Psyllid ID: psy9862

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------38
MDQAPVSCIPVQGKISKAKKVLDESKEIKNPELELADKGLSSFEELPGLMNMLYITRITLSHNKLKGEIIVQVIKGLSNSKYNYIPILHVTSLPILPFLFLQFPCRMNRLSSLPRGFGAFPVLEVLDLTYNNLNEQSLPGNFFMLETLRALYLGDNDFEVLPAEIGNLKNLQILVLRENDLIEIPKELGNLTRLRELHIQANRLTVLPPEIGNLDLASHKSVLKMDFNPWLVLRENDLIEIPKELGNLSRLRELHIQANRLTVLPPEIGNLDLASHKSVLKMDFNPWVTPIADQLQLVLRENDLIEIPKELGNLSRLRELHIQANRLTVLPPEIGNLDLASHKSVLKMDFNPWVTPIADQLQVGISHVLDYIRSETYK
cccccccccccccccccccHHHHHHHHccccEEEEcccccccccccccccccccccEEEccccccccccccHHHccccccccccccccccccccccccccccccccccccccccHHccccccccEEEccccccccccccHHHHcccccccccccccccccccHHHHccccccEEEccccccccccHHHHccccccEEcccccccccccHHHHcccccccccccccccccEEEccccccccccHHHHccccccEEEccccccccccHHHHHcccccccccccccccccccccccccEEEccccccccccHHHHccccccEEEccccccccccHHHHcccccccccEEEcccccccccHHHHHHHcHHHHHHHHHHcccc
cccccccccccccccccccccHHHHHcccccEEEccccccccccccHHHHccHcccEEEcccccccccccHHHHHHHHcccEEEccccccccccHHHHHHHHHcccccccccccHHHHccccccEEEccccccccccccHHHHccccccEEEccccccccccHHHHccccccEEEccccccccccHHHHccccccEEEccccccccccHHHHcHHccccccccccccccEEEccccccccccHHHHccccccEEEccccccccccHHHHHHHcccEEEcccccccHHHcccccccEEEccccccccccHHHHccccccEEEccccccccccHHHHHHHHcccccEEEccccccccccHHHHHHcccHHHHHHcccccc
mdqapvscipvqgkISKAKKVldeskeiknpeleladkglssfeelpGLMNMLYITRITLSHNKLKGEIIVQVIKGLsnskynyipilhvtslpilpflflqfpcrmnrlsslprgfgafpVLEVLDLTynnlneqslpgnfFMLETLRALYlgdndfevlpaeignlknlQILVLRENDLIEIPKELGNLTRLRELHIQAnrltvlppeignldlashksvlkmdfnpwlvlrenDLIEIPKELGNLSRLRELHIQANrltvlppeignldlashksvlkmdfnpwvtpiaDQLQLVLRENDLIEIPKELGNLSRLRELHIQANrltvlppeignldlashksvlkmdfnpwvtpiadqLQVGISHVLDYIRSETYK
mdqapvscipvqgkiskakkvldeskeiknpeleladkGLSSFEELPGLMNMLYITRITLSHNKLKGEIIVQVIKGLSNSKYNYIPILHVTSLPILPFLFLQFPCRMNRLSSLPRGFGAFPVLEVLDLTYNNLNEQSLPGNFFMLETLRALYLGDNDFEVLPAEIGNLKNLQILVLRENDLIEIPKELGNLTRLRELHIQANRLTVLPPEIGNLDLASHKSVLKMDFNPWLVLRENDLIEIPKELGNLSRLRELHIQANRLTVLPPEIGNLDLASHKSVLKMDFNPWVTPIADQLQLVLRENDLIEIPKELGNLSRLRELHIQANRLTVLPPEIGNLDLASHKSVLKMDFNPWVTPIADQLQVGISHVLDYIRSETYK
MDQAPVSCIPVQGKISKAKKVLDESKEIKNPELELADKGLSSFEELPGLMNMLYITRITLSHNKLKGEIIVQVIKGLSNSKYNYIPILHVTSlpilpflflqfpCRMNRLSSLPRGFGAFPVLEVLDLTYNNLNEQSLPGNFFMLETLRALYLGDNDFEVLPAEIGNLKNLQILVLRENDLIEIPKELGNLTRLRELHIQANRLTVLPPEIGNLDLASHKSVLKMDFNPWLVLRENDLIEIPKELGNLSRLRELHIQANRLTVLPPEIGNLDLASHKSVLKMDFNPWVTPIADQLQLVLRENDLIEIPKELGNLSRLRELHIQANRLTVLPPEIGNLDLASHKSVLKMDFNPWVTPIADQLQVGISHVLDYIRSETYK
******************************************FEELPGLMNMLYITRITLSHNKLKGEIIVQVIKGLSNSKYNYIPILHVTSLPILPFLFLQFPCRMNRLSSLPRGFGAFPVLEVLDLTYNNLNEQSLPGNFFMLETLRALYLGDNDFEVLPAEIGNLKNLQILVLRENDLIEIPKELGNLTRLRELHIQANRLTVLPPEIGNLDLASHKSVLKMDFNPWLVLRENDLIEIPKELGNLSRLRELHIQANRLTVLPPEIGNLDLASHKSVLKMDFNPWVTPIADQLQLVLRENDLIEIPKELGNLSRLRELHIQANRLTVLPPEIGNLDLASHKSVLKMDFNPWVTPIADQLQVGISHVLDYIR*****
*DQAPVSCIPVQGKISKAKKVLDESKEIKNPELELADKGLSSFEELPGLMNMLYITRITLSHNKLKGEIIVQVIKGLSNSKYNYIPILHVTSLPILPFLFLQFPCRMNRLSSLPRGFGAFPVLEVLDLTYNNLNEQSLPGNFFMLETLRALYLGDNDFEVLPAEIGNLKNLQILVLRENDLIEIPKELGNLTRLRELHIQANRLTVLPPEIGNLDLASHKSVLKMDFNPWLVLRENDLIEIPKELGNLSRLRELHIQANRLTVLPPEIGNLDLASHKSVLKMDFNPWVTPIADQLQLVLRENDLIEIPKELGNLSRLRELHIQANRLTVLPPEIGNLDLASHKSVLKMDFNPWVTPIADQLQVGISHVLDYIRSET**
MDQAPVSCIPVQGKISKAKKVLDESKEIKNPELELADKGLSSFEELPGLMNMLYITRITLSHNKLKGEIIVQVIKGLSNSKYNYIPILHVTSLPILPFLFLQFPCRMNRLSSLPRGFGAFPVLEVLDLTYNNLNEQSLPGNFFMLETLRALYLGDNDFEVLPAEIGNLKNLQILVLRENDLIEIPKELGNLTRLRELHIQANRLTVLPPEIGNLDLASHKSVLKMDFNPWLVLRENDLIEIPKELGNLSRLRELHIQANRLTVLPPEIGNLDLASHKSVLKMDFNPWVTPIADQLQLVLRENDLIEIPKELGNLSRLRELHIQANRLTVLPPEIGNLDLASHKSVLKMDFNPWVTPIADQLQVGISHVLDYIRSETYK
****PVSCIPVQGKISKAKKVLDESKEIKNPELELADKGLSSFEELPGLMNMLYITRITLSHNKLKGEIIVQVIKGLSNSKYNYIPILHVTSLPILPFLFLQFPCRMNRLSSLPRGFGAFPVLEVLDLTYNNLNEQSLPGNFFMLETLRALYLGDNDFEVLPAEIGNLKNLQILVLRENDLIEIPKELGNLTRLRELHIQANRLTVLPPEIGNLDLASHKSVLKMDFNPWLVLRENDLIEIPKELGNLSRLRELHIQANRLTVLPPEIGNLDLASHKSVLKMDFNPWVTPIADQLQLVLRENDLIEIPKELGNLSRLRELHIQANRLTVLPPEIGNLDLASHKSVLKMDFNPWVTPIADQLQVGISHVLDYIRS****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDQAPVSCIPVQGKISKAKKVLDESKEIKNPELELADKGLSSFEELPGLMNMLYITRITLSHNKLKGEIIVQVIKGLSNSKYNYIPILHVTSLPILPFLFLQFPCRMNRLSSLPRGFGAFPVLEVLDLTYNNLNEQSLPGNFFMLETLRALYLGDNDFEVLPAEIGNLKNLQILVLRENDLIEIPKELGNLTRLRELHIQANRLTVLPPEIGNLDLASHKSVLKMDFNPWLVLRENDLIEIPKELGNLSRLRELHIQANRLTVLPPEIGNLDLASHKSVLKMDFNPWVTPIADQLQLVLRENDLIEIPKELGNLSRLRELHIQANRLTVLPPEIGNLDLASHKSVLKMDFNPWVTPIADQLQVGISHVLDYIRSETYK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query378 2.2.26 [Sep-21-2011]
Q5E9C0277 Ras suppressor protein 1 yes N/A 0.563 0.768 0.533 8e-58
Q15404277 Ras suppressor protein 1 yes N/A 0.563 0.768 0.533 3e-57
Q01730277 Ras suppressor protein 1 yes N/A 0.563 0.768 0.533 8e-57
Q9BTT6 524 Leucine-rich repeat-conta no N/A 0.642 0.463 0.344 1e-20
B0M0P8 2356 Ras guanine nucleotide ex yes N/A 0.521 0.083 0.311 7e-20
Q4H4B6 1724 Protein scribble homolog no N/A 0.629 0.138 0.316 8e-20
Q14160 1630 Protein scribble homolog no N/A 0.566 0.131 0.343 2e-19
Q7KRY7 1851 Protein lap4 OS=Drosophil no N/A 0.555 0.113 0.340 2e-19
Q80U72 1612 Protein scribble homolog no N/A 0.566 0.132 0.347 2e-19
Q5ZLN0 603 Leucine-rich repeat-conta no N/A 0.648 0.406 0.311 2e-19
>sp|Q5E9C0|RSU1_BOVIN Ras suppressor protein 1 OS=Bos taurus GN=RSU1 PE=2 SV=1 Back     alignment and function desciption
 Score =  224 bits (571), Expect = 8e-58,   Method: Compositional matrix adjust.
 Identities = 120/225 (53%), Positives = 160/225 (71%), Gaps = 12/225 (5%)

