112 (55%), Positives = 90/112 (80%)
Query: 1 MFAFDAIF-SDEPQSEICTSALSDVIQAVISGSDGCLFCFGHARLGKSYTMVGSPQSSAT 59
MFAFDA+F D Q+E+C+ +++VIQ+V++G+DGC+FCFGH +LGKS+TM+G S+ +
Sbjct: 117 MFAFDAVFPQDASQAEVCSGTVAEVIQSVVNGADGCIFCFGHVKLGKSFTMIGKDSSTQS 176
Query: 60 LGVIPSAISWLFRCISEQKHKTGARFSVRASAIEISSSSQHVKDLLSTYSNG 111
LG+IP AISWLF+ I+E+K KTG RFS+R SA+EIS +++KDLL+ + G
Sbjct: 177 LGIIPCAISWLFKLINERKEKTGTRFSIRVSAVEISGKDENLKDLLAEVATG 228
|
|
| UNIPROTKB|F1MNK8 KIF26B "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|G3MZ58 KIF26B "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1S8L6 KIF26B "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| RGD|1560022 Kif26b "kinesin family member 26B" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|I3LQA2 KIF26B "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|B7WPD9 KIF26B "Kinesin-like protein KIF26B" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q2KJY2 KIF26B "Kinesin-like protein KIF26B" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:2447076 Kif26b "kinesin family member 26B" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1C4G2 E1C4G2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 241 | |||
| cd00106 | 328 | cd00106, KISc, Kinesin motor domain | 3e-20 | |
| pfam00225 | 326 | pfam00225, Kinesin, Kinesin motor domain | 6e-20 | |
| smart00129 | 335 | smart00129, KISc, Kinesin motor, catalytic domain | 8e-16 | |
| cd01371 | 333 | cd01371, KISc_KIF3, Kinesin motor domain, kinesins | 4e-13 | |
| cd01374 | 321 | cd01374, KISc_CENP_E, Kinesin motor domain, CENP-E | 1e-12 | |
| cd01375 | 334 | cd01375, KISc_KIF9_like, Kinesin motor domain, KIF | 3e-12 | |
| cd01366 | 329 | cd01366, KISc_C_terminal, Kinesin motor domain, KI | 6e-12 | |
| cd01364 | 352 | cd01364, KISc_BimC_Eg5, Kinesin motor domain, BimC | 2e-11 | |
| cd01369 | 325 | cd01369, KISc_KHC_KIF5, Kinesin motor domain, kine | 6e-11 | |
| cd01370 | 338 | cd01370, KISc_KIP3_like, Kinesin motor domain, KIP | 9e-11 | |
| cd01373 | 337 | cd01373, KISc_KLP2_like, Kinesin motor domain, KLP | 2e-10 | |
| cd01372 | 341 | cd01372, KISc_KIF4, Kinesin motor domain, KIF4-lik | 3e-09 | |
| cd01365 | 356 | cd01365, KISc_KIF1A_KIF1B, Kinesin motor domain, K | 6e-09 | |
| cd01376 | 319 | cd01376, KISc_KID_like, Kinesin motor domain, KIF2 | 2e-08 | |
| cd01368 | 345 | cd01368, KISc_KIF23_like, Kinesin motor domain, KI | 6e-07 | |
| cd01367 | 322 | cd01367, KISc_KIF2_like, Kinesin motor domain, KIF | 2e-05 | |
| COG5059 | 568 | COG5059, KIP1, Kinesin-like protein [Cytoskeleton] | 0.001 | |
| cd01363 | 186 | cd01363, Motor_domain, Myosin and Kinesin motor do | 0.003 |
| >gnl|CDD|238054 cd00106, KISc, Kinesin motor domain | Back alignment and domain information |
|---|
Score = 87.3 bits (217), Expect = 3e-20
Identities = 39/113 (34%), Positives = 61/113 (53%), Gaps = 7/113 (6%)
Query: 1 MFAFDAIF-SDEPQSEICTSALSDVIQAVISGSDGCLFCFGHARLGKSYTMVGSPQSSAT 59
F FD +F + Q ++ + ++++V+ G +G +F +G GK+YTM GSP+
Sbjct: 46 SFTFDHVFDPNSTQEDVYETTAKPLVESVLEGYNGTIFAYGQTGSGKTYTMFGSPKD--- 102
Query: 60 LGVIPSAISWLFRCISEQKHKTGARFSVRASAIEISSSSQHVKDLLSTYSNGK 112
G+IP A+ LF I E+K + FSV S +EI ++ V DLLS K
Sbjct: 103 PGIIPRALEDLFNLIDERK-EKNKSFSVSVSYLEI--YNEKVYDLLSPEPPSK 152
|
This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Kinesins are microtubule-dependent molecular motors that play important roles in intracellular transport and in cell division. In most kinesins, the motor domain is found at the N-terminus (N-type), in some its is found in the middle (M-type), or C-terminal (C-type). N-type and M-type kinesins are (+) end-directed motors, while C-type kinesins are (-) end-directed motors, i.e. they transport cargo towards the (-) end of the microtubule. Kinesin motor domains hydrolyze ATP at a rate of about 80 per second, and move along the microtubule at a speed of about 6400 Angstroms per second. To achieve that, kinesin head groups work in pairs. Upon replacing ADP with ATP, a kinesin motor domain increases its affinity for microtubule binding and locks in place. Also, the neck linker binds to the motor domain, which repositions the other head domain through the coiled-coil domain close to a second tubulin dimer, about 80 Angstroms along the microtubule. Meanwhile, ATP hydrolysis takes place, and when the second head domain binds to the microtubule, the first domain again replaces ADP with ATP, triggering a conformational change that pulls the first domain forward. Length = 328 |
| >gnl|CDD|215803 pfam00225, Kinesin, Kinesin motor domain | Back alignment and domain information |
|---|
| >gnl|CDD|214526 smart00129, KISc, Kinesin motor, catalytic domain | Back alignment and domain information |
|---|
| >gnl|CDD|238667 cd01371, KISc_KIF3, Kinesin motor domain, kinesins II or KIF3_like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|238670 cd01374, KISc_CENP_E, Kinesin motor domain, CENP-E/KIP2-like subgroup, involved in chromosome movement and/or spindle elongation during mitosis | Back alignment and domain information |
|---|
| >gnl|CDD|238671 cd01375, KISc_KIF9_like, Kinesin motor domain, KIF9-like subgroup; might play a role in cell shape remodeling | Back alignment and domain information |
|---|
| >gnl|CDD|238662 cd01366, KISc_C_terminal, Kinesin motor domain, KIFC2/KIFC3/ncd-like carboxy-terminal kinesins | Back alignment and domain information |
|---|
| >gnl|CDD|238660 cd01364, KISc_BimC_Eg5, Kinesin motor domain, BimC/Eg5 spindle pole proteins, participate in spindle assembly and chromosome segregation during cell division | Back alignment and domain information |
|---|
| >gnl|CDD|238665 cd01369, KISc_KHC_KIF5, Kinesin motor domain, kinesin heavy chain (KHC) or KIF5-like subgroup | Back alignment and domain information |
|---|
| >gnl|CDD|238666 cd01370, KISc_KIP3_like, Kinesin motor domain, KIP3-like subgroup | Back alignment and domain information |
|---|
| >gnl|CDD|238669 cd01373, KISc_KLP2_like, Kinesin motor domain, KLP2-like subgroup | Back alignment and domain information |
|---|
| >gnl|CDD|238668 cd01372, KISc_KIF4, Kinesin motor domain, KIF4-like subfamily | Back alignment and domain information |
|---|
| >gnl|CDD|238661 cd01365, KISc_KIF1A_KIF1B, Kinesin motor domain, KIF1_like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|238672 cd01376, KISc_KID_like, Kinesin motor domain, KIF22/Kid-like subgroup | Back alignment and domain information |
|---|
| >gnl|CDD|238664 cd01368, KISc_KIF23_like, Kinesin motor domain, KIF23-like subgroup | Back alignment and domain information |
|---|
| >gnl|CDD|238663 cd01367, KISc_KIF2_like, Kinesin motor domain, KIF2-like group | Back alignment and domain information |
|---|
| >gnl|CDD|227392 COG5059, KIP1, Kinesin-like protein [Cytoskeleton] | Back alignment and domain information |
