Diaphorina citri psyllid: psy9878

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------34
TVTGPVVNRLCPYLDTINRQLLDFDFEKLCSVSLSRINVYACLVCGKYFQGRGTNTFAYTHSVAESHHVFLNLHTLKFYCLPDNYEIVGTVAGPVVNRLCPYLDTINRQLLDFDFEKLCSVSLSRINVYACLVCGKYFQDSSLDDIKYVLNPTFTTDQIKQLDLSDKMSRAIDGTLYLPGIVGLNNIKANDYCNVILQALCHVTPLRDYFLREINYARVKRPPGDSSFLLVQRFGELMRKLWNPRNFKSHVSPHEMLQAVVLWSRKQFQFTEQSDPIDFLSWFLNTLHRALNGTKKKDSSIVYKTFLGSMKVKTRKIPPVELEEKVRQRLLLTDNSYR
cccccccccccccccccccccccccccccEEEEcccccEEEEccccCEECcccccccccEEccccccEEEEEEcccEEEEcccccccccccccccccccccccccccccccccccccccccccccccHHHHccccccccccccccccccccccccHHHHccccccccccccccccccccccccccccccccHHHHHHHHHHccHHHHHHHccccHHHHcccccccccHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHcccccccccccEEccccEEEEEEECcccccHHHHHHHHHHccccccc
*******NRLCPYLDTINRQLLDFDFEKLCSVSLSRINVYACLVCGKYFQGRGTNTFAYTHSVAESHHVFLNLHTLKFYCLPDNYEIVGTVAGPVVNRLCPYLDTINRQLLDFDFEKLCSVSLSRINVYACLVCGKYFQDSSLDDIKYVLNPTFTTDQIKQLDLSDKMSRAIDGTLYLPGIVGLNNIKANDYCNVILQALCHVTPLRDYFLREINYARVKRPPGDSSFLLVQRFGELMRKLWNPRNFKSHVSPHEMLQAVVLWSRKQFQFTEQSDPIDFLSWFLNTLHRALNGTKKKDSSIVYKTFLGSMKVKTR****************LT*****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
TVTGPVVNRLCPYLDTINRQLLDFDFEKLCSVSLSRINVYACLVCGKYFQGRGTNTFAYTHSVAESHHVFLNLHTLKFYCLPDNYEIVGTVAGPVVNRLCPYLDTINRQLLDFDFEKLCSVSLSRINVYACLVCGKYFQDSSLDDIKYVLNPTFTTDQIKQLDLSDKMSRAIDGTLYLPGIVGLNNIKANDYCNVILQALCHVTPLRDYFLREINYARVKRPPGDSSFLLVQRFGELMRKLWNPRNFKSHVSPHEMLQAVVLWSRKQFQFTEQSDPIDFLSWFLNTLHRALNGTKKKDSSIVYKTFLGSMKVKTRKIPPVELEEKVRQRLLLTDNSYR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
U4/U6.U5 tri-snRNP-associated protein 2 May play a role in mRNA splicing. It is unsure if the protein really exhibits hydrolase activity. Could be a competitor of ubiquitin C-terminal hydrolases (UCHs).confidentQ53GS9
U4/U6.U5 tri-snRNP-associated protein 2 May play a role in mRNA splicing. It is unsure if the protein really exhibits hydrolase activity. Could be a competitor of ubiquitin C-terminal hydrolases (UCHs).confidentQ3TIX9
U4/U6.U5 tri-snRNP-associated protein 2 May play a role in mRNA splicing. It is unsure if the protein really exhibits hydrolase activity. Could be a competitor of ubiquitin C-terminal hydrolases (UCHs).confidentQ5R761

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0071011 [CC]precatalytic spliceosomeprobableGO:0005575, GO:0032991, GO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0030529, GO:0044446, GO:0043229, GO:0044428, GO:0044422, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0005681
GO:0008150 [BP]biological_processprobable

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2GFO, chain A
Confidence level:very confident
Coverage over the Query: 167-319
View the alignment between query and template
View the model in PyMOL
Template: 3IHP, chain A
Confidence level:very confident
Coverage over the Query: 8-90,102-123,175-320
View the alignment between query and template
View the model in PyMOL