Query: 15  ISKA-KKVLDESKEIKNPELELADKGLSSFEELPGLMNMLYITRITLSHNKLK------G 67
           +SK+ KK+++ES+E   PE++++D+G+S+  ++ GL  + +IT++ LSHNKL        
Sbjct: 1   MSKSLKKLVEESREKNQPEVDMSDRGISNMLDINGLFTLSHITQLVLSHNKLTTVPPNIA 60

Query: 68  EIIVQVIKGLSNSKYNYIPILHVTSLPILPFLFLQFPCRMNRLSSLPRGFGAFPVLEVLD 127
           E+    +    N++   +P   ++SL  L  L L     MNRL++LPRGFG+ P LEVLD
Sbjct: 61  ELKNLEVLNFFNNQIEELPT-QISSLQKLKHLNLG----MNRLNTLPRGFGSLPALEVLD 115

Query: 128 LTYNNLNEQSLPGNFFMLETLRALYLGDNDFEVLPAEIGNLKNLQILVLRENDLIEIPKE 187
           LTYNNLNE SLPGNFF L TLRALYL DNDFE+LP +IG L  LQIL LR+NDLI +PKE
Sbjct: 116 LTYNNLNENSLPGNFFYLTTLRALYLSDNDFEILPPDIGKLTKLQILSLRDNDLISLPKE 175

Query: 188 LGNLTRLRELHIQANRLTVLPPEIGNLDLASHKSVLKMDFNPWLV 232
           +G LT+L+ELHIQ NRLTVLPPE+GNLDL   K + K + NPW+ 
Sbjct: 176 IGELTQLKELHIQGNRLTVLPPELGNLDLTGQKQIFKAENNPWVT 220
Potentially plays a role in the Ras signal transduction pathway. Capable of suppressing v-Ras transformation in vitro.
Bos taurus (taxid: 9913)
>sp|Q15404|RSU1_HUMAN Ras suppressor protein 1 OS=Homo sapiens GN=RSU1 PE=1 SV=3 Back     alignment and function description
>sp|Q01730|RSU1_MOUSE Ras suppressor protein 1 OS=Mus musculus GN=Rsu1 PE=2 SV=3 Back     alignment and function description
>sp|Q9BTT6|LRRC1_HUMAN Leucine-rich repeat-containing protein 1 OS=Homo sapiens GN=LRRC1 PE=1 SV=1 Back     alignment and function description
>sp|B0M0P8|GEFL_DICDI Ras guanine nucleotide exchange factor L OS=Dictyostelium discoideum GN=gefL PE=2 SV=1 Back     alignment and function description
>sp|Q4H4B6|SCRIB_DANRE Protein scribble homolog OS=Danio rerio GN=scrib PE=1 SV=1 Back     alignment and function description
>sp|Q14160|SCRIB_HUMAN Protein scribble homolog OS=Homo sapiens GN=SCRIB PE=1 SV=4 Back     alignment and function description
>sp|Q7KRY7|LAP4_DROME Protein lap4 OS=Drosophila melanogaster GN=scrib PE=1 SV=1 Back     alignment and function description
>sp|Q80U72|SCRIB_MOUSE Protein scribble homolog OS=Mus musculus GN=Scrib PE=1 SV=2 Back     alignment and function description
>sp|Q5ZLN0|LRC40_CHICK Leucine-rich repeat-containing protein 40 OS=Gallus gallus GN=LRRC40 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query378
427778387389 Putative ras suppressor protein [Rhipice 0.706 0.686 0.572 2e-82
350405379 503 PREDICTED: ras suppressor protein 1-like 0.595 0.447 0.682 6e-82
340726496294 PREDICTED: ras suppressor protein 1-like 0.595 0.765 0.686 1e-81
328778234290 PREDICTED: ras suppressor protein 1 [Api 0.595 0.775 0.686 1e-81
383862509283 PREDICTED: ras suppressor protein 1-like 0.595 0.795 0.690 1e-81
380024743283 PREDICTED: LOW QUALITY PROTEIN: ras supp 0.595 0.795 0.686 2e-81
91076586284 PREDICTED: similar to icarus CG9031-PA [ 0.600 0.799 0.659 4e-81
307183343294 Ras suppressor protein 1 [Camponotus flo 0.611 0.785 0.659 6e-81
156553048287 PREDICTED: ras suppressor protein 1-like 0.592 0.780 0.683 7e-81
307214257284 Ras suppressor protein 1 [Harpegnathos s 0.589 0.785 0.665 7e-80
>gi|427778387|gb|JAA54645.1| Putative ras suppressor protein [Rhipicephalus pulchellus] Back     alignment and taxonomy information
 Score =  311 bits (798), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 174/304 (57%), Positives = 218/304 (71%), Gaps = 37/304 (12%)

Query: 15  ISKAKKVLDESKEIKNPELELADKGLSSFEELPGLMNMLYITRITLSHNKLK------GE 68
           ++K KKV+DE++E  NPEL+L D+G++S EE+PGL ++  +TR+TLSHNK++        
Sbjct: 1   MAKVKKVVDEAREQNNPELDLVDRGITSIEEIPGLFSLPNLTRLTLSHNKIRVVPASIAN 60

Query: 69  IIVQVIKGLSNSKYNYIPILHVTSLPILPFLFLQFPCRMNRLSSLPRGFGAFPVLEVLDL 128
           +    I  L N++   +P   ++++P L  L L     +NRLSSLPRGFGAFPVLEVLDL
Sbjct: 61  LYNLEILTLCNNQIVELPS-SISTMPKLKILNLA----INRLSSLPRGFGAFPVLEVLDL 115

Query: 129 TYNNLNEQSLPGNFFMLETLRALYLGDNDFEVLPAEIGNLKNLQILVLRENDLIEIPKEL 188
           TYNNLNEQSL  NFF+++TLRALYLGDN+FE LP  IG LKNLQIL +REN+L+E+PKEL
Sbjct: 116 TYNNLNEQSLSNNFFIMDTLRALYLGDNEFEKLPPAIGQLKNLQILSVRENELVELPKEL 175

Query: 189 GNLTRLRELHIQANRLTV---------------LPPEIGNLDLASHKSVLKMDFNPWLVL 233
           G LTRLRELHIQ NRLT+               LPP IG L      SV           
Sbjct: 176 GQLTRLRELHIQGNRLTLLPPXXLYLGDNEFEKLPPAIGQLKNLQILSV----------- 224

Query: 234 RENDLIEIPKELGNLSRLRELHIQANRLTVLPPEIGNLDLASHKSVLKMDFNPWVTPIAD 293
           REN+L+E+PKELG L+RLRELHIQ NRLT+LPPE+GNLDLASH+ V++MD NPWV PIAD
Sbjct: 225 RENELVELPKELGQLTRLRELHIQGNRLTLLPPELGNLDLASHRCVVRMDDNPWVAPIAD 284

