Diaphorina citri psyllid: psy9862


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------38
MDQAPVSCIPVQGKISKAKKVLDESKEIKNPELELADKGLSSFEELPGLMNMLYITRITLSHNKLKGEIIVQVIKGLSNSKYNYIPILHVTSLPILPFLFLQFPCRMNRLSSLPRGFGAFPVLEVLDLTYNNLNEQSLPGNFFMLETLRALYLGDNDFEVLPAEIGNLKNLQILVLRENDLIEIPKELGNLTRLRELHIQANRLTVLPPEIGNLDLASHKSVLKMDFNPWLVLRENDLIEIPKELGNLSRLRELHIQANRLTVLPPEIGNLDLASHKSVLKMDFNPWVTPIADQLQLVLRENDLIEIPKELGNLSRLRELHIQANRLTVLPPEIGNLDLASHKSVLKMDFNPWVTPIADQLQVGISHVLDYIRSETYK
cccccccccccccccccccHHHHHHHcccccEEECcccccccccccccccccccccEEEccccccccccccHHHccccccccccccccccccccccccccccccccccccccccHHccccccccEEEccccccccccccHHHHcccccccccccccccccccHHHHccccccEEEccccccccccHHHHccccccEEcccccccccccHHHHcccccccccccccccccEEEccccccccccHHHHccccccEEEccccccccccHHHHHcccccccccccccccccccccccccEEEccccccccccHHHHccccccEEEccccccccccHHHHcccccccccEEEccccccccccHHHHHHcHHHHHHHHHHcccc
*DQAPVSCIPVQGKISKAKKVLDESKEIKNPELELADKGLSSFEELPGLMNMLYITRITLSHNKLKGEIIVQVIKGLSNSKYNYIPILHVTSLPILPFLFLQFPCRMNRLSSLPRGFGAFPVLEVLDLTYNNLNEQSLPGNFFMLETLRALYLGDNDFEVLPAEIGNLKNLQILVLRENDLIEIPKELGNLTRLRELHIQANRLTVLPPEIGNLDLASHKSVLKMDFNPWLVLRENDLIEIPKELGNLSRLRELHIQANRLTVLPPEIGNLDLASHKSVLKMDFNPWVTPIADQLQLVLRENDLIEIPKELGNLSRLRELHIQANRLTVLPPEIGNLDLASHKSVLKMDFNPWVTPIADQLQVGISHVLDYIRSET**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDQAPVSCIPVQGKISKAKKVLDESKEIKNPELELADKGLSSFEELPGLMNMLYITRITLSHNKLKGEIIVQVIKGLSNSKYNYIPILHVTSLPILPFLFLQFPCRMNRLSSLPRGFGAFPVLEVLDLTYNNLNEQSLPGNFFMLETLRALYLGDNDFEVLPAEIGNLKNLQILVLRENDLIEIPKELGNLTRLRELHIQANRLTVLPPEIGNLDLASHKSVLKMDFNPWLVLRENDLIEIPKELGNLSRLRELHIQANRLTVLPPEIGNLDLASHKSVLKMDFNPWVTPIADQLQLVLRENDLIEIPKELGNLSRLRELHIQANRLTVLPPEIGNLDLASHKSVLKMDFNPWVTPIADQLQVGISHVLDYIRSETYK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Ras suppressor protein 1 Potentially plays a role in the Ras signal transduction pathway. Capable of suppressing v-Ras transformation in vitro.confidentQ5E9C0
Ras suppressor protein 1 Potentially plays a role in the Ras signal transduction pathway. Capable of suppressing v-Ras transformation in vitro.confidentQ01730
Ras suppressor protein 1 Potentially plays a role in the Ras signal transduction pathway. Capable of suppressing v-Ras transformation in vitro.confidentQ15404

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0007229 [BP]integrin-mediated signaling pathwayprobableGO:0044700, GO:0051716, GO:0008150, GO:0050896, GO:0009987, GO:0050794, GO:0023052, GO:0065007, GO:0044763, GO:0007165, GO:0007166, GO:0007154, GO:0050789, GO:0044699
GO:0043508 [BP]negative regulation of JUN kinase activityprobableGO:0033673, GO:0009892, GO:0043549, GO:0019220, GO:0080090, GO:0019222, GO:0044092, GO:0048585, GO:0031324, GO:0048583, GO:0043407, GO:0023057, GO:0043405, GO:0010648, GO:0023051, GO:0043506, GO:0046328, GO:0071901, GO:0071900, GO:0010627, GO:0043086, GO:0043409, GO:0043408, GO:0051248, GO:0010646, GO:0010605, GO:0009968, GO:0009966, GO:0051348, GO:0051246, GO:0050789, GO:0060255, GO:0065007, GO:0031399, GO:0048519, GO:0065009, GO:0010741, GO:0006469, GO:0045936, GO:0070302, GO:0031323, GO:0045859, GO:0050794, GO:0032872, GO:0032268, GO:0008150, GO:0042325, GO:0051174, GO:0032269, GO:0042326, GO:0050790, GO:0010563, GO:0031400, GO:0080135, GO:0051338, GO:0001933, GO:0001932, GO:0080134, GO:0048523
GO:0007475 [BP]apposition of dorsal and ventral imaginal disc-derived wing surfacesprobableGO:0048563, GO:0048569, GO:0008587, GO:0009887, GO:0035220, GO:0009791, GO:0035120, GO:0002165, GO:0032501, GO:0009653, GO:0007275, GO:0044699, GO:0007472, GO:0007552, GO:0007476, GO:0048513, GO:0032502, GO:0048707, GO:0009886, GO:0035107, GO:0035114, GO:0008150, GO:0044767, GO:0044707, GO:0007444, GO:0048856, GO:0007560, GO:0048731, GO:0048736, GO:0048737
GO:0043231 [CC]intracellular membrane-bounded organelleprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0046329 [BP]negative regulation of JNK cascadeprobableGO:0048585, GO:0048583, GO:0023057, GO:0010648, GO:0023051, GO:0046328, GO:0010646, GO:0010627, GO:0050789, GO:0043409, GO:0043408, GO:0009968, GO:0009966, GO:0065007, GO:0048519, GO:0010741, GO:0070302, GO:0070303, GO:0050794, GO:0032872, GO:0032873, GO:0008150, GO:0080134, GO:0080135, GO:0048523
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0045202 [CC]synapseprobableGO:0005575
GO:0044444 [CC]cytoplasmic partprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0016323 [CC]basolateral plasma membraneprobableGO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459
GO:0030054 [CC]cell junctionprobableGO:0005575

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1ZIW, chain A
Confidence level:very confident
Coverage over the Query: 29-358
View the alignment between query and template
View the model in PyMOL
Template: 4G8A, chain A
Confidence level:confident
Coverage over the Query: 23-376
View the alignment between query and template
View the model in PyMOL