|---|
| >gnl|CDD|238659 cd01363, Motor_domain, Myosin and Kinesin motor domain | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 241 | |||
| KOG4280|consensus | 574 | 100.0 | ||
| cd01373 | 337 | KISc_KLP2_like Kinesin motor domain, KLP2-like sub | 100.0 | |
| cd01370 | 338 | KISc_KIP3_like Kinesin motor domain, KIP3-like sub | 100.0 | |
| KOG0243|consensus | 1041 | 100.0 | ||
| KOG0245|consensus | 1221 | 100.0 | ||
| KOG0242|consensus | 675 | 100.0 | ||
| cd01368 | 345 | KISc_KIF23_like Kinesin motor domain, KIF23-like s | 100.0 | |
| PLN03188 | 1320 | kinesin-12 family protein; Provisional | 100.0 | |
| cd01367 | 322 | KISc_KIF2_like Kinesin motor domain, KIF2-like gro | 100.0 | |
| cd01371 | 333 | KISc_KIF3 Kinesin motor domain, kinesins II or KIF | 100.0 | |
| cd01365 | 356 | KISc_KIF1A_KIF1B Kinesin motor domain, KIF1_like p | 100.0 | |
| cd01369 | 325 | KISc_KHC_KIF5 Kinesin motor domain, kinesin heavy | 100.0 | |
| KOG0240|consensus | 607 | 100.0 | ||
| cd01375 | 334 | KISc_KIF9_like Kinesin motor domain, KIF9-like sub | 100.0 | |
| cd01376 | 319 | KISc_KID_like Kinesin motor domain, KIF22/Kid-like | 100.0 | |
| cd01374 | 321 | KISc_CENP_E Kinesin motor domain, CENP-E/KIP2-like | 100.0 | |
| cd01372 | 341 | KISc_KIF4 Kinesin motor domain, KIF4-like subfamil | 100.0 | |
| cd01364 | 352 | KISc_BimC_Eg5 Kinesin motor domain, BimC/Eg5 spind | 100.0 | |
| KOG0239|consensus | 670 | 100.0 | ||
| cd01366 | 329 | KISc_C_terminal Kinesin motor domain, KIFC2/KIFC3/ | 100.0 | |
| PF00225 | 335 | Kinesin: Kinesin motor domain; InterPro: IPR001752 | 100.0 | |
| smart00129 | 335 | KISc Kinesin motor, catalytic domain. ATPase. Micr | 100.0 | |
| cd00106 | 328 | KISc Kinesin motor domain. This catalytic (head) d | 100.0 | |
| KOG0241|consensus | 1714 | 100.0 | ||
| KOG0247|consensus | 809 | 100.0 | ||
| KOG0246|consensus | 676 | 100.0 | ||
| COG5059 | 568 | KIP1 Kinesin-like protein [Cytoskeleton] | 100.0 | |
| KOG0244|consensus | 913 | 99.98 | ||
| cd01363 | 186 | Motor_domain Myosin and Kinesin motor domain. Thes | 99.89 | |
| PF00308 | 219 | Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 | 94.9 | |
| PRK06620 | 214 | hypothetical protein; Validated | 92.99 | |
| PRK06893 | 229 | DNA replication initiation factor; Validated | 92.98 | |
| COG2805 | 353 | PilT Tfp pilus assembly protein, pilus retraction | 91.94 | |
| COG0556 | 663 | UvrB Helicase subunit of the DNA excision repair c | 91.19 | |
| PRK09087 | 226 | hypothetical protein; Validated | 91.15 | |
| cd01377 | 693 | MYSc_type_II Myosin motor domain, type II myosins. | 91.04 | |
| PRK14086 | 617 | dnaA chromosomal replication initiation protein; P | 90.83 | |
| cd01378 | 674 | MYSc_type_I Myosin motor domain, type I myosins. M | 90.33 | |
| PRK14088 | 440 | dnaA chromosomal replication initiation protein; P | 90.18 | |
| PRK12377 | 248 | putative replication protein; Provisional | 90.02 | |
| PRK05642 | 234 | DNA replication initiation factor; Validated | 89.94 | |
| TIGR02928 | 365 | orc1/cdc6 family replication initiation protein. M | 89.81 | |
| cd01384 | 674 | MYSc_type_XI Myosin motor domain, plant-specific t | 89.44 | |
| PRK08116 | 268 | hypothetical protein; Validated | 89.31 | |
| PRK00149 | 450 | dnaA chromosomal replication initiation protein; R | 89.24 | |
| cd00124 | 679 | MYSc Myosin motor domain. This catalytic (head) do | 89.21 | |
| PRK08084 | 235 | DNA replication initiation factor; Provisional | 89.15 | |
| cd01382 | 717 | MYSc_type_VI Myosin motor domain, type VI myosins. | 89.05 | |
| PRK00411 | 394 | cdc6 cell division control protein 6; Reviewed | 89.05 | |
| cd00009 | 151 | AAA The AAA+ (ATPases Associated with a wide varie | 88.98 | |
| COG2804 | 500 | PulE Type II secretory pathway, ATPase PulE/Tfp pi | 88.95 | |
| cd01380 | 691 | MYSc_type_V Myosin motor domain, type V myosins. M | 88.67 | |
| TIGR00362 | 405 | DnaA chromosomal replication initiator protein Dna | 88.65 | |
| cd01386 | 767 | MYSc_type_XVIII Myosin motor domain, type XVIII my | 88.53 | |
| PRK07952 | 244 | DNA replication protein DnaC; Validated | 86.71 | |
| PF04851 | 184 | ResIII: Type III restriction enzyme, res subunit; | 86.53 | |
| PRK06526 | 254 | transposase; Provisional | 85.98 | |
| COG1474 | 366 | CDC6 Cdc6-related protein, AAA superfamily ATPase | 85.84 | |
| PRK14087 | 450 | dnaA chromosomal replication initiation protein; P | 85.73 | |
| COG0593 | 408 | DnaA ATPase involved in DNA replication initiation | 85.54 | |
| PRK08903 | 227 | DnaA regulatory inactivator Hda; Validated | 83.81 | |
| PRK08181 | 269 | transposase; Validated | 82.48 | |
| PF13245 | 76 | AAA_19: Part of AAA domain | 82.47 | |
| cd00046 | 144 | DEXDc DEAD-like helicases superfamily. A diverse f | 82.44 | |
| PRK06835 | 329 | DNA replication protein DnaC; Validated | 82.34 | |
| PF13401 | 131 | AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S | 82.29 | |
| TIGR03420 | 226 | DnaA_homol_Hda DnaA regulatory inactivator Hda. Me | 81.8 | |
| PRK08939 | 306 | primosomal protein DnaI; Reviewed | 81.66 | |
| smart00382 | 148 | AAA ATPases associated with a variety of cellular | 81.36 | |
| PRK12422 | 445 | chromosomal replication initiation protein; Provis | 81.2 | |
| COG1484 | 254 | DnaC DNA replication protein [DNA replication, rec | 80.75 | |
| PRK10436 | 462 | hypothetical protein; Provisional | 80.35 | |
| PF01695 | 178 | IstB_IS21: IstB-like ATP binding protein; InterPro | 80.29 |
| >KOG4280|consensus | Back alignment and domain information |
|---|
Probab=100.00 E-value=9.4e-52 Score=396.47 Aligned_cols=214 Identities=30% Similarity=0.429 Sum_probs=185.2
Q ss_pred CeecceecC-CCChHHHHHHHHHHHHHHHhcCCCEEEEcccccCCCcceeeccCCCCCCCCCchHHHHHHHHHHHHhccc
Q psy9852 1 MFAFDAIFS-DEPQSEICTSALSDVIQAVISGSDGCLFCFGHARLGKSYTMVGSPQSSATLGVIPSAISWLFRCISEQKH 79 (241)
Q Consensus 1 tF~FD~VF~-~a~Qe~Vy~~~v~plV~~vl~G~n~ti~aYGqtgSGKTyTm~G~~~~~~~~GIipr~~~~LF~~i~~~~~ 79 (241)
+|+||.||+ +++|++||+.++.|+|+++++|||+||||||||||||||||+|++ +...|||||++++||..|+..++
T Consensus 53 ~ftfD~vf~~~stQ~dvy~~~~~~lV~svl~GyNgtvFaYGQTGsGKTyTM~G~~--~~~~GiiPraf~~LF~~I~~~~~ 130 (574)
T KOG4280|consen 53 SFTFDAVFDSDSTQDDVYQETVAPLVESVLEGYNGTVFAYGQTGSGKTYTMIGPD--PELRGLIPRAFEHLFRHIDERKE 130 (574)
T ss_pred CceeeeeecCCCCHHHHHHHHhHHHHHHHhcccCceEEEeccCCCCCceEeeCCC--hhhCCchhHHHHHHHHHHHhccc
Confidence 599999999 999999999999999999999999999999999999999999994 56899999999999999999875
Q ss_pred CCCcEEEEEEEEEEEeCCCCeEEEcCCCCC-CCceEEEccCCcEEecCcEEEeCCCHHHHHHHHH-HhcCCCccccCCCC
Q psy9852 80 KTGARFSVRASAIEISSSSQHVKDLLSTYS-NGKFFRLCFLKRFHAEEDEEMPCPVPPPLHSNLL-TLSRDSLISNKRND 157 (241)
Q Consensus 80 ~~~~~~~V~vS~lEIY~~nE~v~DLL~~~~-~~~~l~~~~~~g~~v~glt~v~V~s~~d~~~ll~-g~~~R~~~~T~~N~ 157 (241)
. .+|.|+|||+||| ||+|+|||++.. +.+.++++|+.|+||+|++++.|.+++++..+|. |..+|++++|.||.