Query: 294 QLQL 297
           QLQ+
Sbjct: 285 QLQI 288

Source: Rhipicephalus pulchellus

Species: Rhipicephalus pulchellus

Genus: Rhipicephalus

Family: Ixodidae

Order: Ixodida

Class: Arachnida

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|350405379|ref|XP_003487417.1| PREDICTED: ras suppressor protein 1-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|340726496|ref|XP_003401593.1| PREDICTED: ras suppressor protein 1-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|328778234|ref|XP_395612.3| PREDICTED: ras suppressor protein 1 [Apis mellifera] Back     alignment and taxonomy information
>gi|383862509|ref|XP_003706726.1| PREDICTED: ras suppressor protein 1-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|380024743|ref|XP_003696151.1| PREDICTED: LOW QUALITY PROTEIN: ras suppressor protein 1-like [Apis florea] Back     alignment and taxonomy information
>gi|91076586|ref|XP_968109.1| PREDICTED: similar to icarus CG9031-PA [Tribolium castaneum] Back     alignment and taxonomy information
>gi|307183343|gb|EFN70201.1| Ras suppressor protein 1 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|156553048|ref|XP_001605145.1| PREDICTED: ras suppressor protein 1-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|307214257|gb|EFN89353.1| Ras suppressor protein 1 [Harpegnathos saltator] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query378
FB|FBgn0028546283 ics "icarus" [Drosophila melan 0.698 0.932 0.562 6.7e-72
UNIPROTKB|E1BS02277 RSU1 "Uncharacterized protein" 0.568 0.776 0.538 2.8e-57
UNIPROTKB|E2R9R1277 RSU1 "Uncharacterized protein" 0.574 0.783 0.529 2.5e-56
UNIPROTKB|Q5E9C0277 RSU1 "Ras suppressor protein 1 0.574 0.783 0.525 3.3e-56
UNIPROTKB|Q15404277 RSU1 "Ras suppressor protein 1 0.568 0.776 0.529 6.8e-56
MGI|MGI:103040277 Rsu1 "Ras suppressor protein 1 0.574 0.783 0.529 2.3e-55
UNIPROTKB|E1BWI3204 RSU1 "Uncharacterized protein" 0.529 0.980 0.548 2.4e-53
UNIPROTKB|Q09497268 rsu-1 "Protein RSU-1" [Caenorh 0.547 0.772 0.528 8e-53
RGD|1591781247 Rsu1 "Ras suppressor protein 1 0.539 0.825 0.529 5.1e-51
UNIPROTKB|E1C0D6 1526 E1C0D6 "Uncharacterized protei 0.809 0.200 0.323 3.5e-26
FB|FBgn0028546 ics "icarus" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 727 (261.0 bits), Expect = 6.7e-72, P = 6.7e-72
 Identities = 158/281 (56%), Positives = 192/281 (68%)

Query:     7 SCIPVQGKISKAKKVLDESKEIKNPELELADKGLSSFEELPGLMNMLYITRITLSHNKLK 66
             SCIPV  K+SKAKKVLDE++E  NPEL+LADKGLSSFEELPGL NM  ITR+TLSHNK+ 
Sbjct:     4 SCIPVSAKMSKAKKVLDEARETHNPELDLADKGLSSFEELPGLFNMSNITRLTLSHNKIS 63

Query:    67 ------GEIIVQVIKGLSNSKYNYIPILHVTSXXXXXXXXXXXXCRMNRLSSLPRGFGAF 120
                     ++   I  LSN++   +P+                   +NRL +LPRGFGAF
Sbjct:    64 VISPGIANLLNLEILNLSNNQLTELPV-----SLSSMPKLRILNVSINRLINLPRGFGAF 118

Query:   121 PVLEVLDLTYNNLNEQSLPGNFFMLETLRALYLGDNDFEVLPAEIGNLKNLQILVLREND 180
             PVLEVLDL+YNNLNEQ LPGNFF +ETLRALYLGDNDFE +P E+G LKNLQIL LR+ND
Sbjct:   119 PVLEVLDLSYNNLNEQVLPGNFFGMETLRALYLGDNDFEYIPKEVGQLKNLQILGLRDND 178

Query:   181 LIEIPKELGNLTRLRELHIQANRLTVLPPEIGNLDLASHKSVLKMDFNPWL-VLRENDLI 239
             L+E+P+E+G+L RLRELHIQ NRL VLPPEI  LDL S+KSV+KM+ NPW+  + E  L+
Sbjct:   179 LLELPREVGDLVRLRELHIQNNRLQVLPPEIAQLDLLSNKSVMKMEENPWVNPIAEQYLL 238

Query:   240 EIPKELGNLSR-----LRELHIQANRLTVLPPEIGNLDLAS 275
              I   +  L       +   H+QA R    PP+      AS
Sbjct:   239 GISHVIDYLKTETYKIIYNRHLQAGRSGPPPPKADKSKKAS 279
GO:0005083 "small GTPase regulator activity" evidence=ISS
GO:0046329 "negative regulation of JNK cascade" evidence=IGI
GO:0043508 "negative regulation of JUN kinase activity" evidence=IMP
GO:0007475 "apposition of dorsal and ventral imaginal disc-derived wing surfaces" evidence=IMP
GO:0007229 "integrin-mediated signaling pathway" evidence=IGI
UNIPROTKB|E1BS02 RSU1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E2R9R1 RSU1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q5E9C0 RSU1 "Ras suppressor protein 1" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q15404 RSU1 "Ras suppressor protein 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:103040 Rsu1 "Ras suppressor protein 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|E1BWI3 RSU1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q09497 rsu-1 "Protein RSU-1" [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
RGD|1591781 Rsu1 "Ras suppressor protein 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|E1C0D6 E1C0D6 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q5E9C0RSU1_BOVINNo assigned EC number0.53330.56340.7689yesN/A
Q15404RSU1_HUMANNo assigned EC number0.53330.56340.7689yesN/A
Q01730RSU1_MOUSENo assigned EC number0.53330.56340.7689yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query378
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-16
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 9e-15
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 3e-13
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 3e-12
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 4e-10
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 1e-05
PRK15370 754 PRK15370, PRK15370, E3 ubiquitin-protein ligase Sl 2e-05
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 3e-05
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 8e-05
PRK15387 788 PRK15387, PRK15387, E3 ubiquitin-protein ligase Ss 1e-04
PRK15387 788 PRK15387, PRK15387, E3 ubiquitin-protein ligase Ss 3e-04
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 0.002
pfam1279943 pfam12799, LRR_4, Leucine Rich repeats (2 copies) 0.002
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information 
 Score = 81.8 bits (202), Expect = 1e-16
 Identities = 99/332 (29%), Positives = 157/332 (47%), Gaps = 61/332 (18%)

Query: 33  LELADKGLSSFEELPGLMNMLYITRITLSHNKLKGEIIVQVIKGLSNSKYNYIPILHVTS 92
           ++L+ K +S  +    +  + YI  I LS+N+L G  I   I   S+S            
Sbjct: 74  IDLSGKNISG-KISSAIFRLPYIQTINLSNNQLSGP-IPDDIFTTSSS------------ 119

Query: 93  LPILPFLFLQFPCRMNRLSSLPRGFGAFPVLEVLDLTYNNLNEQSLPGNFFMLETLRALY 152
              L +L L      N   S+PRG    P LE LDL+ NN+    +P +     +L+ L 
Sbjct: 120 ---LRYLNLS---NNNFTGSIPRGS--IPNLETLDLS-NNMLSGEIPNDIGSFSSLKVLD 170

Query: 153 LGDNDFE-VLPAEIGNLKNLQILVLRENDLI-EIPKELGNLTRLRELHIQANRLT-VLPP 209
           LG N     +P  + NL +L+ L L  N L+ +IP+ELG +  L+ +++  N L+  +P 
Sbjct: 171 LGGNVLVGKIPNSLTNLTSLEFLTLASNQLVGQIPRELGQMKSLKWIYLGYNNLSGEIPY 230

Query: 210 EIGNLDLASHKSVLKMDFNPWLVLRENDLI-EIPKELGNLSRLRELHIQANRLT-VLPPE 267
           EIG L   +H           L L  N+L   IP  LGNL  L+ L +  N+L+  +PP 
Sbjct: 231 EIGGLTSLNH-----------LDLVYNNLTGPIPSSLGNLKNLQYLFLYQNKLSGPIPPS 279

Query: 268 IGNLDLASHKSVLKMDF--NPWVTPIAD---QLQ----LVLRENDLI-EIPKELGNLSRL 317
           I +L     + ++ +D   N     I +   QLQ    L L  N+   +IP  L +L RL
Sbjct: 280 IFSL-----QKLISLDLSDNSLSGEIPELVIQLQNLEILHLFSNNFTGKIPVALTSLPRL 334

Query: 318 RELHIQANRLT-VLPPEIGN------LDLASH 342
           + L + +N+ +  +P  +G       LDL+++
Sbjct: 335 QVLQLWSNKFSGEIPKNLGKHNNLTVLDLSTN 366

