Diaphorina citri psyllid: psy9896


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-----
MESAMREIQYCQTFLKKRLMFKNELQATVLEVKAIPGLGTTIDTILVNGTLYEGDTVVLAGTDGPIVTQIRSLLMPQPMQELRVKNAYVEYKKIKGTQGVKIAAKDLEKTIAGLNLRVAKDQDEIDDLCDEVARELKSALSTIKL
ccHHHHHHHHHHHHHHHHccccccccEEEEEEEEEccccCEEEEEEEccEEccccEEEEccccccEEEEEEEcccccccHHHHHccccEEEEEEEEcccEEEEcccccccccccEEEEEcccccHHHHHHHHHHHHHHHHHcccc
MESAMREIQYCQTFLKKRLMFKNELQATVLEVKAIPGLGTTIDTILVNGTLYEGDTVVLAGTDGPIVTQIRSLLMPQPMQELRVKNAYVEYKKIKGTQGVKIAAKDLEKTIAGLNLRVAKDQDEIDDLCDEVARELKSALSTIKL
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MESAMREIQYCQTFLKKRLMFKNELQATVLEVKAIPGLGTTIDTILVNGTLYEGDTVVLAGTDGPIVTQIRSLLMPQPMQELRVKNAYVEYKKIKGTQGVKIAxxxxxxxxxxxxxxxxxxxxxIDDLCDEVARELKSALSTIKL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Eukaryotic translation initiation factor 5B Function in general translation initiation by promoting the binding of the formylmethionine-tRNA to ribosomes. Seems to function along with eIF-2.confidentP39730
Eukaryotic translation initiation factor 5B Function in general translation initiation by promoting the binding of the formylmethionine-tRNA to ribosomes. Seems to function along with eIF-2.confidentQ5RDE1
Eukaryotic translation initiation factor 5B Function in general translation initiation by promoting the binding of the formylmethionine-tRNA to ribosomes. Seems to function along with eIF-2.confidentQ10251

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0017151 [MF]DEAD/H-box RNA helicase bindingprobableGO:0003674, GO:0005515, GO:0019899, GO:0005488
GO:0003743 [MF]translation initiation factor activityprobableGO:0097159, GO:0008135, GO:0003674, GO:0005488, GO:0003676, GO:1901363, GO:0003723
GO:0006413 [BP]translational initiationprobableGO:0071704, GO:0044267, GO:0008152, GO:0044260, GO:0044238, GO:0019538, GO:0009987, GO:0009058, GO:0044237, GO:0043170, GO:0044249, GO:0010467, GO:0009059, GO:0044763, GO:0034645, GO:1901576, GO:0008150, GO:0006412, GO:0044699

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1G7S, chain A
Confidence level:very confident
Coverage over the Query: 6-139
View the alignment between query and template
View the model in PyMOL