T Consensus 131 ~--~~f~vrvS~lEiY--nE~i~DLL~~~~~~~l~lre~p~~Gv~V~nlse~~v~s~~d~~~~l~~G~~nR~vgat~mn~ 206 (574)
T KOG4280|consen 131 K--TRFLVRVSYLEIY--NESIRDLLSPVNPKGLELREDPKCGVYVENLSEMDVESAEDAQQLLVVGLANRRVGATSMNE 206 (574)
T ss_pred c--ceEEEEeehHHHH--hHHHHHHhCccCcCCceeeEcCCCceEecCcceeecCCHHHHHHHHHHHHhhcchhhccCCc
Confidence 4 3899999999999 999999999987 5889999999999999999999999999999999 99999999999999
Q ss_pred CCch----hhhhceeeeCCCCCCccccccccccccccccccccchhhhhhhhcc-----ccccccchhhHHHHHHhhHHH
Q psy9852 158 NSSL----YSNSNERLHDPGGTGSIKSFRNFGFGSGIQYCKNDLETLEQYCKND-----FNQSTWRNDRLEQLKREKRAL 228 (241)
Q Consensus 158 ~SSr----f~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~-----~~~~~~~~~~~~~~~~~~~~~ 228 (241)
.||| ||+..+.. ..+.+...+++ .|.|+ =+||||||||.|++ ..+++.+|.+|+.|+..=.+|
T Consensus 207 ~SsRSH~ift~~i~~~--~~~~~~~~~~~----~~rln--lvDLagsEr~~~tga~G~rlkEa~~IN~SLs~LG~vI~aL 278 (574)
T KOG4280|consen 207 ESSRSHAIFTIHIESS--EKSDGGLMSGR----SSKLN--LVDLAGSERQSKTGAEGERLKEATNINLSLSALGNVISAL 278 (574)
T ss_pred ccccceEEEEEEEEee--cccCCCccccc----cceee--eeeccchhhhcccCccchhhhhhcccchhHHHHHHHHHHH
Confidence 9999 77776661 22222333333 11233 37999999999997 677777777777777654443
|
|
| >cd01373 KISc_KLP2_like Kinesin motor domain, KLP2-like subgroup | Back alignment and domain information |
|---|
| >cd01370 KISc_KIP3_like Kinesin motor domain, KIP3-like subgroup | Back alignment and domain information |
|---|
| >KOG0243|consensus | Back alignment and domain information |
|---|
| >KOG0245|consensus | Back alignment and domain information |
|---|
| >KOG0242|consensus | Back alignment and domain information |
|---|
| >cd01368 KISc_KIF23_like Kinesin motor domain, KIF23-like subgroup | Back alignment and domain information |
|---|
| >PLN03188 kinesin-12 family protein; Provisional | Back alignment and domain information |
|---|
| >cd01367 KISc_KIF2_like Kinesin motor domain, KIF2-like group | Back alignment and domain information |
|---|
| >cd01371 KISc_KIF3 Kinesin motor domain, kinesins II or KIF3_like proteins | Back alignment and domain information |
|---|
| >cd01365 KISc_KIF1A_KIF1B Kinesin motor domain, KIF1_like proteins | Back alignment and domain information |
|---|
| >cd01369 KISc_KHC_KIF5 Kinesin motor domain, kinesin heavy chain (KHC) or KIF5-like subgroup | Back alignment and domain information |
|---|
| >KOG0240|consensus | Back alignment and domain information |
|---|
| >cd01375 KISc_KIF9_like Kinesin motor domain, KIF9-like subgroup; might play a role in cell shape remodeling | Back alignment and domain information |
|---|
| >cd01376 KISc_KID_like Kinesin motor domain, KIF22/Kid-like subgroup | Back alignment and domain information |
|---|
| >cd01374 KISc_CENP_E Kinesin motor domain, CENP-E/KIP2-like subgroup, involved in chromosome movement and/or spindle elongation during mitosis | Back alignment and domain information |
|---|
| >cd01372 KISc_KIF4 Kinesin motor domain, KIF4-like subfamily | Back alignment and domain information |
|---|
| >cd01364 KISc_BimC_Eg5 Kinesin motor domain, BimC/Eg5 spindle pole proteins, participate in spindle assembly and chromosome segregation during cell division | Back alignment and domain information |
|---|
| >KOG0239|consensus | Back alignment and domain information |
|---|
| >cd01366 KISc_C_terminal Kinesin motor domain, KIFC2/KIFC3/ncd-like carboxy-terminal kinesins | Back alignment and domain information |
|---|
| >PF00225 Kinesin: Kinesin motor domain; InterPro: IPR001752 Kinesin [, , ] is a microtubule-associated force-producing protein that may play a role in organelle transport | Back alignment and domain information |
|---|
| >smart00129 KISc Kinesin motor, catalytic domain | Back alignment and domain information |
|---|
| >cd00106 KISc Kinesin motor domain | Back alignment and domain information |
|---|
| >KOG0241|consensus | Back alignment and domain information |
|---|
| >KOG0247|consensus | Back alignment and domain information |
|---|
| >KOG0246|consensus | Back alignment and domain information |
|---|
| >COG5059 KIP1 Kinesin-like protein [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0244|consensus | Back alignment and domain information |
|---|
| >cd01363 Motor_domain Myosin and Kinesin motor domain | Back alignment and domain information |
|---|
| >PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication | Back alignment and domain information |
|---|
| >PRK06620 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK06893 DNA replication initiation factor; Validated | Back alignment and domain information |
|---|
| >COG2805 PilT Tfp pilus assembly protein, pilus retraction ATPase PilT [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >COG0556 UvrB Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK09087 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >cd01377 MYSc_type_II Myosin motor domain, type II myosins | Back alignment and domain information |
|---|
| >PRK14086 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >cd01378 MYSc_type_I Myosin motor domain, type I myosins | Back alignment and domain information |
|---|
| >PRK14088 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >PRK12377 putative replication protein; Provisional | Back alignment and domain information |
|---|
| >PRK05642 DNA replication initiation factor; Validated | Back alignment and domain information |
|---|
| >TIGR02928 orc1/cdc6 family replication initiation protein | Back alignment and domain information |
|---|
| >cd01384 MYSc_type_XI Myosin motor domain, plant-specific type XI myosin, involved in organelle transport | Back alignment and domain information |
|---|
| >PRK08116 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK00149 dnaA chromosomal replication initiation protein; Reviewed | Back alignment and domain information |
|---|
| >cd00124 MYSc Myosin motor domain | Back alignment and domain information |
|---|
| >PRK08084 DNA replication initiation factor; Provisional | Back alignment and domain information |
|---|
| >cd01382 MYSc_type_VI Myosin motor domain, type VI myosins | Back alignment and domain information |
|---|
| >PRK00411 cdc6 cell division control protein 6; Reviewed | Back alignment and domain information |
|---|
| >cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold | Back alignment and domain information |
|---|
| >COG2804 PulE Type II secretory pathway, ATPase PulE/Tfp pilus assembly pathway, ATPase PilB [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >cd01380 MYSc_type_V Myosin motor domain, type V myosins | Back alignment and domain information |
|---|
| >TIGR00362 DnaA chromosomal replication initiator protein DnaA | Back alignment and domain information |
|---|
| >cd01386 MYSc_type_XVIII Myosin motor domain, type XVIII myosins | Back alignment and domain information |
|---|
| >PRK07952 DNA replication protein DnaC; Validated | Back alignment and domain information |
|---|
| >PF04851 ResIII: Type III restriction enzyme, res subunit; InterPro: IPR006935 This entry represents a domain found in the N terminus of several proteins, including helicases, the R subunit (HsdR) of type I restriction endonucleases (3 | Back alignment and domain information |
|---|
| >PRK06526 transposase; Provisional | Back alignment and domain information |
|---|
| >COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK14087 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK08903 DnaA regulatory inactivator Hda; Validated | Back alignment and domain information |
|---|
| >PRK08181 transposase; Validated | Back alignment and domain information |
|---|
| >PF13245 AAA_19: Part of AAA domain | Back alignment and domain information |
|---|
| >cd00046 DEXDc DEAD-like helicases superfamily | Back alignment and domain information |
|---|
| >PRK06835 DNA replication protein DnaC; Validated | Back alignment and domain information |
|---|
| >PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B | Back alignment and domain information |
|---|
| >TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda | Back alignment and domain information |
|---|