Length = 968
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|185268 PRK15370, PRK15370, E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|185285 PRK15387, PRK15387, E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>gnl|CDD|185285 PRK15387, PRK15387, E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|205079 pfam12799, LRR_4, Leucine Rich repeats (2 copies) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 378
KOG0472|consensus565 99.95
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.95
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.94
KOG4194|consensus 873 99.94
KOG0472|consensus 565 99.94
KOG0444|consensus 1255 99.93
KOG0444|consensus 1255 99.93
KOG4194|consensus 873 99.91
KOG0617|consensus264 99.9
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.87
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.84
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.83
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.81
KOG0617|consensus264 99.79
KOG4237|consensus 498 99.77
KOG0618|consensus 1081 99.76
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.76
KOG0618|consensus 1081 99.73
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.71
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.69
KOG0532|consensus 722 99.65
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.59
KOG4237|consensus 498 99.55
KOG0532|consensus 722 99.42
KOG1909|consensus382 99.34
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.27
KOG3207|consensus505 99.25
KOG3207|consensus 505 99.23
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.19
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.15
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.06
KOG1259|consensus490 98.95
KOG1259|consensus490 98.93
KOG4658|consensus889 98.91
KOG1909|consensus382 98.85
KOG0531|consensus414 98.71
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.63
KOG0531|consensus414 98.62
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.62
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.54
KOG1859|consensus 1096 98.53
KOG1859|consensus 1096 98.49
PLN03150623 hypothetical protein; Provisional 98.43
KOG4658|consensus889 98.43
KOG2982|consensus 418 98.41
KOG4579|consensus177 98.35
PLN03150623 hypothetical protein; Provisional 98.31
KOG2120|consensus419 98.29
KOG2982|consensus418 98.28
KOG4579|consensus177 98.23
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.12
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.05
KOG2120|consensus419 98.04
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.95
KOG3665|consensus 699 97.93
PRK15386 426 type III secretion protein GogB; Provisional 97.9
KOG1644|consensus233 97.87
KOG1644|consensus233 97.75
KOG3665|consensus 699 97.6
PRK15386426 type III secretion protein GogB; Provisional 97.46
KOG4308|consensus478 97.42
KOG2739|consensus260 97.16
KOG2123|consensus 388 96.83
KOG2739|consensus260 96.8
KOG2123|consensus388 96.7
KOG4341|consensus483 96.47
KOG4242|consensus553 96.4
KOG4308|consensus 478 96.15
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.95
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 95.76
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 94.46
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 94.16
smart0036828 LRR_RI Leucine rich repeat, ribonuclease inhibitor 94.0
KOG0473|consensus326 93.8
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 93.73
smart0037026 LRR Leucine-rich repeats, outliers. 93.25
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 93.25
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 92.85
KOG1947|consensus482 91.79
KOG0473|consensus326 90.01
smart0036426 LRR_BAC Leucine-rich repeats, bacterial type. 88.83
smart0036828 LRR_RI Leucine rich repeat, ribonuclease inhibitor 88.16
KOG4341|consensus483 86.56
smart0036526 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily 83.18
>KOG0472|consensus Back     alignment and domain information 
Probab=99.95  E-value=4.5e-30  Score=225.47  Aligned_cols=326  Identities=29%  Similarity=0.452  Sum_probs=240.9

Q ss_pred             cCCceeeccCCcccCcCcccccccccccEEEcccccccCchhHHHHhhccccc---cCCccccCCCCCCC----Cccchh
Q psy9862          29 KNPELELADKGLSSFEELPGLMNMLYITRITLSHNKLKGEIIVQVIKGLSNSK---YNYIPILHVTSLPI----LPFLFL  101 (378)
Q Consensus        29 ~l~~L~l~~~~~~~~~~~~~l~~~~~L~~L~ls~~~l~~~~~~~~~~~l~~l~---~~~l~~l~l~~~~~----~~~l~~  101 (378)
                      ++..|+.+.|.+..+.  +++..+..+..++..+|++..     .|+++..+.   -..+...++..+|.    ++.++ 
T Consensus       115 ~l~~l~~s~n~~~el~--~~i~~~~~l~dl~~~~N~i~s-----lp~~~~~~~~l~~l~~~~n~l~~l~~~~i~m~~L~-  186 (565)
T KOG0472|consen  115 SLVKLDCSSNELKELP--DSIGRLLDLEDLDATNNQISS-----LPEDMVNLSKLSKLDLEGNKLKALPENHIAMKRLK-  186 (565)
T ss_pred             hhhhhhccccceeecC--chHHHHhhhhhhhcccccccc-----CchHHHHHHHHHHhhccccchhhCCHHHHHHHHHH-
Confidence            3667777777776543  667777777777777777762     332222222   00133334444442    66777 


Q ss_pred             ccccCCcccccCCCCCCCCCcccEEEccCCCCCCCCCCcccccCccccEEecCCCCCccCCcccc-CCCCCcEEecCCCC
Q psy9862         102 QFPCRMNRLSSLPRGFGAFPVLEVLDLTYNNLNEQSLPGNFFMLETLRALYLGDNDFEVLPAEIG-NLKNLQILVLREND  180 (378)
Q Consensus       102 ~l~l~~~~l~~~~~~~~~~~~L~~L~l~~n~i~~~~~~~~l~~l~~L~~L~l~~n~l~~l~~~l~-~l~~L~~L~l~~n~  180 (378)
                      ++++..|.+..+|..++++..|..|++..|++..  +| .|.++..|++++++.|++..+|.+.. .+.++..||+..|+
T Consensus       187 ~ld~~~N~L~tlP~~lg~l~~L~~LyL~~Nki~~--lP-ef~gcs~L~Elh~g~N~i~~lpae~~~~L~~l~vLDLRdNk  263 (565)
T KOG0472|consen  187 HLDCNSNLLETLPPELGGLESLELLYLRRNKIRF--LP-EFPGCSLLKELHVGENQIEMLPAEHLKHLNSLLVLDLRDNK  263 (565)
T ss_pred             hcccchhhhhcCChhhcchhhhHHHHhhhccccc--CC-CCCccHHHHHHHhcccHHHhhHHHHhcccccceeeeccccc
Confidence            8888888888888888888888888888888863  34 67778888888888888877777654 77788888888888


Q ss_pred             CccCChhhcCCCCCcEEeccCCcCcccCcccccccccccccccccCCC--------------------------------
Q psy9862         181 LIEIPKELGNLTRLRELHIQANRLTVLPPEIGNLDLASHKSVLKMDFN--------------------------------  228 (378)
Q Consensus       181 ~~~l~~~l~~l~~L~~L~l~~~~l~~~~~~~~~l~~l~~l~~~~~~~~--------------------------------  228 (378)
                      ++++|+.+.-+.+|..||+++|.++++|..++++ .+..+   .+..+                                
T Consensus       264 lke~Pde~clLrsL~rLDlSNN~is~Lp~sLgnl-hL~~L---~leGNPlrTiRr~ii~~gT~~vLKyLrs~~~~dglS~  339 (565)
T KOG0472|consen  264 LKEVPDEICLLRSLERLDLSNNDISSLPYSLGNL-HLKFL---ALEGNPLRTIRREIISKGTQEVLKYLRSKIKDDGLSQ  339 (565)
T ss_pred             cccCchHHHHhhhhhhhcccCCccccCCcccccc-eeeeh---hhcCCchHHHHHHHHcccHHHHHHHHHHhhccCCCCC
Confidence            8888888888888888888888888777766655 22111   11000                                


Q ss_pred             ---------------------------------------------------Cc------------------------eec
Q psy9862         229 ---------------------------------------------------PW------------------------LVL  233 (378)
Q Consensus       229 ---------------------------------------------------~~------------------------l~l  233 (378)
                                                                         +.                        +.+
T Consensus       340 se~~~e~~~t~~~~~~~~~~~~i~tkiL~~s~~qlt~VPdEVfea~~~~~Vt~VnfskNqL~elPk~L~~lkelvT~l~l  419 (565)
T KOG0472|consen  340 SEGGTETAMTLPSESFPDIYAIITTKILDVSDKQLTLVPDEVFEAAKSEIVTSVNFSKNQLCELPKRLVELKELVTDLVL  419 (565)
T ss_pred             CcccccccCCCCCCcccchhhhhhhhhhcccccccccCCHHHHHHhhhcceEEEecccchHhhhhhhhHHHHHHHHHHHh
Confidence                                                               00                        444


Q ss_pred             cCCccccccccccCCcCcceeecccccCCcCCCCCCCcccccccccccccCCCCccC------ccchhhhhccCcccccc
Q psy9862         234 RENDLIEIPKELGNLSRLRELHIQANRLTVLPPEIGNLDLASHKSVLKMDFNPWVTP------IADQLQLVLRENDLIEI  307 (378)
Q Consensus       234 ~~~~l~~l~~~l~~~~~L~~L~l~~n~l~~~~~~~~~l~~~~~l~~l~l~~~~~~~~------~~~l~~L~l~~n~l~~l  307 (378)
                      +.|.++.+|..+..+++|..|++++|-+..+|..++.+   ..|+.+++++|.|...      +..++.+-.++|+++++
T Consensus       420 snn~isfv~~~l~~l~kLt~L~L~NN~Ln~LP~e~~~l---v~Lq~LnlS~NrFr~lP~~~y~lq~lEtllas~nqi~~v  496 (565)
T KOG0472|consen  420 SNNKISFVPLELSQLQKLTFLDLSNNLLNDLPEEMGSL---VRLQTLNLSFNRFRMLPECLYELQTLETLLASNNQIGSV  496 (565)
T ss_pred             hcCccccchHHHHhhhcceeeecccchhhhcchhhhhh---hhhheecccccccccchHHHhhHHHHHHHHhcccccccc
Confidence            55555556666788888899999999888888877655   5588889999987542      22345667778999999


