Diaphorina citri psyllid: psy987

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110----
MDELEVEVCGENGAYYKVIVKMIKGDFHVVEYLGCQSTFTEIVPPERMRQKNTNPPIDAKTFHKFDIEVPLDQSDWLISKNGKNTNPPIDAKTFHKFDIEVPLDVQELGLMRDL
cccccEEEEcccccEEEEEEEEEEccEEEEEEEccccccccccccccccccccccccccccEEEEEccccHHHHHHHHHHccccccccccccCEEEcccccccccccccccccc
****EVEVCGENGAYYKVIVKMIKGDFHVVEYLGCQSTFTEIVPPERMRQKNTNPPIDAKTFHKFDIEVPLDQSDWLISKNGKNTNPPIDAKTFHKFDIEVPLDVQELGLMR**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDELEVEVCGENGAYYKVIVKMIKGDFHVVEYLGCQSTFTEIVPPERMRQKNTNPPIDAKTFHKFDIEVPLDQSDWLISKNGKNTNPPIDAKTFHKFDIEVPLDVQELGLMRDL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0010494 [CC]cytoplasmic stress granuleprobableGO:0005737, GO:0035770, GO:0043232, GO:0044464, GO:0043229, GO:0005623, GO:0030529, GO:0005575, GO:0044444, GO:0043228, GO:0044424, GO:0032991, GO:0005622, GO:0043226
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0045202 [CC]synapseprobableGO:0005575
GO:0043197 [CC]dendritic spineprobableGO:0044309, GO:0044463, GO:0044464, GO:0030425, GO:0005575, GO:0097458, GO:0005623, GO:0043005, GO:0042995
GO:0043198 [CC]dendritic shaftprobableGO:0044463, GO:0044464, GO:0030425, GO:0005575, GO:0097458, GO:0005623, GO:0043005, GO:0042995
GO:0071598 [CC]neuronal ribonucleoprotein granuleprobableGO:0005737, GO:0005622, GO:0035770, GO:0043232, GO:0032838, GO:0044463, GO:0044464, GO:0043229, GO:0005623, GO:0030529, GO:0005575, GO:0097458, GO:0044444, GO:0043228, GO:0043005, GO:0044424, GO:0032991, GO:0042995, GO:0043226
GO:0005845 [CC]mRNA cap binding complexprobableGO:0043234, GO:0032991, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0034518, GO:0044424
GO:0005844 [CC]polysomeprobableGO:0032991, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424, GO:0030529
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0003723 [MF]RNA bindingprobableGO:0097159, GO:0003674, GO:1901363, GO:0003676, GO:0005488
GO:0045947 [BP]negative regulation of translational initiationprobableGO:0009892, GO:0080090, GO:0009890, GO:0031327, GO:2000112, GO:0031324, GO:0031323, GO:0050789, GO:0051248, GO:0010605, GO:0019222, GO:0010608, GO:0051246, GO:2000113, GO:0065007, GO:0031326, GO:0048519, GO:0010468, GO:0060255, GO:0006446, GO:0009889, GO:0050794, GO:0008150, GO:0032269, GO:0032268, GO:0010556, GO:0017148, GO:0006417, GO:0010558, GO:0048523

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3H8Z, chain A
Confidence level:very confident
Coverage over the Query: 4-57
View the alignment between query and template
View the model in PyMOL
Template: 3H8Z, chain A
Confidence level:very confident
Coverage over the Query: 1-89
View the alignment between query and template
View the model in PyMOL