| >PRK08939 primosomal protein DnaI; Reviewed | Back alignment and domain information |
|---|
| >smart00382 AAA ATPases associated with a variety of cellular activities | Back alignment and domain information |
|---|
| >PRK12422 chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK10436 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 241 | ||||
| 3nwn_A | 359 | Crystal Structure Of The Human Kif9 Motor Domain In | 8e-12 | ||
| 3b6v_A | 395 | Crystal Structure Of The Motor Domain Of Human Kine | 2e-10 | ||
| 4h1g_A | 715 | Structure Of Candida Albicans Kar3 Motor Domain Fus | 4e-10 | ||
| 3b6u_A | 372 | Crystal Structure Of The Motor Domain Of Human Kine | 7e-10 | ||
| 1cz7_A | 406 | The Crystal Structure Of A Minus-End Directed Micro | 3e-09 | ||
| 3l1c_A | 383 | Kinesin-14 Protein Ncd, T436s Mutant Length = 383 | 3e-09 | ||
| 2ncd_A | 420 | Ncd (Non-Claret Disjunctional) Dimer From D. Melano | 3e-09 | ||
| 3u06_A | 412 | Crystal Structure Of The Kinesin-14 Ncdg347d Length | 3e-09 | ||
| 1n6m_A | 409 | Rotation Of The StalkNECK AND ONE HEAD IN A NEW CRY | 3e-09 | ||
| 2rep_A | 376 | Crystal Structure Of The Motor Domain Of Human Kine | 1e-08 | ||
| 1f9t_A | 358 | Crystal Structures Of Kinesin Mutants Reveal A Sign | 2e-08 | ||
| 3kar_A | 346 | The Motor Domain Of Kinesin-Like Protein Kar3, A Sa | 3e-08 | ||
| 1f9v_A | 347 | Crystal Structures Of Mutants Reveal A Signalling P | 3e-08 | ||
| 1f9u_A | 347 | Crystal Structures Of Mutants Reveal A Signalling P | 3e-08 | ||
| 1f9w_A | 347 | Crystal Structures Of Mutants Reveal A Signalling P | 3e-08 | ||
| 1t5c_A | 349 | Crystal Structure Of The Motor Domain Of Human Kine | 5e-08 | ||
| 4etp_A | 403 | C-Terminal Motor And Motor Homology Domain Of Kar3v | 5e-08 | ||
| 1goj_A | 355 | Structure Of A Fast Kinesin: Implications For Atpas | 5e-07 | ||
| 2wbe_C | 373 | Kinesin-5-Tubulin Complex With Amppnp Length = 373 | 7e-07 | ||
| 2y5w_A | 365 | Crystal Structure Of Drosophila Melanogaster Kinesi | 7e-07 | ||
| 1bg2_A | 325 | Human Ubiquitous Kinesin Motor Domain Length = 325 | 1e-06 | ||
| 1mkj_A | 349 | Human Kinesin Motor Domain With Docked Neck Linker | 1e-06 | ||
| 4atx_C | 340 | Rigor Kinesin Motor Domain With An Ordered Neck-Lin | 1e-06 | ||
| 4aqv_C | 373 | Model Of Human Kinesin-5 Motor Domain (3hqd) And Ma | 1e-06 | ||
| 4gkr_A | 371 | Structure Of The C-Terminal Motor Domain Of Kar3 Fr | 2e-06 | ||
| 2owm_A | 443 | Motor Domain Of Neurospora Crassa Kinesin-3 (Nckin3 | 3e-06 | ||
| 3t0q_A | 349 | Motor Domain Structure Of The Kar3-Like Kinesin Fro | 3e-06 | ||
| 1x88_A | 359 | Human Eg5 Motor Domain Bound To Mg-Adp And Monastro | 5e-06 | ||
| 3hqd_A | 369 | Human Kinesin Eg5 Motor Domain In Complex With Ampp | 6e-06 | ||
| 1ii6_A | 368 | Crystal Structure Of The Mitotic Kinesin Eg5 In Com | 6e-06 | ||
| 1q0b_A | 367 | Crystal Structure Of The Motor Protein Ksp In Compl | 6e-06 | ||
| 3zcw_A | 348 | Eg5 - New Allosteric Binding Site Length = 348 | 6e-06 | ||
| 4ap0_A | 370 | The Mitotic Kinesin Eg5 In Complex With Mg-Adp And | 6e-06 | ||
| 4a28_A | 368 | Eg5-2 Length = 368 | 6e-06 | ||
| 4a1z_A | 368 | Eg5-1 Length = 368 | 7e-06 | ||
| 3bfn_A | 388 | Crystal Structure Of The Motor Domain Of Human Kine | 7e-06 | ||
| 1vfv_A | 366 | Crystal Structure Of The Kif1a Motor Domain Complex | 1e-05 | ||
| 1ia0_K | 394 | Kif1a Head-Microtubule Complex Structure In Atp-For | 1e-05 | ||
| 1i5s_A | 367 | Crystal Structure Of The Kif1a Motor Domain Complex | 1e-05 | ||
| 1i6i_A | 366 | Crystal Structure Of The Kif1a Motor Domain Complex | 1e-05 | ||
| 2h58_A | 330 | Crystal Structure Of The Kifc3 Motor Domain In Comp | 1e-05 | ||
| 3gbj_A | 354 | Crystal Structure Of The Motor Domain Of Kinesin Ki | 2e-05 | ||
| 1sdm_A | 369 | Crystal Structure Of Kinesin-Like Calmodulin Bindin | 4e-05 | ||
| 2kin_A | 238 | Kinesin (Monomeric) From Rattus Norvegicus Length = | 4e-05 | ||
| 3lre_A | 355 | Crystal Structure Analysis Of Human Kinesin-8 Motor | 7e-05 | ||
| 2vvg_A | 350 | Crystal Structure Of The G.Intestinalis Kinesin 2 G | 3e-04 |
| >pdb|3NWN|A Chain A, Crystal Structure Of The Human Kif9 Motor Domain In Complex With Adp Length = 359 | Back alignment and structure |
|
| >pdb|3B6V|A Chain A, Crystal Structure Of The Motor Domain Of Human Kinesin Family Member 3c In Complex With Adp Length = 395 | Back alignment and structure |
| >pdb|4H1G|A Chain A, Structure Of Candida Albicans Kar3 Motor Domain Fused To Maltose- Binding Protein Length = 715 | Back alignment and structure |
| >pdb|3B6U|A Chain A, Crystal Structure Of The Motor Domain Of Human Kinesin Family Member 3b In Complex With Adp Length = 372 | Back alignment and structure |
| >pdb|1CZ7|A Chain A, The Crystal Structure Of A Minus-End Directed Microtubule Motor Protein Ncd Reveals Variable Dimer Conformations Length = 406 | Back alignment and structure |
| >pdb|3L1C|A Chain A, Kinesin-14 Protein Ncd, T436s Mutant Length = 383 | Back alignment and structure |
| >pdb|2NCD|A Chain A, Ncd (Non-Claret Disjunctional) Dimer From D. Melanogaster Length = 420 | Back alignment and structure |
| >pdb|3U06|A Chain A, Crystal Structure Of The Kinesin-14 Ncdg347d Length = 412 | Back alignment and structure |
| >pdb|1N6M|A Chain A, Rotation Of The StalkNECK AND ONE HEAD IN A NEW CRYSTAL Structure Of The Kinesin Motor Protein, Ncd Length = 409 | Back alignment and structure |
| >pdb|2REP|A Chain A, Crystal Structure Of The Motor Domain Of Human Kinesin Family Member C1 Length = 376 | Back alignment and structure |
| >pdb|1F9T|A Chain A, Crystal Structures Of Kinesin Mutants Reveal A Signalling Pathway For Activation Of The Motor Atpase Length = 358 | Back alignment and structure |
| >pdb|3KAR|A Chain A, The Motor Domain Of Kinesin-Like Protein Kar3, A Saccharomyces Cerevisiae Kinesin-Related Protein Length = 346 | Back alignment and structure |
| >pdb|1F9V|A Chain A, Crystal Structures Of Mutants Reveal A Signalling Pathway For Activation Of The Kinesin Motor Atpase Length = 347 | Back alignment and structure |
| >pdb|1F9U|A Chain A, Crystal Structures Of Mutants Reveal A Signalling Pathway For Activation Of The Kinesin Motor Atpase Length = 347 | Back alignment and structure |
| >pdb|1F9W|A Chain A, Crystal Structures Of Mutants Reveal A Signalling Pathway For Activation Of The Kinesin Motor Atpase Length = 347 | Back alignment and structure |
| >pdb|1T5C|A Chain A, Crystal Structure Of The Motor Domain Of Human Kinetochore Protein Cenp-E Length = 349 | Back alignment and structure |
| >pdb|4ETP|A Chain A, C-Terminal Motor And Motor Homology Domain Of Kar3vik1 Fused To A Synthetic Heterodimeric Coiled Coil Length = 403 | Back alignment and structure |
| >pdb|1GOJ|A Chain A, Structure Of A Fast Kinesin: Implications For Atpase Mechanism And Interactions With Microtubules Length = 355 | Back alignment and structure |
| >pdb|2WBE|C Chain C, Kinesin-5-Tubulin Complex With Amppnp Length = 373 | Back alignment and structure |
| >pdb|2Y5W|A Chain A, Crystal Structure Of Drosophila Melanogaster Kinesin-1 Motor Domain Dimer Length = 365 | Back alignment and structure |
| >pdb|1BG2|A Chain A, Human Ubiquitous Kinesin Motor Domain Length = 325 | Back alignment and structure |
| >pdb|1MKJ|A Chain A, Human Kinesin Motor Domain With Docked Neck Linker Length = 349 | Back alignment and structure |
| >pdb|4ATX|C Chain C, Rigor Kinesin Motor Domain With An Ordered Neck-Linker, Docked On Tubulin Dimer, Modelled Into The 8a Cryo-Em Map Of Doublecortin-Microtubules Decorated With Kinesin Length = 340 | Back alignment and structure |
| >pdb|4AQV|C Chain C, Model Of Human Kinesin-5 Motor Domain (3hqd) And Mammalian Tubulin Heterodimer (1jff) Docked Into The 9.7-angstrom Cryo-em Map Of Microtubule-bound Kinesin-5 Motor Domain In The Ampppnp State. Length = 373 | Back alignment and structure |
| >pdb|4GKR|A Chain A, Structure Of The C-Terminal Motor Domain Of Kar3 From Candida Glabrata Length = 371 | Back alignment and structure |
| >pdb|2OWM|A Chain A, Motor Domain Of Neurospora Crassa Kinesin-3 (Nckin3) Length = 443 | Back alignment and structure |