Q ss_pred             chh-hcCCCCCCEEEeecCCCCcCChhhccCCCccCcceeeccCCCCCccchHHhhhhhHHHHHHHhhh
Q psy9862         308 PKE-LGNLSRLRELHIQANRLTVLPPEIGNLDLASHKSVLKMDFNPWVTPIADQLQVGISHVLDYIRSE  375 (378)
Q Consensus       308 ~~~-l~~~~~L~~L~l~~n~l~~~~~~~~~l~~~~~l~~l~l~~n~~~~~~~~~~~~~~~~~~~~~~~~  375 (378)
                      ++. +..|.+|+.||+.+|.+..+|+.++++.   +++.++++||+|..+..+.+..|+..+++|++.+
T Consensus       497 d~~~l~nm~nL~tLDL~nNdlq~IPp~Lgnmt---nL~hLeL~gNpfr~Pr~~iLmkgT~aiL~ylrdr  562 (565)
T KOG0472|consen  497 DPSGLKNMRNLTTLDLQNNDLQQIPPILGNMT---NLRHLELDGNPFRQPRHQILMKGTAAILSYLRDR  562 (565)
T ss_pred             ChHHhhhhhhcceeccCCCchhhCChhhcccc---ceeEEEecCCccCCCHHHHhccChHHHHHHhccc
Confidence            877 8999999999999999999999999987   9999999999999888888999999999999875

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG4194|consensus Back     alignment and domain information
>KOG0472|consensus Back     alignment and domain information
>KOG0444|consensus Back     alignment and domain information
>KOG0444|consensus Back     alignment and domain information
>KOG4194|consensus Back     alignment and domain information
>KOG0617|consensus Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG0617|consensus Back     alignment and domain information
>KOG4237|consensus Back     alignment and domain information
>KOG0618|consensus Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG0618|consensus Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG0532|consensus Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG4237|consensus Back     alignment and domain information
>KOG0532|consensus Back     alignment and domain information
>KOG1909|consensus Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG3207|consensus Back     alignment and domain information
>KOG3207|consensus Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG1259|consensus Back     alignment and domain information
>KOG1259|consensus Back     alignment and domain information
>KOG4658|consensus Back     alignment and domain information
>KOG1909|consensus Back     alignment and domain information
>KOG0531|consensus Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG0531|consensus Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG1859|consensus Back     alignment and domain information
>KOG1859|consensus Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG4658|consensus Back     alignment and domain information
>KOG2982|consensus Back     alignment and domain information
>KOG4579|consensus Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG2120|consensus Back     alignment and domain information
>KOG2982|consensus Back     alignment and domain information
>KOG4579|consensus Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG2120|consensus Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG3665|consensus Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG1644|consensus Back     alignment and domain information
>KOG1644|consensus Back     alignment and domain information
>KOG3665|consensus Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG4308|consensus Back     alignment and domain information
>KOG2739|consensus Back     alignment and domain information
>KOG2123|consensus Back     alignment and domain information
>KOG2739|consensus Back     alignment and domain information
>KOG2123|consensus Back     alignment and domain information
>KOG4341|consensus Back     alignment and domain information
>KOG4242|consensus Back     alignment and domain information
>KOG4308|consensus Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>smart00368 LRR_RI Leucine rich repeat, ribonuclease inhibitor type Back     alignment and domain information
>KOG0473|consensus Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>KOG1947|consensus Back     alignment and domain information
>KOG0473|consensus Back     alignment and domain information
>smart00364 LRR_BAC Leucine-rich repeats, bacterial type Back     alignment and domain information
>smart00368 LRR_RI Leucine rich repeat, ribonuclease inhibitor type Back     alignment and domain information
>KOG4341|consensus Back     alignment and domain information
>smart00365 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query378
4b8c_D 727 Nuclease Module Of The Yeast Ccr4-Not Complex Lengt 1e-10
4b8c_D 727 Nuclease Module Of The Yeast Ccr4-Not Complex Lengt 3e-07
2o6q_A270 Structural Diversity Of The Hagfish Variable Lympho 3e-10
1sq0_B288 Crystal Structure Of The Complex Of The Wild-Type V 8e-06
1sq0_B288 Crystal Structure Of The Complex Of The Wild-Type V 2e-04
1sq0_B288 Crystal Structure Of The Complex Of The Wild-Type V 5e-04
3rgx_A 768 Structural Insight Into Brassinosteroid Perception 2e-05
3riz_A 772 Crystal Structure Of The Plant Steroid Receptor Bri 2e-05
3e6j_A229 Crystal Structure Of Variable Lymphocyte Receptor ( 3e-05
2o6s_A208 Structural Diversity Of The Hagfish Variable Lympho 3e-05
3kj4_A286 Structure Of Rat Nogo Receptor Bound To 1d9 Antagon 3e-05
3pmh_G290 Mechanism Of Sulfotyrosine-Mediated Glycoprotein Ib 3e-05
1p8t_A285 Crystal Structure Of Nogo-66 Receptor Length = 285 3e-05
1ook_G290 Crystal Structure Of The Complex Of Platelet Recept 3e-05
1p9a_G290 Crystal Structure Of N-terminal Domain Of Human Pla 3e-05
1ozn_A285 1.5a Crystal Structure Of The Nogo Receptor Ligand 3e-05
1p8v_A279 Crystal Structure Of The Complex Of Platelet Recept 4e-05
3p72_A269 Structure Of Platelet Glycoprotein 1b Alpha With A 4e-05
1u0n_D265 The Ternary Von Willebrand Factor A1-Glycoprotein I 4e-05
1gwb_B281 Structure Of Glycoprotein 1b Length = 281 4e-05
1m0z_A290 Crystal Structure Of The Von Willebrand Factor Bind 4e-05
1m10_B290 Crystal Structure Of The Complex Of Glycoprotein Ib 4e-05
2o6r_A177 Structural Diversity Of The Hagfish Variable Lympho 5e-05
2ft3_A332 Crystal Structure Of The Biglycan Dimer Core Protei 7e-05
3a79_B562 Crystal Structure Of Tlr2-Tlr6-Pam2csk4 Complex Len 2e-04
2wfh_A193 The Human Slit 2 Dimerization Domain D4 Length = 19 4e-04
1xku_A330 Crystal Structure Of The Dimeric Protein Core Of De 6e-04
1xcd_A329 Dimeric Bovine Tissue-Extracted Decorin, Crystal Fo 6e-04
>pdb|4B8C|D Chain D, Nuclease Module Of The Yeast Ccr4-Not Complex Length = 727 Back     alignment and structure 
Iteration: 1