| >pdb|3T0Q|A Chain A, Motor Domain Structure Of The Kar3-Like Kinesin From Ashbya Gossypii Length = 349 | Back alignment and structure |
| >pdb|1X88|A Chain A, Human Eg5 Motor Domain Bound To Mg-Adp And Monastrol Length = 359 | Back alignment and structure |
| >pdb|3HQD|A Chain A, Human Kinesin Eg5 Motor Domain In Complex With Amppnp And Mg2+ Length = 369 | Back alignment and structure |
| >pdb|1II6|A Chain A, Crystal Structure Of The Mitotic Kinesin Eg5 In Complex With Mg-Adp. Length = 368 | Back alignment and structure |
| >pdb|1Q0B|A Chain A, Crystal Structure Of The Motor Protein Ksp In Complex With Adp And Monastrol Length = 367 | Back alignment and structure |
| >pdb|3ZCW|A Chain A, Eg5 - New Allosteric Binding Site Length = 348 | Back alignment and structure |
| >pdb|4AP0|A Chain A, The Mitotic Kinesin Eg5 In Complex With Mg-Adp And Ispinesib Length = 370 | Back alignment and structure |
| >pdb|4A28|A Chain A, Eg5-2 Length = 368 | Back alignment and structure |
| >pdb|4A1Z|A Chain A, Eg5-1 Length = 368 | Back alignment and structure |
| >pdb|3BFN|A Chain A, Crystal Structure Of The Motor Domain Of Human Kinesin Family Member 22 Length = 388 | Back alignment and structure |
| >pdb|1VFV|A Chain A, Crystal Structure Of The Kif1a Motor Domain Complexed With Mg-Amppnp Length = 366 | Back alignment and structure |
| >pdb|1IA0|K Chain K, Kif1a Head-Microtubule Complex Structure In Atp-Form Length = 394 | Back alignment and structure |
| >pdb|1I5S|A Chain A, Crystal Structure Of The Kif1a Motor Domain Complexed With Mg-Adp Length = 367 | Back alignment and structure |
| >pdb|1I6I|A Chain A, Crystal Structure Of The Kif1a Motor Domain Complexed With Mg-Amppcp Length = 366 | Back alignment and structure |
| >pdb|2H58|A Chain A, Crystal Structure Of The Kifc3 Motor Domain In Complex With Adp Length = 330 | Back alignment and structure |
| >pdb|3GBJ|A Chain A, Crystal Structure Of The Motor Domain Of Kinesin Kif13b Bound With Adp Length = 354 | Back alignment and structure |
| >pdb|1SDM|A Chain A, Crystal Structure Of Kinesin-Like Calmodulin Binding Protein Length = 369 | Back alignment and structure |
| >pdb|2KIN|A Chain A, Kinesin (Monomeric) From Rattus Norvegicus Length = 238 | Back alignment and structure |
| >pdb|3LRE|A Chain A, Crystal Structure Analysis Of Human Kinesin-8 Motor Domain Length = 355 | Back alignment and structure |
| >pdb|2VVG|A Chain A, Crystal Structure Of The G.Intestinalis Kinesin 2 Gikin2a Motor Domain Length = 350 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 241 | |||
| 2nr8_A | 358 | Kinesin-like protein KIF9; motor domain, ADP, stru | 2e-18 | |
| 1bg2_A | 325 | Kinesin; motor protein, ATPase, microtubule associ | 1e-17 | |
| 3b6u_A | 372 | Kinesin-like protein KIF3B; structural genomics co | 2e-17 | |
| 1t5c_A | 349 | CENP-E protein, centromeric protein E; kinesin mot | 5e-17 | |
| 2y65_A | 365 | Kinesin, kinesin heavy chain; motor protein; HET: | 6e-17 | |
| 2vvg_A | 350 | Kinesin-2; motor protein, nucleotide-binding, micr | 2e-16 | |
| 3dc4_A | 344 | Kinesin-like protein NOD; catalytic domain, ATPase | 2e-16 | |
| 1goj_A | 355 | Kinesin, kinesin heavy chain; motor protein, ATPas | 4e-16 | |
| 3bfn_A | 388 | Kinesin-like protein KIF22; limited proteolysis, s | 1e-15 | |
| 3lre_A | 355 | Kinesin-like protein KIF18A; motor protein, nucleo | 1e-15 | |
| 3cob_A | 369 | Kinesin heavy chain-like protein; motor, switch II | 2e-15 | |
| 3u06_A | 412 | Protein claret segregational; motor domain, stalk | 4e-15 | |
| 1f9v_A | 347 | Kinesin-like protein KAR3; kinesin-related protein | 6e-15 | |
| 2h58_A | 330 | Kinesin-like protein KIFC3 variant; motor domain, | 7e-15 | |
| 3t0q_A | 349 | AGR253WP; kinesin, alpha and beta proteins, P-loop | 7e-15 | |
| 4a14_A | 344 | Kinesin, kinesin-like protein KIF7; motor protein, | 9e-15 | |
| 1x88_A | 359 | Kinesin-like protein KIF11; switch II, motor domai | 1e-14 | |
| 4etp_A | 403 | Kinesin-like protein KAR3; kinesin motor protein, | 2e-14 | |
| 2wbe_C | 373 | Bipolar kinesin KRP-130; EG5, KLP61F, tubulin, mit | 2e-14 | |
| 2rep_A | 376 | Kinesin-like protein KIFC1; structural genomics co | 3e-14 | |
| 2owm_A | 443 | Nckin3-434, related to kinesin-like protein KIF1C; | 1e-13 | |
| 2zfi_A | 366 | Kinesin-like protein KIF1A, kinesin heavy chain is | 5e-13 | |
| 2heh_A | 387 | KIF2C protein; kinesin, motor domain, ADP, structu | 6e-13 | |
| 3gbj_A | 354 | KIF13B protein; kinesin, motor domain, ADP, struct | 7e-13 | |
| 1v8k_A | 410 | Kinesin-like protein KIF2C; microtubule destabiliz | 2e-12 | |
| 1ry6_A | 360 | Internal kinesin; kinesin motor domain, nucleotide | 5e-11 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 5e-05 |
| >1bg2_A Kinesin; motor protein, ATPase, microtubule associated; HET: ADP; 1.80A {Homo sapiens} SCOP: c.37.1.9 PDB: 2p4n_K* 1mkj_A* 2kin_A* 3kin_A* Length = 325 | Back alignment and structure |
|---|
| >3b6u_A Kinesin-like protein KIF3B; structural genomics consortium, motor domain, ADP, SGC, ATP-binding, coiled coil, microtubule, motor protein; HET: ADP; 1.80A {Homo sapiens} PDB: 3b6v_A* Length = 372 | Back alignment and structure |
|---|
| >1t5c_A CENP-E protein, centromeric protein E; kinesin motor-domain-ADP complex, stranded beta-sheet core with solvent exposed alpha-helices; HET: ADP PIN; 2.50A {Homo sapiens} Length = 349 | Back alignment and structure |
|---|
| >2y65_A Kinesin, kinesin heavy chain; motor protein; HET: ADP; 2.20A {Drosophila melanogaster} PDB: 2y5w_A* Length = 365 | Back alignment and structure |
|---|
| >2vvg_A Kinesin-2; motor protein, nucleotide-binding, microtubule, ATP-binding; HET: ADP; 1.60A {Giardia intestinalis} Length = 350 | Back alignment and structure |
|---|
| >3dc4_A Kinesin-like protein NOD; catalytic domain, ATPase, microtubule, ADP, nucleotide-binding protein, ATP-binding, coiled coil, motor protein; HET: ADP; 1.90A {Drosophila melanogaster} PDB: 3dcb_A* 3dco_N* 3pxn_A* Length = 344 | Back alignment and structure |
|---|
| >1goj_A Kinesin, kinesin heavy chain; motor protein, ATPase; HET: ADP; 2.3A {Neurospora crassa} SCOP: c.37.1.9 Length = 355 | Back alignment and structure |
|---|
| >3bfn_A Kinesin-like protein KIF22; limited proteolysis, structural genomics consortium domain, ADP, SGC, ATP-binding, DNA-binding, microtubule, MO protein; HET: ADP; 2.30A {Homo sapiens} Length = 388 | Back alignment and structure |
|---|
| >3lre_A Kinesin-like protein KIF18A; motor protein, nucleotide binding, microtubule binding, ATP- cell projection, cytoskeleton, glycoprotein, microtubule; HET: ADP; 2.20A {Homo sapiens} Length = 355 | Back alignment and structure |
|---|
| >3cob_A Kinesin heavy chain-like protein; motor, switch II, loop L11, conformation, nucleotide, ATP-binding, microtubule, motor protein; HET: ADP; 2.20A {Solanum tuberosum} SCOP: c.37.1.9 PDB: 3cnz_A* 1sdm_A* 3h4s_A* Length = 369 | Back alignment and structure |
|---|
| >3u06_A Protein claret segregational; motor domain, stalk rotation, power stroke, kinesin-14, MICR binding, NCD, transport, molecular motor; HET: ADP GOL; 2.35A {Drosophila melanogaster} PDB: 2ncd_A* 1n6m_A* 1cz7_A* 3l1c_A* Length = 412 | Back alignment and structure |
|---|
| >1f9v_A Kinesin-like protein KAR3; kinesin-related protein, motor protein, microtubinding proteinbule, contractIle protein; HET: ADP; 1.30A {Saccharomyces cerevisiae} SCOP: c.37.1.9 PDB: 1f9t_A* 1f9w_A* 1f9u_A* 3kar_A* Length = 347 | Back alignment and structure |
|---|
| >2h58_A Kinesin-like protein KIFC3 variant; motor domain, ADP, structural genomics, structur Al genomics consortium, SGC; HET: ADP; 1.85A {Homo sapiens} Length = 330 | Back alignment and structure |
|---|
| >3t0q_A AGR253WP; kinesin, alpha and beta proteins, P-loop containing nucleosi triphosphate hydrolases, microtubule motor protein; HET: ADP; 2.35A {Ashbya gossypii} Length = 349 | Back alignment and structure |
|---|
| >4a14_A Kinesin, kinesin-like protein KIF7; motor protein, motor domain; HET: ADP; 1.60A {Homo sapiens} PDB: 2xt3_A* Length = 344 | Back alignment and structure |
|---|
| >1x88_A Kinesin-like protein KIF11; switch II, motor domain, NECK linker, cell cycle; HET: ADP NAT; 1.80A {Homo sapiens} SCOP: c.37.1.9 PDB: 3hqd_A* 3ken_A* 2pg2_A* 1yrs_A* 2fme_A* 2g1q_A* 2gm1_A* 1ii6_A* 2uyi_A* 2uym_A* 2wog_A* 2x2r_A* 2x7c_A* 2x7d_A* 2x7e_A* 2xae_A* 3k3b_A* 3k5e_A* 3l9h_A* 1q0b_A* ... Length = 359 | Back alignment and structure |
|---|
| >4etp_A Kinesin-like protein KAR3; kinesin motor protein, kinesin motor homology domain, karyog mitosis, microtubules; HET: ADP EBC; 2.30A {Saccharomyces cerevisiae} Length = 403 | Back alignment and structure |
|---|
| >2wbe_C Bipolar kinesin KRP-130; EG5, KLP61F, tubulin, mitosis, GTP-binding, motor protein, cell division, cell cycle, microtubule, ATP-binding; HET: GTP ANP GDP TA1; 9.40A {Drosophila melanogaster} Length = 373 | Back alignment and structure |
|---|
| >2rep_A Kinesin-like protein KIFC1; structural genomics consortium, motor domain, ADP, binding, cell cycle, cell division, endosome, microtubule; HET: ADP; 2.60A {Homo sapiens} Length = 376 | Back alignment and structure |
|---|
| >2owm_A Nckin3-434, related to kinesin-like protein KIF1C; motor domain, ADP, NECK linker, motor PR; HET: ADP; 3.25A {Neurospora crassa} Length = 443 | Back alignment and structure |
|---|
| >2zfi_A Kinesin-like protein KIF1A, kinesin heavy chain isoform 5C; alpha and beta protein, enzyme, ATPase, P-loop, motor protein, ATP-binding, coiled coil; HET: ADP; 1.55A {Mus musculus} SCOP: c.37.1.9 PDB: 1vfw_A* 1vfx_A* 1vfz_A* 1vfv_A* 2zfj_A* 2zfk_A* 2zfl_A* 2zfm_A* 1i5s_A* 1i6i_A* 2hxf_C* 1ia0_K* 2hxh_C* Length = 366 | Back alignment and structure |
|---|
| >2heh_A KIF2C protein; kinesin, motor domain, ADP, structural genomics, structural genomics consortium, SGC, structural protein; HET: ADP; 2.15A {Homo sapiens} PDB: 3edl_D* Length = 387 | Back alignment and structure |
|---|
| >3gbj_A KIF13B protein; kinesin, motor domain, ADP, structural genomics, structural genomics consortium, SGC, ATP-binding, microtubule, motor protein; HET: ADP; 2.10A {Homo sapiens} Length = 354 | Back alignment and structure |
|---|
| >1v8k_A Kinesin-like protein KIF2C; microtubule destabilizer, structural P; HET: ANP; 2.25A {Mus musculus} SCOP: c.37.1.9 PDB: 1v8j_A* 2gry_A* Length = 410 | Back alignment and structure |
|---|
| >1ry6_A Internal kinesin; kinesin motor domain, nucleotide-free, transport protein; 1.60A {Plasmodium falciparum} SCOP: c.37.1.9 Length = 360 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 241 | |||
| 2y65_A | 365 | Kinesin, kinesin heavy chain; motor protein; HET: | 100.0 | |
| 1bg2_A | 325 | Kinesin; motor protein, ATPase, microtubule associ | 100.0 | |
| 2owm_A | 443 | Nckin3-434, related to kinesin-like protein KIF1C; | 100.0 | |
| 2zfi_A | 366 | Kinesin-like protein KIF1A, kinesin heavy chain is | 100.0 | |
| 3lre_A | 355 | Kinesin-like protein KIF18A; motor protein, nucleo | 100.0 | |
| 3bfn_A | 388 | Kinesin-like protein KIF22; limited proteolysis, s | 100.0 | |
| 1t5c_A | 349 | CENP-E protein, centromeric protein E; kinesin mot | 100.0 | |
| 2vvg_A | 350 | Kinesin-2; motor protein, nucleotide-binding, micr | 100.0 | |
| 1goj_A | 355 | Kinesin, kinesin heavy chain; motor protein, ATPas | 100.0 | |
| 3b6u_A | 372 | Kinesin-like protein KIF3B; structural genomics co | 100.0 | |
| 2h58_A | 330 | Kinesin-like protein KIFC3 variant; motor domain, | 100.0 | |
| 3cob_A | 369 | Kinesin heavy chain-like protein; motor, switch II | 100.0 | |
| 1f9v_A | 347 | Kinesin-like protein KAR3; kinesin-related protein | 100.0 | |
| 4a14_A | 344 | Kinesin, kinesin-like protein KIF7; motor protein, | 100.0 | |
| 3gbj_A | 354 | KIF13B protein; kinesin, motor domain, ADP, struct | 100.0 | |
| 2rep_A | 376 | Kinesin-like protein KIFC1; structural genomics co | 100.0 | |
| 3nwn_A | 359 | Kinesin-like protein KIF9; motor domain, ADP, stru | 100.0 | |
| 2nr8_A | 358 | Kinesin-like protein KIF9; motor domain, ADP, stru | 100.0 | |
| 1x88_A | 359 | Kinesin-like protein KIF11; switch II, motor domai | 100.0 | |
| 3t0q_A | 349 | AGR253WP; kinesin, alpha and beta proteins, P-loop | 100.0 | |
| 2wbe_C | 373 | Bipolar kinesin KRP-130; EG5, KLP61F, tubulin, mit | 100.0 | |
| 2heh_A | 387 | KIF2C protein; kinesin, motor domain, ADP, structu | 100.0 | |
| 4etp_A | 403 | Kinesin-like protein KAR3; kinesin motor protein, | 100.0 | |
| 1v8k_A | 410 | Kinesin-like protein KIF2C; microtubule destabiliz | 100.0 | |
| 3u06_A | 412 | Protein claret segregational; motor domain, stalk | 100.0 | |
| 1ry6_A | 360 | Internal kinesin; kinesin motor domain, nucleotide | 100.0 | |
| 3dc4_A | 344 | Kinesin-like protein NOD; catalytic domain, ATPase | 100.0 | |
| 4h1g_A | 715 | Maltose binding protein-cakar3 motor domain fusio; | 100.0 | |
| 2o0a_A | 298 | S.cerevisiae chromosome XVI reading frame ORF YPL2 | 99.85 | |
| 3ec2_A | 180 | DNA replication protein DNAC; helicase loader, rep | 94.52 | |
| 2w58_A | 202 | DNAI, primosome component (helicase loader); ATP-b | 93.18 | |
| 2qgz_A | 308 | Helicase loader, putative primosome component; str | 91.67 | |
| 1jbk_A | 195 | CLPB protein; beta barrel, chaperone; 1.80A {Esche | 89.94 | |
| 2p65_A | 187 | Hypothetical protein PF08_0063; CLPB, malaria, str | 89.15 | |
| 3te6_A | 318 | Regulatory protein SIR3; heterochromatin, gene sil | 87.76 | |
| 4b4t_K | 428 | 26S protease regulatory subunit 6B homolog; hydrol | 87.21 | |
| 3t15_A | 293 | Ribulose bisphosphate carboxylase/oxygenase activ | 86.94 | |
| 4b4t_M | 434 | 26S protease regulatory subunit 6A; hydrolase, AAA | 86.92 | |
| 4anj_A | 1052 | Unconventional myosin-VI, green fluorescent prote; | 86.15 | |
| 1l8q_A | 324 | Chromosomal replication initiator protein DNAA; AA | 85.48 | |
| 2bjv_A | 265 | PSP operon transcriptional activator; AAA, transcr | 84.58 | |
| 2r62_A | 268 | Cell division protease FTSH homolog; ATPase domain | 84.55 | |
| 3cf0_A | 301 | Transitional endoplasmic reticulum ATPase; AAA, P9 | 83.48 | |
| 2chg_A | 226 | Replication factor C small subunit; DNA-binding pr | 82.79 | |
| 3h4m_A | 285 | Proteasome-activating nucleotidase; ATPase, PAN, A | 82.76 | |
| 4b4t_J | 405 | 26S protease regulatory subunit 8 homolog; hydrola | 82.72 | |
| 2v1u_A | 387 | Cell division control protein 6 homolog; DNA repli | 82.48 | |
| 1d2n_A | 272 | N-ethylmaleimide-sensitive fusion protein; hexamer | 82.42 | |
| 3bos_A | 242 | Putative DNA replication factor; P-loop containing | 81.89 | |
| 1g8p_A | 350 | Magnesium-chelatase 38 kDa subunit; parallel beta | 81.07 | |
| 4b4t_L | 437 | 26S protease subunit RPT4; hydrolase, AAA-atpases, | 80.52 | |
| 1ixz_A | 254 | ATP-dependent metalloprotease FTSH; AAA domain fol | 80.5 | |
| 1fnn_A | 389 | CDC6P, cell division control protein 6; ORC1, AAA | 80.03 |
| >2y65_A Kinesin, kinesin heavy chain; motor protein; HET: ADP; 2.20A {Drosophila melanogaster} PDB: 2y5w_A* | Back alignment and structure |
|---|
Probab=100.00 E-value=3.6e-52 Score=384.75 Aligned_cols=209 Identities=20% Similarity=0.277 Sum_probs=166.7
Q ss_pred CeecceecC-CCChHHHHHHHHHHHHHHHhcCCCEEEEcccccCCCcceeeccCCCCCCCCCchHHHHHHHHHHHHhccc
Q psy9852 1 MFAFDAIFS-DEPQSEICTSALSDVIQAVISGSDGCLFCFGHARLGKSYTMVGSPQSSATLGVIPSAISWLFRCISEQKH 79 (241)
Q Consensus 1 tF~FD~VF~-~a~Qe~Vy~~~v~plV~~vl~G~n~ti~aYGqtgSGKTyTm~G~~~~~~~~GIipr~~~~LF~~i~~~~~ 79 (241)
+|.||+||+ +++|++||+.++.|+|+++++|||+||||||||||||||||+|...++..+|||||++++||+.+.....
T Consensus 52 ~f~FD~Vf~~~~~Q~~Vy~~~~~plv~~~l~G~n~tifAYGqTGSGKTyTm~G~~~~~~~~Giipr~~~~lF~~i~~~~~ 131 (365)
T 2y65_A 52 VYLFDKVFKPNASQEKVYNEAAKSIVTDVLAGYNGTIFAYGQTSSGKTHTMEGVIGDSVKQGIIPRIVNDIFNHIYAMEV 131 (365)
T ss_dssp EEECSEEECTTCCHHHHHHHHTHHHHHHHHTTCCEEEEEECSTTSSHHHHHTBSTTCTTTBCHHHHHHHHHHHHHHHCCS
T ss_pred EEeCceEecCCCCHHHHHHHhhhhHHHHHhCCCceEEEeecCCCCCCceEEecCCCCcccCChHHHHHHHHHHHHHhccC
Confidence 499999999 9999999999999999999999999999999999999999999887767899999999999999987543
Q ss_pred CCCcEEEEEEEEEEEeCCCCeEEEcCCCCCCCceEEEccCCcEEecCcEEEeCCCHHHHHHHHH-HhcCCCccccCCCCC
Q psy9852 80 KTGARFSVRASAIEISSSSQHVKDLLSTYSNGKFFRLCFLKRFHAEEDEEMPCPVPPPLHSNLL-TLSRDSLISNKRNDN 158 (241)
Q Consensus 80 ~~~~~~~V~vS~lEIY~~nE~v~DLL~~~~~~~~l~~~~~~g~~v~glt~v~V~s~~d~~~ll~-g~~~R~~~~T~~N~~ 158 (241)
++.|.|.+||+||| ||+|+|||++....+.+++++.++++|+|++++.|.+++|++++|+ |.++|++++|.||+.