 Score = 64.3 bits (155), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 38/93 (40%), Positives = 51/93 (54%), Gaps = 2/93 (2%)
Query: 122 VLEVLDLTYNNLNEQSLPGNFFMLETLRALYLGDNDFEVLPAEIGNLKNLQILVLRENDL 181
           +   LDL+  NL   ++  N F  + L  LYL  N    LPAEI NL NL++L L  N L
Sbjct: 225 LWHALDLS--NLQIFNISANIFKYDFLTRLYLNGNSLTELPAEIKNLSNLRVLDLSHNRL 282
Query: 182 IEIPKELGNLTRLRELHIQANRLTVLPPEIGNL 214
             +P ELG+  +L+  +   N +T LP E GNL
Sbjct: 283 TSLPAELGSCFQLKYFYFFDNMVTTLPWEFGNL 315
>pdb|4B8C|D Chain D, Nuclease Module Of The Yeast Ccr4-Not Complex Length = 727 Back     alignment and structure
>pdb|2O6Q|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors A29 Length = 270 Back     alignment and structure
>pdb|1SQ0|B Chain B, Crystal Structure Of The Complex Of The Wild-Type Von Willebrand Factor A1 Domain And Glycoprotein Ib Alpha At 2.6 Angstrom Resolution Length = 288 Back     alignment and structure
>pdb|1SQ0|B Chain B, Crystal Structure Of The Complex Of The Wild-Type Von Willebrand Factor A1 Domain And Glycoprotein Ib Alpha At 2.6 Angstrom Resolution Length = 288 Back     alignment and structure
>pdb|1SQ0|B Chain B, Crystal Structure Of The Complex Of The Wild-Type Von Willebrand Factor A1 Domain And Glycoprotein Ib Alpha At 2.6 Angstrom Resolution Length = 288 Back     alignment and structure
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure
>pdb|3E6J|A Chain A, Crystal Structure Of Variable Lymphocyte Receptor (Vlr) Rbc36 In Complex With H-Trisaccharide Length = 229 Back     alignment and structure
>pdb|2O6S|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors B59 Length = 208 Back     alignment and structure
>pdb|3KJ4|A Chain A, Structure Of Rat Nogo Receptor Bound To 1d9 Antagonist Antibody Length = 286 Back     alignment and structure
>pdb|3PMH|G Chain G, Mechanism Of Sulfotyrosine-Mediated Glycoprotein Ib Interaction With Two Distinct Alpha-Thrombin Sites Length = 290 Back     alignment and structure
>pdb|1P8T|A Chain A, Crystal Structure Of Nogo-66 Receptor Length = 285 Back     alignment and structure
>pdb|1OOK|G Chain G, Crystal Structure Of The Complex Of Platelet Receptor Gpib-alpha And Human Alpha-thrombin Length = 290 Back     alignment and structure
>pdb|1P9A|G Chain G, Crystal Structure Of N-terminal Domain Of Human Platelet Receptor Glycoprotein Ib-alpha At 1.7 Angstrom Resolution Length = 290 Back     alignment and structure
>pdb|1OZN|A Chain A, 1.5a Crystal Structure Of The Nogo Receptor Ligand Binding Domain Reveals A Convergent Recognition Scaffold Mediating Inhibition Of Myelination Length = 285 Back     alignment and structure
>pdb|1P8V|A Chain A, Crystal Structure Of The Complex Of Platelet Receptor Gpib-alpha And Alpha-thrombin At 2.6a Length = 279 Back     alignment and structure
>pdb|3P72|A Chain A, Structure Of Platelet Glycoprotein 1b Alpha With A Bound Peptide Inhibitor Length = 269 Back     alignment and structure
>pdb|1U0N|D Chain D, The Ternary Von Willebrand Factor A1-Glycoprotein Ibalpha- Botrocetin Complex Length = 265 Back     alignment and structure
>pdb|1GWB|B Chain B, Structure Of Glycoprotein 1b Length = 281 Back     alignment and structure
>pdb|1M0Z|A Chain A, Crystal Structure Of The Von Willebrand Factor Binding Domain Of Glycoprotein Ib Alpha Length = 290 Back     alignment and structure
>pdb|1M10|B Chain B, Crystal Structure Of The Complex Of Glycoprotein Ib Alpha And The Von Willebrand Factor A1 Domain Length = 290 Back     alignment and structure
>pdb|2O6R|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors B61 Length = 177 Back     alignment and structure
>pdb|2FT3|A Chain A, Crystal Structure Of The Biglycan Dimer Core Protein Length = 332 Back     alignment and structure
>pdb|3A79|B Chain B, Crystal Structure Of Tlr2-Tlr6-Pam2csk4 Complex Length = 562 Back     alignment and structure
>pdb|2WFH|A Chain A, The Human Slit 2 Dimerization Domain D4 Length = 193 Back     alignment and structure
>pdb|1XKU|A Chain A, Crystal Structure Of The Dimeric Protein Core Of Decorin, The Archetypal Small Leucine-Rich Repeat Proteoglycan Length = 330 Back     alignment and structure
>pdb|1XCD|A Chain A, Dimeric Bovine Tissue-Extracted Decorin, Crystal Form 1 Length = 329 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query378
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 7e-47
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-41
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-38
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-32
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 5e-09
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 7e-40
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-38
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-34
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-16
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 3e-35
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 4e-28
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-23
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-14
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 6e-07
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 6e-35
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-32
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-31
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-29
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-18
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-11
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 3e-34
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-32
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-30
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-26
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 2e-20
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-32
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 2e-28
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 9e-25
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-24
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 9e-04
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 4e-32
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 3e-31
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-25
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 2e-24
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 5e-19
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 5e-17
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 7e-30
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-28
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-24
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 3e-20
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 9e-15
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 8e-10
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 5e-29
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-23
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 4e-19
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 7e-18
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 2e-28
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-22
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 1e-19
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-17
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 4e-28
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-25
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 4e-21
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 8e-21
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 4e-11
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-06
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-04
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 8e-28
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-27
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 4e-18
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 4e-27
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 6e-22
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-18
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 2e-15
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 8e-11
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 6e-27
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 9e-23
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 6e-22
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-21
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 5e-17
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-26
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-23
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-23
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-22
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-22
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-17
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-10
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-26
1ozn_A 285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-05
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-25
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-13
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 3e-08
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-25
4fmz_A347 Internalin; leucine rich repeat, structural genomi 4e-25
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-19
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 5e-14
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 5e-25
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-23
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-23
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 3e-22
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 3e-21
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 6e-25
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 4e-24
2z66_A 306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-10
2z66_A 306 Variable lymphocyte receptor B, TOLL-like recepto; 4e-06
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-24
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-21
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 4e-18
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 3e-24
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 2e-15
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-24
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-23
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 8e-20
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-18
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 7e-05
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 4e-24
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-13
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 5e-24
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 4e-21
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-23
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-21
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-22
1o6v_A 466 Internalin A; bacterial infection, extracellular r 2e-19
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-19
1o6v_A 466 Internalin A; bacterial infection, extracellular r 1e-10
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 4e-22
1p9a_G 290 Platelet glycoprotein IB alpha chain precursor; pl 4e-07
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 5e-22
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 4e-21
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-21
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-17
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-21
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-21
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 5e-20
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 6e-17
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-16
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 9e-16
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 5e-15
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-19
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-18
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 5e-17
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 9e-17
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-16
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-08
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 7e-19
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 3e-14
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 4e-14
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 8e-09
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 4e-18
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 7e-16
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-08
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 7e-04
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 8e-18
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 1e-17
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-17
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-17
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-16
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 9e-14
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 6e-13
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 8e-17
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-13
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-06
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-15
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 6e-08
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 6e-08
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 8e-15
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-07
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 5e-06
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 3e-04
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 9e-15
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-14
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 9e-14
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-07
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 3e-14
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 2e-13
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 9e-10
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 3e-14
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-04
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 3e-14
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 8e-07
1h6u_A 308 Internalin H; cell adhesion, leucine rich repeat, 4e-04
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 1e-13
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 6e-05
3e6j_A229 Variable lymphocyte receptor diversity region; var 6e-13
3e6j_A229 Variable lymphocyte receptor diversity region; var 3e-09
3e6j_A229 Variable lymphocyte receptor diversity region; var 6e-05
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 5e-12
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 4e-10
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 9e-07
3m19_A251 Variable lymphocyte receptor A diversity region; a 1e-11
3m19_A251 Variable lymphocyte receptor A diversity region; a 4e-09
3m19_A251 Variable lymphocyte receptor A diversity region; a 3e-08
3m19_A251 Variable lymphocyte receptor A diversity region; a 4e-04
1w8a_A192 SLIT protein; signaling protein, secreted protein, 1e-11
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-11
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 4e-09
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-07
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-11
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 3e-11
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 8e-10
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 3e-09
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 2e-11
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 1e-10
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 3e-08
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 1e-06
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 1e-10
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-10
4ezg_A197 Putative uncharacterized protein; internalin-A, le 7e-10
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-08
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-08
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 4e-10
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 3e-08
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 3e-06
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 1e-04
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 2e-09
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 5e-08
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 8e-06
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 1e-05
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 2e-08
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 3e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-07
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 7e-07
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 2e-06
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 1e-05
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 5e-06
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 2e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 6e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 7e-04
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query378
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.97
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.97
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.97
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.97
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.97
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 99.97
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.97
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.96
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.96
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.96
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.96
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.96
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.96
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.96
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.96
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 99.96
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.96
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.95
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.95
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 99.95
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.95
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.95
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.95
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.95
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.94
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.94
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.94
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.94
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.94
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.94
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.94
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.94
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.94
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.94
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.94
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.94
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.94
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.94
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.94
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.94
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.94
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.94
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.93
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.93
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.93
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.93
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.92
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.92
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.92
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.92
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 99.92
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.92
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.92
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.91
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.91
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.91
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.91
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.9
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.9
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.9
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.9
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.89
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.89
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.89
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.88
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.88
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.88
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.88
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.88
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.88
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.87
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.87
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.85
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.85
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.85
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.85
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.85
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.84
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.84
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.84
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.84
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.82
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.82
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.82
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.81
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.81
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.8
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.8
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.79
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.76
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.75
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.75
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.75
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.74
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.74
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.73
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.73
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.73
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.72
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.72
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.72
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.72
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.71
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 99.7
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.7
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.69
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.69
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.69
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.68
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.66
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.65
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.65
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.65
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.64
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.64
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.63
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.61
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.6
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.6
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.6
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.57
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.57
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.57
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.54
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.52
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.5
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.47
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.46
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.45
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.44
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.42
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.4
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.38
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.37
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.32
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.31
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.3
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.29
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.27
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.26
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.26
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.21
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.09
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.03
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.98
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.96
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.61
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.54
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.54
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.52
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.47
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.41
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.17
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.07
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 97.88
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.87
4gt6_A394 Cell surface protein; leucine rich repeats, putati 97.85
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.69
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.66
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 97.6
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.56
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.56
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 96.82
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.24
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
Probab=99.97  E-value=1.7e-31  Score=271.06  Aligned_cols=249  Identities=30%  Similarity=0.426  Sum_probs=188.3