T Consensus 132 --~~~~~v~vS~~EIY--nE~i~DLL~~~~~~l~i~e~~~~~~~v~gl~~~~V~s~~e~~~ll~~g~~~R~~~~T~~N~~ 207 (365)
T 2y65_A 132 --NLEFHIKVSYYEIY--MDKIRDLLDVSKVNLSVHEDKNRVPYVKGATERFVSSPEDVFEVIEEGKSNRHIAVTNMNEH 207 (365)
T ss_dssp --CEEEEEEEEEEEEE--TTEEEETTCTTCCSBCEEECSSSCEEETTCCCEEECSHHHHHHHHHHHHHHHTTTCSCHHHH
T ss_pred --CceEEEEEEEEEEE--CCeeeecccCCcCCceEEECCCCCEEecCCEEEecCCHHHHHHHHHHHHhhcccccccCCCC
Confidence 57999999999999 9999999999888899999999999999999999999999999999 999999999999999
Q ss_pred Cch----hhhhceeeeCCCCCCccccccccccccccccccccchhhhhhhhccccccccchhhHHHHHHhhHHHH
Q psy9852 159 SSL----YSNSNERLHDPGGTGSIKSFRNFGFGSGIQYCKNDLETLEQYCKNDFNQSTWRNDRLEQLKREKRALL 229 (241)
Q Consensus 159 SSr----f~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 229 (241)
||| |++..++.....+ .. ..|-|.. +|||||||+.+++ ..+.|+.|...||+||+
T Consensus 208 SSRSH~if~i~v~~~~~~~~--~~-------~~skL~l--VDLAGSEr~~~t~-----~~g~rl~E~~~INkSL~ 266 (365)
T 2y65_A 208 SSRSHSVFLINVKQENLENQ--KK-------LSGKLYL--VDLAGSEKVSKTG-----AEGTVLDEAKNINKSLS 266 (365)
T ss_dssp HHTSEEEEEEEEEEEETTTC--CE-------EEEEEEE--EECCCCCC---------------------CCHHHH
T ss_pred CCCceEEEEEEEEEEecCCC--CE-------eEEEEEE--EECCCCCcchhcC-----CcchhHHHHHHHHHHHH
Confidence 999 4444333322111 00 0011222 6999999987764 34556666666666654
|
| >1bg2_A Kinesin; motor protein, ATPase, microtubule associated; HET: ADP; 1.80A {Homo sapiens} SCOP: c.37.1.9 PDB: 2p4n_K* 1mkj_A* 2kin_A* 3kin_A* | Back alignment and structure |
|---|
| >2owm_A Nckin3-434, related to kinesin-like protein KIF1C; motor domain, ADP, NECK linker, motor PR; HET: ADP; 3.25A {Neurospora crassa} | Back alignment and structure |
|---|
| >2zfi_A Kinesin-like protein KIF1A, kinesin heavy chain isoform 5C; alpha and beta protein, enzyme, ATPase, P-loop, motor protein, ATP-binding, coiled coil; HET: ADP; 1.55A {Mus musculus} SCOP: c.37.1.9 PDB: 1vfw_A* 1vfx_A* 1vfz_A* 1vfv_A* 2zfj_A* 2zfk_A* 2zfl_A* 2zfm_A* 1i5s_A* 1i6i_A* 2hxf_C* 1ia0_K* 2hxh_C* | Back alignment and structure |
|---|
| >3lre_A Kinesin-like protein KIF18A; motor protein, nucleotide binding, microtubule binding, ATP- cell projection, cytoskeleton, glycoprotein, microtubule; HET: ADP; 2.20A {Homo sapiens} SCOP: c.37.1.0 | Back alignment and structure |
|---|
| >3bfn_A Kinesin-like protein KIF22; limited proteolysis, structural genomics consortium domain, ADP, SGC, ATP-binding, DNA-binding, microtubule, MO protein; HET: ADP; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >1t5c_A CENP-E protein, centromeric protein E; kinesin motor-domain-ADP complex, stranded beta-sheet core with solvent exposed alpha-helices; HET: ADP PIN; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >2vvg_A Kinesin-2; motor protein, nucleotide-binding, microtubule, ATP-binding; HET: ADP; 1.60A {Giardia intestinalis} | Back alignment and structure |
|---|
| >1goj_A Kinesin, kinesin heavy chain; motor protein, ATPase; HET: ADP; 2.3A {Neurospora crassa} SCOP: c.37.1.9 | Back alignment and structure |
|---|
| >3b6u_A Kinesin-like protein KIF3B; structural genomics consortium, motor domain, ADP, SGC, ATP-binding, coiled coil, microtubule, motor protein; HET: ADP; 1.80A {Homo sapiens} PDB: 3b6v_A* | Back alignment and structure |
|---|
| >2h58_A Kinesin-like protein KIFC3 variant; motor domain, ADP, structural genomics, structur Al genomics consortium, SGC; HET: ADP; 1.85A {Homo sapiens} | Back alignment and structure |
|---|
| >3cob_A Kinesin heavy chain-like protein; motor, switch II, loop L11, conformation, nucleotide, ATP-binding, microtubule, motor protein; HET: ADP; 2.20A {Solanum tuberosum} SCOP: c.37.1.9 PDB: 3cnz_A* 1sdm_A* 3h4s_A* | Back alignment and structure |
|---|
| >1f9v_A Kinesin-like protein KAR3; kinesin-related protein, motor protein, microtubinding proteinbule, contractIle protein; HET: ADP; 1.30A {Saccharomyces cerevisiae} SCOP: c.37.1.9 PDB: 1f9t_A* 1f9w_A* 1f9u_A* 3kar_A* | Back alignment and structure |
|---|
| >4a14_A Kinesin, kinesin-like protein KIF7; motor protein, motor domain; HET: ADP; 1.60A {Homo sapiens} SCOP: c.37.1.0 PDB: 2xt3_A* | Back alignment and structure |
|---|
| >3gbj_A KIF13B protein; kinesin, motor domain, ADP, structural genomics, structural genomics consortium, SGC, ATP-binding, microtubule, motor protein; HET: ADP; 2.10A {Homo sapiens} SCOP: c.37.1.9 | Back alignment and structure |
|---|
| >2rep_A Kinesin-like protein KIFC1; structural genomics consortium, motor domain, ADP, binding, cell cycle, cell division, endosome, microtubule; HET: ADP; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3nwn_A Kinesin-like protein KIF9; motor domain, ADP, structural genomics, structural consortium, SGC, contractIle protein; HET: ADP; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1x88_A Kinesin-like protein KIF11; switch II, motor domain, NECK linker, cell cycle; HET: ADP NAT; 1.80A {Homo sapiens} SCOP: c.37.1.9 PDB: 3hqd_A* 3ken_A* 2pg2_A* 1yrs_A* 2fme_A* 2g1q_A* 2gm1_A* 1ii6_A* 2uyi_A* 2uym_A* 2wog_A* 2x2r_A* 2x7c_A* 2x7d_A* 2x7e_A* 2xae_A* 3k3b_A* 3k5e_A* 3l9h_A* 1q0b_A* ... | Back alignment and structure |
|---|
| >3t0q_A AGR253WP; kinesin, alpha and beta proteins, P-loop containing nucleosi triphosphate hydrolases, microtubule motor protein; HET: ADP; 2.35A {Ashbya gossypii} | Back alignment and structure |
|---|
| >2wbe_C Bipolar kinesin KRP-130; EG5, KLP61F, tubulin, mitosis, GTP-binding, motor protein, cell division, cell cycle, microtubule, ATP-binding; HET: GTP ANP GDP TA1; 9.40A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2heh_A KIF2C protein; kinesin, motor domain, ADP, structural genomics, structural genomics consortium, SGC, structural protein; HET: ADP; 2.15A {Homo sapiens} PDB: 3edl_D* | Back alignment and structure |
|---|
| >4etp_A Kinesin-like protein KAR3; kinesin motor protein, kinesin motor homology domain, karyog mitosis, microtubules; HET: ADP EBC; 2.30A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1v8k_A Kinesin-like protein KIF2C; microtubule destabilizer, structural P; HET: ANP; 2.25A {Mus musculus} SCOP: c.37.1.9 PDB: 1v8j_A* 2gry_A* | Back alignment and structure |
|---|
| >3u06_A Protein claret segregational; motor domain, stalk rotation, power stroke, kinesin-14, MICR binding, NCD, transport, molecular motor; HET: ADP GOL; 2.35A {Drosophila melanogaster} PDB: 2ncd_A* 1n6m_A* 1cz7_A* 3l1c_A* | Back alignment and structure |
|---|
| >1ry6_A Internal kinesin; kinesin motor domain, nucleotide-free, transport protein; 1.60A {Plasmodium falciparum} SCOP: c.37.1.9 | Back alignment and structure |
|---|
| >3dc4_A Kinesin-like protein NOD; catalytic domain, ATPase, microtubule, ADP, nucleotide-binding protein, ATP-binding, coiled coil, motor protein; HET: ADP; 1.90A {Drosophila melanogaster} PDB: 3dcb_A* 3dco_N* 3pxn_A* | Back alignment and structure |
|---|
| >4h1g_A Maltose binding protein-cakar3 motor domain fusio; kinesin motor domain, motor protein, chimera; HET: MTT ADP EDO; 2.15A {Escherichia coli} | Back alignment and structure |
|---|
| >2o0a_A S.cerevisiae chromosome XVI reading frame ORF YPL253C; VIK1, motor homology domain, kinesin, motor domain, microtubule-binding; 1.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* | Back alignment and structure |
|---|
| >2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} | Back alignment and structure |
|---|
| >2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} | Back alignment and structure |
|---|
| >1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A | Back alignment and structure |
|---|
| >4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4anj_A Unconventional myosin-VI, green fluorescent prote; motor protein-metal-bindng protein complex, molecular motor, metal-binding protein, transition state; HET: CR2 ADP; 2.60A {Sus scrofa} | Back alignment and structure |
|---|
| >1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* | Back alignment and structure |
|---|
| >2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* | Back alignment and structure |
|---|