Q ss_pred             CccchhccccCCcccc-cCCCCCCCCCcccEEEccCCCCCCCCCCcccccCccccEEecCCCCCc-cCCccccCCCCCcE
Q psy9862          96 LPFLFLQFPCRMNRLS-SLPRGFGAFPVLEVLDLTYNNLNEQSLPGNFFMLETLRALYLGDNDFE-VLPAEIGNLKNLQI  173 (378)
Q Consensus        96 ~~~l~~~l~l~~~~l~-~~~~~~~~~~~L~~L~l~~n~i~~~~~~~~l~~l~~L~~L~l~~n~l~-~l~~~l~~l~~L~~  173 (378)
                      +++++ ++++++|.++ .+|..|..+++|++|++++|.+.+ ..|..+..+++|++|++++|.+. .+|..+..+++|++
T Consensus       393 ~~~L~-~L~L~~n~l~~~~p~~l~~l~~L~~L~Ls~N~l~~-~~p~~l~~l~~L~~L~L~~n~l~~~~p~~~~~l~~L~~  470 (768)
T 3rgz_A          393 KNTLQ-ELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSG-TIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLET  470 (768)
T ss_dssp             TCCCC-EEECCSSEEEEECCGGGGGCTTCCEEECCSSEEES-CCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCE
T ss_pred             cCCcc-EEECCCCccccccCHHHhcCCCCCEEECcCCcccC-cccHHHhcCCCCCEEECCCCcccCcCCHHHcCCCCceE
Confidence            34566 6667777666 556667777777777777777765 45666777777777777777776 56777777777888


Q ss_pred             EecCCCCCc-cCChhhcCCCCCcEEeccCCcCc-ccCcccccccccccccccccCCCCceeccCCccc-cccccccCCcC
Q psy9862         174 LVLRENDLI-EIPKELGNLTRLRELHIQANRLT-VLPPEIGNLDLASHKSVLKMDFNPWLVLRENDLI-EIPKELGNLSR  250 (378)
Q Consensus       174 L~l~~n~~~-~l~~~l~~l~~L~~L~l~~~~l~-~~~~~~~~l~~l~~l~~~~~~~~~~l~l~~~~l~-~l~~~l~~~~~  250 (378)
                      |++++|.++ .+|..+..+++|+.|++++|.++ .+|.+++.++.++           .+++++|.+. .+|..+..+++
T Consensus       471 L~L~~N~l~~~~p~~l~~l~~L~~L~L~~N~l~~~~p~~~~~l~~L~-----------~L~L~~N~l~~~~p~~l~~l~~  539 (768)
T 3rgz_A          471 LILDFNDLTGEIPSGLSNCTNLNWISLSNNRLTGEIPKWIGRLENLA-----------ILKLSNNSFSGNIPAELGDCRS  539 (768)
T ss_dssp             EECCSSCCCSCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCC-----------EEECCSSCCEEECCGGGGGCTT
T ss_pred             EEecCCcccCcCCHHHhcCCCCCEEEccCCccCCcCChHHhcCCCCC-----------EEECCCCcccCcCCHHHcCCCC
Confidence            888877777 45777777777888888887777 5666666555444           3889999987 78888999999


Q ss_pred             cceeecccccCC-cCCCCCCC-----------------------------------------------------------
Q psy9862         251 LRELHIQANRLT-VLPPEIGN-----------------------------------------------------------  270 (378)
Q Consensus       251 L~~L~l~~n~l~-~~~~~~~~-----------------------------------------------------------  270 (378)
                      |+.|++++|.+. .+|..+..                                                           
T Consensus       540 L~~L~Ls~N~l~g~ip~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~l~~~~  619 (768)
T 3rgz_A          540 LIWLDLNTNLFNGTIPAAMFKQSGKIAANFIAGKRYVYIKNDGMKKECHGAGNLLEFQGIRSEQLNRLSTRNPCNITSRV  619 (768)
T ss_dssp             CCEEECCSSEEESBCCGGGGTTTTCBCCSTTCSCEEEEEECCSCCTTCCSSEEEEECTTCCGGGGGGGGGTCCSCTTSCE
T ss_pred             CCEEECCCCccCCcCChHHhcccchhhhhccccccccccccccccccccccccccccccccchhhhccccccccccccce
Confidence            999999999886 66644322                                                           


Q ss_pred             --------cccccccccccccCCCCccCc-------cchhhhhccCcccc-ccchhhcCCCCCCEEEeecCCCC-cCChh
Q psy9862         271 --------LDLASHKSVLKMDFNPWVTPI-------ADQLQLVLRENDLI-EIPKELGNLSRLRELHIQANRLT-VLPPE  333 (378)
Q Consensus       271 --------l~~~~~l~~l~l~~~~~~~~~-------~~l~~L~l~~n~l~-~l~~~l~~~~~L~~L~l~~n~l~-~~~~~  333 (378)
                              +..++.++.+++++|.+.+..       +.++.|++++|.++ .+|..++.+++|++||+++|+++ .+|..
T Consensus       620 ~~g~~~~~~~~l~~L~~LdLs~N~l~g~ip~~l~~l~~L~~L~Ls~N~l~g~ip~~l~~L~~L~~LdLs~N~l~g~ip~~  699 (768)
T 3rgz_A          620 YGGHTSPTFDNNGSMMFLDMSYNMLSGYIPKEIGSMPYLFILNLGHNDISGSIPDEVGDLRGLNILDLSSNKLDGRIPQA  699 (768)
T ss_dssp             EEEECCCSCSSSBCCCEEECCSSCCBSCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCEECCCGG
T ss_pred             ecccCchhhhccccccEEECcCCcccccCCHHHhccccCCEEeCcCCccCCCCChHHhCCCCCCEEECCCCcccCcCChH
Confidence                    223456778888888876543       45778899999997 88888999999999999999998 77777


Q ss_pred             hccCCCccCcceeeccCCCCCccchHH
Q psy9862         334 IGNLDLASHKSVLKMDFNPWVTPIADQ  360 (378)
Q Consensus       334 ~~~l~~~~~l~~l~l~~n~~~~~~~~~  360 (378)
                      ++.++   .|+++++++|+++|.+|+.
T Consensus       700 l~~l~---~L~~L~ls~N~l~g~iP~~  723 (768)
T 3rgz_A          700 MSALT---MLTEIDLSNNNLSGPIPEM  723 (768)
T ss_dssp             GGGCC---CCSEEECCSSEEEEECCSS
T ss_pred             HhCCC---CCCEEECcCCcccccCCCc
Confidence            76665   8999999999999998875
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 378
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 1e-14
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 7e-10
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 6e-12
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 6e-11
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-09
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-08
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 3e-04
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 0.001
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-09
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 5e-08
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 8e-08
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-06
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-06
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-05
d1jl5a_ 353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 3e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 4e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.002
d1jl5a_ 353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.003
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 4e-08
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 1e-07
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 5e-06
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 0.002
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 0.003
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 5e-08
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 3e-06
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 2e-05
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 3e-04
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 1e-07
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 3e-06
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 3e-06
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 4e-06
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 2e-05
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 2e-05
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 5e-06
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 6e-04
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 1e-05
d1w8aa_192 c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga 3e-05
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 1e-04
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 6e-04
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 0.004
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 6e-04
d2ca6a1 344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 0.004
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 7e-04
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 8e-04
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 0.001
d1m9la_198 c.10.3.1 (A:) Outer arm dynein light chain 1 {Gree 0.003
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Ngr ectodomain-like
domain: Decorin
species: Cow (Bos taurus) [TaxId: 9913]

 Score = 72.0 bits (175), Expect = 1e-14
 Identities = 56/275 (20%), Positives = 106/275 (38%), Gaps = 33/275 (12%)

Query: 105 CRMNRLSSLPRGFGAFPVLEVLDLTYNNLNEQSLPGNFFMLETLRALYLGDNDF-EVLPA 163
           C    L  +P+     P   +LDL  N + E    G+F  L+ L  L L +N   ++ P 
Sbjct: 17  CSDLGLEKVPKDL--PPDTALLDLQNNKITEIK-DGDFKNLKNLHTLILINNKISKISPG 73

Query: 164 EIGNLKNLQILVLRENDLIEIPKELGNLTRLRELHIQANRLTVLPPEIGN-------LDL 216
               L  L+ L L +N L E+P+++     L+EL +  N +T +   + N       ++L
Sbjct: 74  AFAPLVKLERLYLSKNQLKELPEKMPK--TLQELRVHENEITKVRKSVFNGLNQMIVVEL 131