| >2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* | Back alignment and structure |
|---|
| >3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} | Back alignment and structure |
|---|
| >2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* | Back alignment and structure |
|---|
| >3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A | Back alignment and structure |
|---|
| >1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 PDB: 2x31_G | Back alignment and structure |
|---|
| >4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* | Back alignment and structure |
|---|
| >1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 241 | ||||
| d1bg2a_ | 323 | c.37.1.9 (A:) Kinesin {Human (Homo sapiens) [TaxId | 6e-11 | |
| d1x88a1 | 345 | c.37.1.9 (A:18-362) Kinesin {Human (Homo sapiens), | 1e-08 | |
| d1goja_ | 354 | c.37.1.9 (A:) Kinesin {Neurospora crassa [TaxId: 5 | 7e-06 | |
| d1f9va_ | 342 | c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjun | 3e-05 | |
| d1sdma_ | 364 | c.37.1.9 (A:) Kinesin heavy chain-like protein {Po | 3e-04 |
| >d1bg2a_ c.37.1.9 (A:) Kinesin {Human (Homo sapiens) [TaxId: 9606]} Length = 323 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: Motor proteins domain: Kinesin species: Human (Homo sapiens) [TaxId: 9606]
Score = 59.1 bits (142), Expect = 6e-11
Identities = 29/133 (21%), Positives = 53/133 (39%), Gaps = 5/133 (3%)
Query: 2 FAFDAIF-SDEPQSEICTSALSDVIQAVISGSDGCLFCFGHARLGKSYTMVGSPQSSATL 60
+AFD +F S Q ++ +++ V+ G +G +F +G GK++TM G +
Sbjct: 44 YAFDRVFQSSTSQEQVYNDCAKKIVKDVLEGYNGTIFAYGQTSSGKTHTMEGKLHDPEGM 103
Query: 61 GVIPSAISWLFRCISEQKHKTGARFSVRASAIEISSSSQHVKDLLSTYSNGKFFRLCFLK 120
G+IP + +F I F ++ S EI ++DLL +
Sbjct: 104 GIIPRIVQDIFNYIYSMDENL--EFHIKVSYFEI--YLDKIRDLLDVSKTNLSVHEDKNR 159
Query: 121 RFHAEEDEEMPCP 133
+ + E
Sbjct: 160 VPYVKGCTERFVC 172
|
| >d1x88a1 c.37.1.9 (A:18-362) Kinesin {Human (Homo sapiens), mitotic kinesin eg5 [TaxId: 9606]} Length = 345 | Back information, alignment and structure |
|---|
| >d1goja_ c.37.1.9 (A:) Kinesin {Neurospora crassa [TaxId: 5141]} Length = 354 | Back information, alignment and structure |
|---|
| >d1f9va_ c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjunctional) {Baker's yeast (Saccharomyces cerevisiae), Kar [TaxId: 4932]} Length = 342 | Back information, alignment and structure |
|---|
| >d1sdma_ c.37.1.9 (A:) Kinesin heavy chain-like protein {Potato (Solanum tuberosum) [TaxId: 4113]} Length = 364 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 241 | |||
| d1bg2a_ | 323 | Kinesin {Human (Homo sapiens) [TaxId: 9606]} | 100.0 | |
| d2zfia1 | 349 | Kinesin {Mouse (Mus musculus), kif1a [TaxId: 10090 | 100.0 | |
| d1goja_ | 354 | Kinesin {Neurospora crassa [TaxId: 5141]} | 100.0 | |
| d1sdma_ | 364 | Kinesin heavy chain-like protein {Potato (Solanum | 100.0 | |
| d1v8ka_ | 362 | Kinesin {Mouse (Mus musculus), kif2c [TaxId: 10090 | 100.0 | |
| d1ry6a_ | 330 | Kinesin {Malaria parasite (Plasmodium falciparum) | 100.0 | |
| d1x88a1 | 345 | Kinesin {Human (Homo sapiens), mitotic kinesin eg5 | 100.0 | |
| d1f9va_ | 342 | Kinesin motor Ncd (non-claret disjunctional) {Bake | 100.0 | |
| d2ncda_ | 368 | Kinesin motor Ncd (non-claret disjunctional) {Frui | 100.0 | |
| d1l8qa2 | 213 | Chromosomal replication initiation factor DnaA {Aq | 95.64 | |
| d1w5sa2 | 287 | CDC6-like protein APE0152, N-terminal domain {Aero | 92.93 | |
| d1r7ra3 | 265 | Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu | 92.56 | |
| d1gvnb_ | 273 | Plasmid maintenance system epsilon/zeta, toxin zet | 89.92 | |
| d1fnna2 | 276 | CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T | 89.23 | |
| d1e32a2 | 258 | Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu | 85.97 | |
| d1iqpa2 | 231 | Replication factor C {Archaeon Pyrococcus furiosus | 85.49 | |
| d1p9ra_ | 401 | Extracellular secretion NTPase EpsE {Vibrio choler | 85.43 | |
| d1lv7a_ | 256 | AAA domain of cell division protein FtsH {Escheric | 83.75 | |
| d1d2na_ | 246 | Hexamerization domain of N-ethylmalemide-sensitive | 83.17 | |
| d1ixza_ | 247 | AAA domain of cell division protein FtsH {Thermus | 81.81 | |
| d1szpa2 | 251 | DNA repair protein Rad51, catalytic domain {Baker' | 81.7 |
| >d1bg2a_ c.37.1.9 (A:) Kinesin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: Motor proteins domain: Kinesin species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00 E-value=8.3e-46 Score=333.95 Aligned_cols=216 Identities=20% Similarity=0.262 Sum_probs=183.8
Q ss_pred CeecceecC-CCChHHHHHHHHHHHHHHHhcCCCEEEEcccccCCCcceeeccCCCCCCCCCchHHHHHHHHHHHHhccc
Q psy9852 1 MFAFDAIFS-DEPQSEICTSALSDVIQAVISGSDGCLFCFGHARLGKSYTMVGSPQSSATLGVIPSAISWLFRCISEQKH 79 (241)
Q Consensus 1 tF~FD~VF~-~a~Qe~Vy~~~v~plV~~vl~G~n~ti~aYGqtgSGKTyTm~G~~~~~~~~GIipr~~~~LF~~i~~~~~ 79 (241)
.|+||+||+ +++|++||+.++.|+|+++++|+|+||||||||||||||||+|+..++...||+||++.+||+.+.....
T Consensus 43 ~f~FD~vf~~~~~q~~vf~~~~~~lv~~~l~G~n~~i~aYGqtgSGKTyT~~G~~~~~~~~gii~r~l~~l~~~~~~~~~ 122 (323)
T d1bg2a_ 43 PYAFDRVFQSSTSQEQVYNDCAKKIVKDVLEGYNGTIFAYGQTSSGKTHTMEGKLHDPEGMGIIPRIVQDIFNYIYSMDE 122 (323)
T ss_dssp EEECSEEECTTCCHHHHHHHHTHHHHHHHHTTCCEEEEEECSTTSSHHHHHTBSTTCTTTBCHHHHHHHHHHHHHHHHCS
T ss_pred eeECCEEECCCCCHHHHHHHHHHHHHHHHHcCCCcceeeecccCCCCceeccCCcccccccchhhhHHHHHHhhhhcccc
Confidence 499999999 9999999999999999999999999999999999999999999998877899999999999999987654
Q ss_pred CCCcEEEEEEEEEEEeCCCCeEEEcCCCCCCCceEEEccCCcEEecCcEEEeCCCHHHHHHHHH-HhcCCCccccCCCCC
Q psy9852 80 KTGARFSVRASAIEISSSSQHVKDLLSTYSNGKFFRLCFLKRFHAEEDEEMPCPVPPPLHSNLL-TLSRDSLISNKRNDN 158 (241)
Q Consensus 80 ~~~~~~~V~vS~lEIY~~nE~v~DLL~~~~~~~~l~~~~~~g~~v~glt~v~V~s~~d~~~ll~-g~~~R~~~~T~~N~~ 158 (241)
..++.|.|||+||| ||++||||.+....+.+++++.++++++|++++.|.+++++..++. |.++|++++|.+|+.
T Consensus 123 --~~~~~v~~S~~EIy--ne~i~DLL~~~~~~~~~~~~~~~~~~v~~l~~~~v~s~~~~~~~l~~~~~~R~~~~t~~n~~ 198 (323)
T d1bg2a_ 123 --NLEFHIKVSYFEIY--LDKIRDLLDVSKTNLSVHEDKNRVPYVKGCTERFVCSPDEVMDTIDEGKSNRHVAVTNMNEH 198 (323)
T ss_dssp --SEEEEEEEEEEEEE--TTEEEESSCTTCCSBCEEECTTSCEEETTCCCEEECSHHHHHHHHHHHHHHTTTTCSCHHHH
T ss_pred --ccceEEEEEEEEEE--cCcccccccccccceeEeeccccceeecCCEEEEEeccHhHhHHhhhcccceeecccCCCCC
Confidence 47899999999999 9999999999999999999999999999999999999999999999 999999999999999
Q ss_pred Cch-hhhhceeeeCCCCCCccccccccccccccccccccchhhhhhhhc-----cccccccchhhHHHHHHhhHHH
Q psy9852 159 SSL-YSNSNERLHDPGGTGSIKSFRNFGFGSGIQYCKNDLETLEQYCKN-----DFNQSTWRNDRLEQLKREKRAL 228 (241)
Q Consensus 159 SSr-f~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~-----~~~~~~~~~~~~~~~~~~~~~~ 228 (241)
||| +.++...+......... ...|.| .-+||||+|+..++ ...++..+|.+|..|++.=++|
T Consensus 199 ssRsh~i~~i~v~~~~~~~~~------~~~s~l--~~vDLAGse~~~~~~~~~~~~~e~~~iN~SL~~L~~vi~al 266 (323)
T d1bg2a_ 199 SSRSHSIFLINVKQENTQTEQ------KLSGKL--YLVDLAGSEKVSKTGAEGAVLDEAKNINKSLSALGNVISAL 266 (323)
T ss_dssp HHHSEEEEEEEEEEEETTTCC------EEEEEE--EEEECCCSCCCCCCSSSCTTSCCCCCCCHHHHHHHHHHHHH
T ss_pred CCccceEEEEEEEEEeCCCCc------EEEEEE--EEEecccccccccccchhhhhhhhhcccccHHHHHHHHHHH
Confidence 999 44333333211110000 011112 23799999987664 4577888899999888876665
|
| >d2zfia1 c.37.1.9 (A:4-352) Kinesin {Mouse (Mus musculus), kif1a [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1goja_ c.37.1.9 (A:) Kinesin {Neurospora crassa [TaxId: 5141]} | Back information, alignment and structure |
|---|
| >d1sdma_ c.37.1.9 (A:) Kinesin heavy chain-like protein {Potato (Solanum tuberosum) [TaxId: 4113]} | Back information, alignment and structure |
|---|
| >d1v8ka_ c.37.1.9 (A:) Kinesin {Mouse (Mus musculus), kif2c [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ry6a_ c.37.1.9 (A:) Kinesin {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1x88a1 c.37.1.9 (A:18-362) Kinesin {Human (Homo sapiens), mitotic kinesin eg5 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1f9va_ c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjunctional) {Baker's yeast (Saccharomyces cerevisiae), Kar [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2ncda_ c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjunctional) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|