Query: 217 ASHKSVLKMDFNPWLV---------LRENDLIEIPKELGNLSRLRELHIQANRLTVLPPE 267
            ++        N             + + ++  IP+  G    L ELH+  N++T +   
Sbjct: 132 GTNPLKSSGIENGAFQGMKKLSYIRIADTNITTIPQ--GLPPSLTELHLDGNKITKVDAA 189

Query: 268 I----GNLDLASHKSVLKMDFNPWVTPIADQL-QLVLRENDLIEIPKELGNLSRLRELHI 322
                 NL             +         L +L L  N L+++P  L +   ++ +++
Sbjct: 190 SLKGLNNLAKLGLSFNSISAVDNGSLANTPHLRELHLNNNKLVKVPGGLADHKYIQVVYL 249

Query: 323 QANRLTVLPPE----IGNLDLASHKSVLKMDFNPW 353
             N ++ +        G     +  S + +  NP 
Sbjct: 250 HNNNISAIGSNDFCPPGYNTKKASYSGVSLFSNPV 284
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 198 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query378
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.91
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.9
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.89
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.87
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.87
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.85
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.85
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.85
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.83
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.81
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.8
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.72
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.71
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.7
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.68
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.67
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.65
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.64
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.64
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.6
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.58
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.57
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.55
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.54
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.53
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.48
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.48
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.43
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.43
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.43
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.3
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.26
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.22
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.16
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.13
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.12
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.21
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.94
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.92
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.9
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.59
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.43
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]

Probab=99.91  E-value=6.5e-23  Score=188.93  Aligned_cols=277  Identities=23%  Similarity=0.322  Sum_probs=165.5

Q ss_pred             ccCCceeeccCCcccCcCcccccccccccEEEcccccccCchhHHHHhhccccccCCccccCCCCCCCCccchhccccCC
Q psy9862          28 IKNPELELADKGLSSFEELPGLMNMLYITRITLSHNKLKGEIIVQVIKGLSNSKYNYIPILHVTSLPILPFLFLQFPCRM  107 (378)
Q Consensus        28 ~~l~~L~l~~~~~~~~~~~~~l~~~~~L~~L~ls~~~l~~~~~~~~~~~l~~l~~~~l~~l~l~~~~~~~~l~~~l~l~~  107 (378)
                      .++++|++++++|+.+   +.+.++++|++|++++|++++     ++ .+.+                +++|+ ++++++
T Consensus        44 ~~l~~L~l~~~~I~~l---~gl~~L~nL~~L~Ls~N~l~~-----l~-~l~~----------------L~~L~-~L~L~~   97 (384)
T d2omza2          44 DQVTTLQADRLGIKSI---DGVEYLNNLTQINFSNNQLTD-----IT-PLKN----------------LTKLV-DILMNN   97 (384)
T ss_dssp             TTCCEEECCSSCCCCC---TTGGGCTTCCEEECCSSCCCC-----CG-GGTT----------------CTTCC-EEECCS
T ss_pred             CCCCEEECCCCCCCCc---cccccCCCCCEEeCcCCcCCC-----Cc-cccC----------------Ccccc-cccccc
Confidence            4689999999999864   456789999999999999986     22 1333                33566 888888


Q ss_pred             cccccCCCCCCCCCcccEEEccCCCCCCCCCCcccccCccccEEecCCCC------------------------------
Q psy9862         108 NRLSSLPRGFGAFPVLEVLDLTYNNLNEQSLPGNFFMLETLRALYLGDND------------------------------  157 (378)
Q Consensus       108 ~~l~~~~~~~~~~~~L~~L~l~~n~i~~~~~~~~l~~l~~L~~L~l~~n~------------------------------  157 (378)
                      |.+..++. ++++++|+.|+++++.+.+...   ......+.......+.                              
T Consensus        98 n~i~~i~~-l~~l~~L~~L~~~~~~~~~~~~---~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  173 (384)
T d2omza2          98 NQIADITP-LANLTNLTGLTLFNNQITDIDP---LKNLTNLNRLELSSNTISDISALSGLTSLQQLSFGNQVTDLKPLAN  173 (384)
T ss_dssp             SCCCCCGG-GTTCTTCCEEECCSSCCCCCGG---GTTCTTCSEEEEEEEEECCCGGGTTCTTCSEEEEEESCCCCGGGTT
T ss_pred             cccccccc-cccccccccccccccccccccc---ccccccccccccccccccccccccccccccccccccccchhhhhcc
Confidence            88887654 7788888888888887764211   1111111111111000                              


Q ss_pred             ------------CccCCccccCCCCCcEEecCCCCCccCChhhcCCCCCcEEeccCCcCcccCccccccccccccccccc
Q psy9862         158 ------------FEVLPAEIGNLKNLQILVLRENDLIEIPKELGNLTRLRELHIQANRLTVLPPEIGNLDLASHKSVLKM  225 (378)
Q Consensus       158 ------------l~~l~~~l~~l~~L~~L~l~~n~~~~l~~~l~~l~~L~~L~l~~~~l~~~~~~~~~l~~l~~l~~~~~  225 (378)
                                  ..........+++++.+++++|.++.+++ +..+++|+.+++++|.++.++ .+..+..++       
T Consensus       174 ~~~~~~~~~~~~~~~~~~~~~~l~~~~~l~l~~n~i~~~~~-~~~~~~L~~L~l~~n~l~~~~-~l~~l~~L~-------  244 (384)
T d2omza2         174 LTTLERLDISSNKVSDISVLAKLTNLESLIATNNQISDITP-LGILTNLDELSLNGNQLKDIG-TLASLTNLT-------  244 (384)
T ss_dssp             CTTCCEEECCSSCCCCCGGGGGCTTCSEEECCSSCCCCCGG-GGGCTTCCEEECCSSCCCCCG-GGGGCTTCS-------
T ss_pred             ccccccccccccccccccccccccccceeeccCCccCCCCc-ccccCCCCEEECCCCCCCCcc-hhhcccccc-------
Confidence                        00112234555677777777777776643 455667777777777766543 233333322       


Q ss_pred             CCCCceeccCCccccccccccCCcCcceeecccccCCcCCCCCCCcccccccccccccCCCCc-----cCccchhhhhcc
Q psy9862         226 DFNPWLVLRENDLIEIPKELGNLSRLRELHIQANRLTVLPPEIGNLDLASHKSVLKMDFNPWV-----TPIADQLQLVLR  300 (378)
Q Consensus       226 ~~~~~l~l~~~~l~~l~~~l~~~~~L~~L~l~~n~l~~~~~~~~~l~~~~~l~~l~l~~~~~~-----~~~~~l~~L~l~  300 (378)
                          .+++.+|.+..++. +..+++|+.++++++.+..++.    +.....+..+....+.+.     ...+.++.|+++
T Consensus       245 ----~L~l~~n~l~~~~~-~~~~~~L~~L~l~~~~l~~~~~----~~~~~~l~~l~~~~n~l~~~~~~~~~~~l~~L~ls  315 (384)
T d2omza2         245 ----DLDLANNQISNLAP-LSGLTKLTELKLGANQISNISP----LAGLTALTNLELNENQLEDISPISNLKNLTYLTLY  315 (384)
T ss_dssp             ----EEECCSSCCCCCGG-GTTCTTCSEEECCSSCCCCCGG----GTTCTTCSEEECCSSCCSCCGGGGGCTTCSEEECC
T ss_pred             ----hhccccCccCCCCc-ccccccCCEeeccCcccCCCCc----cccccccccccccccccccccccchhcccCeEECC
Confidence                36666666666543 5666777777777776664432    223344445555554432     234455566666


Q ss_pred             CccccccchhhcCCCCCCEEEeecCCCCcCChhhccCCCccCcceeeccCCCCCccc
Q psy9862         301 ENDLIEIPKELGNLSRLRELHIQANRLTVLPPEIGNLDLASHKSVLKMDFNPWVTPI  357 (378)
Q Consensus       301 ~n~l~~l~~~l~~~~~L~~L~l~~n~l~~~~~~~~~l~~~~~l~~l~l~~n~~~~~~  357 (378)
                      +|+++.++. +..+++|++|++++|+|+.++ .+..   +++|++|++++|++++-.
T Consensus       316 ~n~l~~l~~-l~~l~~L~~L~L~~n~l~~l~-~l~~---l~~L~~L~l~~N~l~~l~  367 (384)
T d2omza2         316 FNNISDISP-VSSLTKLQRLFFANNKVSDVS-SLAN---LTNINWLSAGHNQISDLT  367 (384)
T ss_dssp             SSCCSCCGG-GGGCTTCCEEECCSSCCCCCG-GGGG---CTTCCEEECCSSCCCBCG
T ss_pred             CCCCCCCcc-cccCCCCCEEECCCCCCCCCh-hHcC---CCCCCEEECCCCcCCCCh
Confidence            666666542 566666666666666666554 2333   346666666666666543
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure