Psyllid ID: psy9896
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 145 | ||||||
| 91080893 | 1106 | PREDICTED: similar to AGAP004824-PA [Tri | 0.951 | 0.124 | 0.768 | 2e-53 | |
| 195013303 | 1150 | GH15356 [Drosophila grimshawi] gi|193897 | 0.937 | 0.118 | 0.764 | 3e-53 | |
| 357626559 | 1178 | hypothetical protein KGM_03313 [Danaus p | 0.951 | 0.117 | 0.760 | 6e-53 | |
| 194866106 | 1141 | GG14257 [Drosophila erecta] gi|190653542 | 0.937 | 0.119 | 0.757 | 1e-52 | |
| 386770502 | 1090 | eIF5B, isoform D [Drosophila melanogaste | 0.937 | 0.124 | 0.75 | 1e-52 | |
| 195125988 | 1175 | GI12960 [Drosophila mojavensis] gi|19391 | 0.937 | 0.115 | 0.764 | 1e-52 | |
| 386770504 | 1108 | eIF5B, isoform E [Drosophila melanogaste | 0.937 | 0.122 | 0.75 | 1e-52 | |
| 195337174 | 1056 | GM14051 [Drosophila sechellia] gi|194128 | 0.937 | 0.128 | 0.75 | 2e-52 | |
| 24656849 | 1144 | eIF5B, isoform B [Drosophila melanogaste | 0.937 | 0.118 | 0.75 | 2e-52 | |
| 443906781 | 1142 | LD42524p1 [Drosophila melanogaster] | 0.937 | 0.119 | 0.75 | 2e-52 |
| >gi|91080893|ref|XP_973325.1| PREDICTED: similar to AGAP004824-PA [Tribolium castaneum] gi|270005394|gb|EFA01842.1| hypothetical protein TcasGA2_TC007444 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
Score = 213 bits (543), Expect = 2e-53, Method: Compositional matrix adjust.
Identities = 106/138 (76%), Positives = 122/138 (88%)
Query: 8 IQYCQTFLKKRLMFKNELQATVLEVKAIPGLGTTIDTILVNGTLYEGDTVVLAGTDGPIV 67
+++CQT L KRLM+ +ELQATVLEVKAIPGLGTTID ILVNGTL EGDT+V AGTDG IV
Sbjct: 725 VEFCQTKLPKRLMYSDELQATVLEVKAIPGLGTTIDVILVNGTLREGDTMVCAGTDGAIV 784
Query: 68 TQIRSLLMPQPMQELRVKNAYVEYKKIKGTQGVKIAAKDLEKTIAGLNLRVAKDQDEIDD 127
TQIRSLLMPQP++ELRVKNAYVEYK++K QGVKIAAK+LEK IAGLNL VA+ DE++
Sbjct: 785 TQIRSLLMPQPLRELRVKNAYVEYKEVKAAQGVKIAAKELEKAIAGLNLFVAQKSDEVEI 844
Query: 128 LCDEVARELKSALSTIKL 145
L +EV+RELKSALS IKL
Sbjct: 845 LREEVSRELKSALSNIKL 862
|
Source: Tribolium castaneum Species: Tribolium castaneum Genus: Tribolium Family: Tenebrionidae Order: Coleoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|195013303|ref|XP_001983830.1| GH15356 [Drosophila grimshawi] gi|193897312|gb|EDV96178.1| GH15356 [Drosophila grimshawi] | Back alignment and taxonomy information |
|---|
| >gi|357626559|gb|EHJ76611.1| hypothetical protein KGM_03313 [Danaus plexippus] | Back alignment and taxonomy information |
|---|
| >gi|194866106|ref|XP_001971759.1| GG14257 [Drosophila erecta] gi|190653542|gb|EDV50785.1| GG14257 [Drosophila erecta] | Back alignment and taxonomy information |
|---|
| >gi|386770502|ref|NP_001246600.1| eIF5B, isoform D [Drosophila melanogaster] gi|383291728|gb|AFH04271.1| eIF5B, isoform D [Drosophila melanogaster] | Back alignment and taxonomy information |
|---|
| >gi|195125988|ref|XP_002007456.1| GI12960 [Drosophila mojavensis] gi|193919065|gb|EDW17932.1| GI12960 [Drosophila mojavensis] | Back alignment and taxonomy information |
|---|
| >gi|386770504|ref|NP_001246601.1| eIF5B, isoform E [Drosophila melanogaster] gi|383291729|gb|AFH04272.1| eIF5B, isoform E [Drosophila melanogaster] | Back alignment and taxonomy information |
|---|
| >gi|195337174|ref|XP_002035204.1| GM14051 [Drosophila sechellia] gi|194128297|gb|EDW50340.1| GM14051 [Drosophila sechellia] | Back alignment and taxonomy information |
|---|
| >gi|24656849|ref|NP_651974.1| eIF5B, isoform B [Drosophila melanogaster] gi|386770500|ref|NP_001246599.1| eIF5B, isoform C [Drosophila melanogaster] gi|386770506|ref|NP_001246602.1| eIF5B, isoform F [Drosophila melanogaster] gi|23092924|gb|AAF47774.2| eIF5B, isoform B [Drosophila melanogaster] gi|383291727|gb|AFH04270.1| eIF5B, isoform C [Drosophila melanogaster] gi|383291730|gb|AFH04273.1| eIF5B, isoform F [Drosophila melanogaster] | Back alignment and taxonomy information |
|---|
| >gi|443906781|gb|AGD79331.1| LD42524p1 [Drosophila melanogaster] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 145 | ||||||
| FB|FBgn0026259 | 1144 | eIF5B "eIF5B" [Drosophila mela | 0.937 | 0.118 | 0.75 | 5.5e-48 | |
| RGD|735017 | 388 | Eif5b "eukaryotic translation | 0.951 | 0.355 | 0.594 | 2.6e-38 | |
| UNIPROTKB|J9P504 | 1219 | EIF5B "Uncharacterized protein | 0.951 | 0.113 | 0.594 | 3.2e-37 | |
| UNIPROTKB|I3L8K4 | 1219 | EIF5B "Uncharacterized protein | 0.951 | 0.113 | 0.594 | 3.2e-37 | |
| UNIPROTKB|O60841 | 1220 | EIF5B "Eukaryotic translation | 0.951 | 0.113 | 0.594 | 3.2e-37 | |
| UNIPROTKB|F1STE8 | 1220 | EIF5B "Uncharacterized protein | 0.951 | 0.113 | 0.594 | 3.2e-37 | |
| UNIPROTKB|F1PMA6 | 1221 | EIF5B "Uncharacterized protein | 0.951 | 0.113 | 0.594 | 3.2e-37 | |
| MGI|MGI:2441772 | 1216 | Eif5b "eukaryotic translation | 0.951 | 0.113 | 0.594 | 5.2e-37 | |
| RGD|1591046 | 1216 | Eif5b-ps1 "eukaryotic translat | 0.951 | 0.113 | 0.594 | 5.2e-37 | |
| UNIPROTKB|F1N6Y7 | 1220 | EIF5B "Uncharacterized protein | 0.951 | 0.113 | 0.586 | 6.7e-37 |
| FB|FBgn0026259 eIF5B "eIF5B" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 512 (185.3 bits), Expect = 5.5e-48, P = 5.5e-48
Identities = 102/136 (75%), Positives = 116/136 (85%)
Query: 10 YCQTFLKKRLMFKNELQATVLEVKAIPGLGTTIDTILVNGTLYEGDTVVLAGTDGPIVTQ 69
+CQ L KRLM+ ELQATVLEVKA+PGLGTTID IL+NG L EG T+V+AGTDGPIVTQ
Sbjct: 765 FCQNMLAKRLMYSEELQATVLEVKALPGLGTTIDAILINGKLREGQTMVVAGTDGPIVTQ 824
Query: 70 IRSLLMPQPMQELRVKNAYVEYKKIKGTQGVKIAAKDLEKTIAGLNLRVAKDQDEIDDLC 129
IRSLLMPQPM+ELRVKNAYVEYK++K QGVKIAAKDLEK IAG+NL +A DE++
Sbjct: 825 IRSLLMPQPMKELRVKNAYVEYKEVKAAQGVKIAAKDLEKAIAGINLLIAHKPDEVEICT 884
Query: 130 DEVARELKSALSTIKL 145
+EVARELKSALS IKL
Sbjct: 885 EEVARELKSALSHIKL 900
|
|
| RGD|735017 Eif5b "eukaryotic translation initiation factor 5B" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|J9P504 EIF5B "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|I3L8K4 EIF5B "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|O60841 EIF5B "Eukaryotic translation initiation factor 5B" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1STE8 EIF5B "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1PMA6 EIF5B "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:2441772 Eif5b "eukaryotic translation initiation factor 5B" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| RGD|1591046 Eif5b-ps1 "eukaryotic translation initiation factor 5B, pseudogene 1" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1N6Y7 EIF5B "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 145 | |||
| cd03703 | 110 | cd03703, aeIF5B_II, aeIF5B_II: This family represe | 5e-55 | |
| PRK04004 | 586 | PRK04004, PRK04004, translation initiation factor | 1e-36 | |
| PRK14845 | 1049 | PRK14845, PRK14845, translation initiation factor | 1e-27 | |
| TIGR00491 | 590 | TIGR00491, aIF-2, translation initiation factor aI | 2e-23 | |
| cd03701 | 95 | cd03701, IF2_IF5B_II, IF2_IF5B_II: This family rep | 4e-22 | |
| COG0532 | 509 | COG0532, InfB, Translation initiation factor 2 (IF | 1e-21 | |
| cd01342 | 83 | cd01342, Translation_Factor_II_like, Translation_F | 2e-07 | |
| pfam03144 | 70 | pfam03144, GTP_EFTU_D2, Elongation factor Tu domai | 6e-04 |
| >gnl|CDD|239674 cd03703, aeIF5B_II, aeIF5B_II: This family represents the domain II of archeal and eukaryotic aeIF5B | Back alignment and domain information |
|---|
Score = 167 bits (426), Expect = 5e-55
Identities = 64/110 (58%), Positives = 82/110 (74%)
Query: 25 LQATVLEVKAIPGLGTTIDTILVNGTLYEGDTVVLAGTDGPIVTQIRSLLMPQPMQELRV 84
LQ TVLEVK GLGTTID IL +GTL EGDT+V+ G +GPIVT++R+LL PQP++ELRV
Sbjct: 1 LQGTVLEVKEEEGLGTTIDVILYDGTLREGDTIVVCGLNGPIVTKVRALLKPQPLKELRV 60
Query: 85 KNAYVEYKKIKGTQGVKIAAKDLEKTIAGLNLRVAKDQDEIDDLCDEVAR 134
K+ ++ K++K GVKI A DLEK IAG L V +DEI++L +EV
Sbjct: 61 KSRFIHVKEVKAAAGVKILAPDLEKAIAGSPLLVVGPEDEIEELKEEVME 110
|
aeIF5B is a homologue of prokaryotic Initiation Factor 2 (IF2). Disruption of the eIF5B gene (FUN12) in yeast causes a severe slow-growth phenotype, associated with a defect in translation. eIF5B has a function analogous to prokaryotic IF2 in mediating the joining of joining of 60S subunits. The eIF5B consists of three N-terminal domains (I, II, II) connected by a long helix to domain IV. Domain I is a G domain, domain II and IV are beta-barrels and domain III has a novel alpha-beta-alpha sandwich fold. The G domain and the beta-barrel domain II display a similar structure and arrangement to the homologous domains of EF1A, eEF1A and aeIF2gamma. Length = 110 |
| >gnl|CDD|235195 PRK04004, PRK04004, translation initiation factor IF-2; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|237833 PRK14845, PRK14845, translation initiation factor IF-2; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|129582 TIGR00491, aIF-2, translation initiation factor aIF-2/yIF-2 | Back alignment and domain information |
|---|
| >gnl|CDD|239672 cd03701, IF2_IF5B_II, IF2_IF5B_II: This family represents the domain II of prokaryotic Initiation Factor 2 (IF2) and its archeal and eukaryotic homologue aeIF5B | Back alignment and domain information |
|---|
| >gnl|CDD|223606 COG0532, InfB, Translation initiation factor 2 (IF-2; GTPase) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|238652 cd01342, Translation_Factor_II_like, Translation_Factor_II_like: Elongation factor Tu (EF-Tu) domain II-like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|217388 pfam03144, GTP_EFTU_D2, Elongation factor Tu domain 2 | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 145 | |||
| KOG1144|consensus | 1064 | 100.0 | ||
| cd03703 | 110 | aeIF5B_II aeIF5B_II: This family represents the do | 100.0 | |
| PRK14845 | 1049 | translation initiation factor IF-2; Provisional | 100.0 | |
| TIGR00491 | 590 | aIF-2 translation initiation factor aIF-2/yIF-2. T | 99.97 | |
| PRK04004 | 586 | translation initiation factor IF-2; Validated | 99.95 | |
| cd03702 | 95 | IF2_mtIF2_II This family represents the domain II | 99.91 | |
| COG0532 | 509 | InfB Translation initiation factor 2 (IF-2; GTPase | 99.91 | |
| cd03701 | 95 | IF2_IF5B_II IF2_IF5B_II: This family represents th | 99.88 | |
| TIGR00487 | 587 | IF-2 translation initiation factor IF-2. This mode | 99.64 | |
| KOG1145|consensus | 683 | 99.54 | ||
| PRK05306 | 787 | infB translation initiation factor IF-2; Validated | 99.37 | |
| CHL00189 | 742 | infB translation initiation factor 2; Provisional | 99.35 | |
| PF03144 | 74 | GTP_EFTU_D2: Elongation factor Tu domain 2; InterP | 98.23 | |
| cd01342 | 83 | Translation_Factor_II_like Translation_Factor_II_l | 98.18 | |
| cd03691 | 86 | BipA_TypA_II BipA_TypA_II: domain II of BipA (also | 96.93 | |
| cd03697 | 87 | EFTU_II EFTU_II: Elongation factor Tu domain II. E | 96.61 | |
| PLN03127 | 447 | Elongation factor Tu; Provisional | 96.56 | |
| PRK12735 | 396 | elongation factor Tu; Reviewed | 96.56 | |
| TIGR01394 | 594 | TypA_BipA GTP-binding protein TypA/BipA. This bact | 96.48 | |
| cd03692 | 84 | mtIF2_IVc mtIF2_IVc: this family represents the C2 | 96.44 | |
| PRK00049 | 396 | elongation factor Tu; Reviewed | 96.32 | |
| cd03694 | 87 | GTPBP_II Domain II of the GP-1 family of GTPase. T | 96.29 | |
| PRK12736 | 394 | elongation factor Tu; Reviewed | 96.26 | |
| PTZ00141 | 446 | elongation factor 1- alpha; Provisional | 96.26 | |
| CHL00071 | 409 | tufA elongation factor Tu | 96.24 | |
| TIGR00475 | 581 | selB selenocysteine-specific elongation factor Sel | 96.22 | |
| cd03693 | 91 | EF1_alpha_II EF1_alpha_II: this family represents | 96.18 | |
| TIGR00490 | 720 | aEF-2 translation elongation factor aEF-2. This mo | 96.16 | |
| PRK10512 | 614 | selenocysteinyl-tRNA-specific translation factor; | 96.1 | |
| cd04088 | 83 | EFG_mtEFG_II EFG_mtEFG_II: this subfamily represen | 96.05 | |
| PRK12317 | 425 | elongation factor 1-alpha; Reviewed | 96.04 | |
| TIGR00483 | 426 | EF-1_alpha translation elongation factor EF-1 alph | 95.92 | |
| cd03696 | 83 | selB_II selB_II: this subfamily represents the dom | 95.88 | |
| cd03690 | 85 | Tet_II Tet_II: This subfamily represents domain II | 95.86 | |
| cd03698 | 83 | eRF3_II_like eRF3_II_like: domain similar to domai | 95.8 | |
| PRK05433 | 600 | GTP-binding protein LepA; Provisional | 95.72 | |
| PLN03126 | 478 | Elongation factor Tu; Provisional | 95.55 | |
| cd03695 | 81 | CysN_NodQ_II CysN_NodQ_II: This subfamily represen | 95.51 | |
| TIGR00485 | 394 | EF-Tu translation elongation factor TU. This align | 95.4 | |
| TIGR01393 | 595 | lepA GTP-binding protein LepA. LepA (GUF1 in Sacca | 95.31 | |
| PRK04004 | 586 | translation initiation factor IF-2; Validated | 95.29 | |
| PLN00043 | 447 | elongation factor 1-alpha; Provisional | 95.28 | |
| cd04092 | 83 | mtEFG2_II_like mtEFG2_C: C-terminus of mitochondri | 95.2 | |
| TIGR00491 | 590 | aIF-2 translation initiation factor aIF-2/yIF-2. T | 94.96 | |
| cd03689 | 85 | RF3_II RF3_II: this subfamily represents the domai | 94.81 | |
| COG0532 | 509 | InfB Translation initiation factor 2 (IF-2; GTPase | 94.76 | |
| cd04091 | 81 | mtEFG1_II_like mtEFG1_C: C-terminus of mitochondri | 94.6 | |
| cd03699 | 86 | lepA_II lepA_II: This subfamily represents the dom | 94.57 | |
| PRK13351 | 687 | elongation factor G; Reviewed | 94.56 | |
| PRK10218 | 607 | GTP-binding protein; Provisional | 94.21 | |
| cd04089 | 82 | eRF3_II eRF3_II: domain II of the eukaryotic class | 94.06 | |
| PRK12740 | 668 | elongation factor G; Reviewed | 94.0 | |
| PRK14845 | 1049 | translation initiation factor IF-2; Provisional | 93.97 | |
| PF14578 | 81 | GTP_EFTU_D4: Elongation factor Tu domain 4; PDB: 1 | 93.81 | |
| PRK07560 | 731 | elongation factor EF-2; Reviewed | 93.8 | |
| PTZ00327 | 460 | eukaryotic translation initiation factor 2 gamma s | 92.47 | |
| TIGR00487 | 587 | IF-2 translation initiation factor IF-2. This mode | 92.18 | |
| TIGR03680 | 406 | eif2g_arch translation initiation factor 2 subunit | 91.6 | |
| PRK04000 | 411 | translation initiation factor IF-2 subunit gamma; | 91.59 | |
| PRK05306 | 787 | infB translation initiation factor IF-2; Validated | 90.74 | |
| cd04090 | 94 | eEF2_II_snRNP Loc2 eEF2_C_snRNP, cd01514/C termina | 90.37 | |
| cd03688 | 113 | eIF2_gamma_II eIF2_gamma_II: this subfamily repres | 90.07 | |
| TIGR02034 | 406 | CysN sulfate adenylyltransferase, large subunit. H | 89.3 | |
| COG5258 | 527 | GTPBP1 GTPase [General function prediction only] | 88.52 | |
| cd03700 | 93 | eEF2_snRNP_like_II EF2_snRNP_like_II: this subfami | 88.16 | |
| CHL00189 | 742 | infB translation initiation factor 2; Provisional | 88.11 | |
| TIGR00484 | 689 | EF-G translation elongation factor EF-G. After pep | 87.34 | |
| PRK05124 | 474 | cysN sulfate adenylyltransferase subunit 1; Provis | 86.74 | |
| PRK12739 | 691 | elongation factor G; Reviewed | 85.5 | |
| PRK05506 | 632 | bifunctional sulfate adenylyltransferase subunit 1 | 85.29 | |
| COG3276 | 447 | SelB Selenocysteine-specific translation elongatio | 84.65 | |
| PRK00007 | 693 | elongation factor G; Reviewed | 83.89 | |
| COG5256 | 428 | TEF1 Translation elongation factor EF-1alpha (GTPa | 81.43 |
| >KOG1144|consensus | Back alignment and domain information |
|---|
Probab=100.00 E-value=1.1e-47 Score=355.70 Aligned_cols=142 Identities=53% Similarity=0.787 Sum_probs=139.7
Q ss_pred hhhHHHHHHHHHHhhcCccCcceEEEEEEeeeCCcceEEEEEEEccEEcCCCEEEEccCCCceeeeeeeccCCCcchhhc
Q psy9896 4 AMREIQYCQTFLKKRLMFKNELQATVLEVKAIPGLGTTIDTILVNGTLYEGDTVVLAGTDGPIVTQIRSLLMPQPMQELR 83 (145)
Q Consensus 4 ~~~l~gl~Q~~m~~~L~~~~~~~gtVLEvK~~kGlG~tidvIl~~G~L~~GD~Iv~~~~~Gpi~tkIRaLl~p~Pl~E~R 83 (145)
+.+|+.|||++|.+||+|.++++|||||||..+|+|+||||||+||+||.||+||+||++|||+|.||+||+|+||+|||
T Consensus 679 l~llv~ltQk~m~~kl~y~~ev~cTVlEVKvieG~GtTIDViLvNG~L~eGD~IvvcG~~GpIvTtIRaLLtP~PlkElR 758 (1064)
T KOG1144|consen 679 LLLLVQLTQKTMVEKLAYVDEVQCTVLEVKVIEGHGTTIDVILVNGELHEGDQIVVCGLQGPIVTTIRALLTPQPLKELR 758 (1064)
T ss_pred HHHHHHHHHHHHHHHHhhhhheeeEEEEEEeecCCCceEEEEEEcceeccCCEEEEcCCCCchhHHHHHhcCCcchHhhc
Confidence 56899999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred ccccceeeceeecCcCeEEecCCCCcccCCCeEEEecCcccHHHHHHHHHHHHHHHhhhccC
Q psy9896 84 VKNAYVEYKKIKGTQGVKIAAKDLEKTIAGLNLRVAKDQDEIDDLCDEVARELKSALSTIKL 145 (145)
Q Consensus 84 ~k~~~~~~~~v~aa~gVkI~a~~Le~~~AGs~l~vv~~~~e~e~~~~ev~~e~~~~~~~i~~ 145 (145)
+++.|.||++++||+||||.|.|||+++||++|+|+.++||++.+++++|++++++|++|++
T Consensus 759 Vk~~Y~hhkEvkaA~GiKI~A~~LEkaiaG~~l~VvgpeDd~e~lk~~~m~dl~~~l~~Id~ 820 (1064)
T KOG1144|consen 759 VKGTYVHHKEVKAAQGIKIAAKDLEKAIAGTRLLVVGPEDDIEELKEEAMEDLESVLSRIDK 820 (1064)
T ss_pred cccceeehhHhhhhccchhhhcchHHHhcCCeeEEeCCcccHHHHHHHHHHHHHHHHHHhhc
Confidence 99999999999999999999999999999999999999999999999999999999999975
|
|
| >cd03703 aeIF5B_II aeIF5B_II: This family represents the domain II of archeal and eukaryotic aeIF5B | Back alignment and domain information |
|---|
| >PRK14845 translation initiation factor IF-2; Provisional | Back alignment and domain information |
|---|
| >TIGR00491 aIF-2 translation initiation factor aIF-2/yIF-2 | Back alignment and domain information |
|---|
| >PRK04004 translation initiation factor IF-2; Validated | Back alignment and domain information |
|---|
| >cd03702 IF2_mtIF2_II This family represents the domain II of bacterial Initiation Factor 2 (IF2) and its eukaryotic mitochondrial homologue mtIF2 | Back alignment and domain information |
|---|
| >COG0532 InfB Translation initiation factor 2 (IF-2; GTPase) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >cd03701 IF2_IF5B_II IF2_IF5B_II: This family represents the domain II of prokaryotic Initiation Factor 2 (IF2) and its archeal and eukaryotic homologue aeIF5B | Back alignment and domain information |
|---|
| >TIGR00487 IF-2 translation initiation factor IF-2 | Back alignment and domain information |
|---|
| >KOG1145|consensus | Back alignment and domain information |
|---|
| >PRK05306 infB translation initiation factor IF-2; Validated | Back alignment and domain information |
|---|
| >CHL00189 infB translation initiation factor 2; Provisional | Back alignment and domain information |
|---|
| >PF03144 GTP_EFTU_D2: Elongation factor Tu domain 2; InterPro: IPR004161 Translation elongation factors are responsible for two main processes during protein synthesis on the ribosome [, , ] | Back alignment and domain information |
|---|
| >cd01342 Translation_Factor_II_like Translation_Factor_II_like: Elongation factor Tu (EF-Tu) domain II-like proteins | Back alignment and domain information |
|---|
| >cd03691 BipA_TypA_II BipA_TypA_II: domain II of BipA (also called TypA) having homology to domain II of the elongation factors (EFs) EF-G and EF-Tu | Back alignment and domain information |
|---|
| >cd03697 EFTU_II EFTU_II: Elongation factor Tu domain II | Back alignment and domain information |
|---|
| >PLN03127 Elongation factor Tu; Provisional | Back alignment and domain information |
|---|
| >PRK12735 elongation factor Tu; Reviewed | Back alignment and domain information |
|---|
| >TIGR01394 TypA_BipA GTP-binding protein TypA/BipA | Back alignment and domain information |
|---|
| >cd03692 mtIF2_IVc mtIF2_IVc: this family represents the C2 subdomain of domain IV of mitochondrial translation initiation factor 2 (mtIF2) which adopts a beta-barrel fold displaying a high degree of structural similarity with domain II of the translation elongation factor EF-Tu | Back alignment and domain information |
|---|
| >PRK00049 elongation factor Tu; Reviewed | Back alignment and domain information |
|---|
| >cd03694 GTPBP_II Domain II of the GP-1 family of GTPase | Back alignment and domain information |
|---|
| >PRK12736 elongation factor Tu; Reviewed | Back alignment and domain information |
|---|
| >PTZ00141 elongation factor 1- alpha; Provisional | Back alignment and domain information |
|---|
| >CHL00071 tufA elongation factor Tu | Back alignment and domain information |
|---|
| >TIGR00475 selB selenocysteine-specific elongation factor SelB | Back alignment and domain information |
|---|
| >cd03693 EF1_alpha_II EF1_alpha_II: this family represents the domain II of elongation factor 1-alpha (EF-1a) that is found in archaea and all eukaryotic lineages | Back alignment and domain information |
|---|
| >TIGR00490 aEF-2 translation elongation factor aEF-2 | Back alignment and domain information |
|---|
| >PRK10512 selenocysteinyl-tRNA-specific translation factor; Provisional | Back alignment and domain information |
|---|
| >cd04088 EFG_mtEFG_II EFG_mtEFG_II: this subfamily represents the domain II of elongation factor G (EF-G) in bacteria and, the C-terminus of mitochondrial Elongation factor G1 (mtEFG1) and G2 (mtEFG2)_like proteins found in eukaryotes | Back alignment and domain information |
|---|
| >PRK12317 elongation factor 1-alpha; Reviewed | Back alignment and domain information |
|---|
| >TIGR00483 EF-1_alpha translation elongation factor EF-1 alpha | Back alignment and domain information |
|---|
| >cd03696 selB_II selB_II: this subfamily represents the domain of elongation factor SelB, homologous to domain II of EF-Tu | Back alignment and domain information |
|---|
| >cd03690 Tet_II Tet_II: This subfamily represents domain II of ribosomal protection proteins Tet(M) and Tet(O) | Back alignment and domain information |
|---|
| >cd03698 eRF3_II_like eRF3_II_like: domain similar to domain II of the eukaryotic class II release factor (eRF3) | Back alignment and domain information |
|---|
| >PRK05433 GTP-binding protein LepA; Provisional | Back alignment and domain information |
|---|
| >PLN03126 Elongation factor Tu; Provisional | Back alignment and domain information |
|---|
| >cd03695 CysN_NodQ_II CysN_NodQ_II: This subfamily represents the domain II of the large subunit of ATP sulfurylase (ATPS): CysN or the N-terminal portion of NodQ, found mainly in proteobacteria and homologous to the domain II of EF-Tu | Back alignment and domain information |
|---|
| >TIGR00485 EF-Tu translation elongation factor TU | Back alignment and domain information |
|---|
| >TIGR01393 lepA GTP-binding protein LepA | Back alignment and domain information |
|---|
| >PRK04004 translation initiation factor IF-2; Validated | Back alignment and domain information |
|---|
| >PLN00043 elongation factor 1-alpha; Provisional | Back alignment and domain information |
|---|
| >cd04092 mtEFG2_II_like mtEFG2_C: C-terminus of mitochondrial Elongation factor G2 (mtEFG2)-like proteins found in eukaryotes | Back alignment and domain information |
|---|
| >TIGR00491 aIF-2 translation initiation factor aIF-2/yIF-2 | Back alignment and domain information |
|---|
| >cd03689 RF3_II RF3_II: this subfamily represents the domain II of bacterial Release Factor 3 (RF3) | Back alignment and domain information |
|---|
| >COG0532 InfB Translation initiation factor 2 (IF-2; GTPase) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >cd04091 mtEFG1_II_like mtEFG1_C: C-terminus of mitochondrial Elongation factor G1 (mtEFG1)-like proteins found in eukaryotes | Back alignment and domain information |
|---|
| >cd03699 lepA_II lepA_II: This subfamily represents the domain II of LepA, a GTP-binding protein localized in the cytoplasmic membrane | Back alignment and domain information |
|---|
| >PRK13351 elongation factor G; Reviewed | Back alignment and domain information |
|---|
| >PRK10218 GTP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd04089 eRF3_II eRF3_II: domain II of the eukaryotic class II release factor (eRF3) | Back alignment and domain information |
|---|
| >PRK12740 elongation factor G; Reviewed | Back alignment and domain information |
|---|
| >PRK14845 translation initiation factor IF-2; Provisional | Back alignment and domain information |
|---|
| >PF14578 GTP_EFTU_D4: Elongation factor Tu domain 4; PDB: 1G7R_A 1G7S_A 1G7T_A 1XE1_A | Back alignment and domain information |
|---|
| >PRK07560 elongation factor EF-2; Reviewed | Back alignment and domain information |
|---|
| >PTZ00327 eukaryotic translation initiation factor 2 gamma subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR00487 IF-2 translation initiation factor IF-2 | Back alignment and domain information |
|---|
| >TIGR03680 eif2g_arch translation initiation factor 2 subunit gamma | Back alignment and domain information |
|---|
| >PRK04000 translation initiation factor IF-2 subunit gamma; Validated | Back alignment and domain information |
|---|
| >PRK05306 infB translation initiation factor IF-2; Validated | Back alignment and domain information |
|---|
| >cd04090 eEF2_II_snRNP Loc2 eEF2_C_snRNP, cd01514/C terminal domain:eEF2_C_snRNP: This family includes C-terminal portion of the spliceosomal human 116kD U5 small nuclear ribonucleoprotein (snRNP) protein (U5-116 kD) and, its yeast counterpart Snu114p | Back alignment and domain information |
|---|
| >cd03688 eIF2_gamma_II eIF2_gamma_II: this subfamily represents the domain II of the gamma subunit of eukaryotic translation initiation factor 2 (eIF2-gamma) found in Eukaryota and Archaea | Back alignment and domain information |
|---|
| >TIGR02034 CysN sulfate adenylyltransferase, large subunit | Back alignment and domain information |
|---|
| >COG5258 GTPBP1 GTPase [General function prediction only] | Back alignment and domain information |
|---|
| >cd03700 eEF2_snRNP_like_II EF2_snRNP_like_II: this subfamily represents domain II of elongation factor (EF) EF-2 found eukaryotes and archaea and, the C-terminal portion of the spliceosomal human 116kD U5 small nuclear ribonucleoprotein (snRNP) protein (U5-116 kD) and, its yeast counterpart Snu114p | Back alignment and domain information |
|---|
| >CHL00189 infB translation initiation factor 2; Provisional | Back alignment and domain information |
|---|
| >TIGR00484 EF-G translation elongation factor EF-G | Back alignment and domain information |
|---|
| >PRK05124 cysN sulfate adenylyltransferase subunit 1; Provisional | Back alignment and domain information |
|---|
| >PRK12739 elongation factor G; Reviewed | Back alignment and domain information |
|---|
| >PRK05506 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Provisional | Back alignment and domain information |
|---|
| >COG3276 SelB Selenocysteine-specific translation elongation factor [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK00007 elongation factor G; Reviewed | Back alignment and domain information |
|---|
| >COG5256 TEF1 Translation elongation factor EF-1alpha (GTPase) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 145 | ||||
| 1g7s_A | 594 | X-Ray Structure Of Translation Initiation Factor If | 2e-13 | ||
| 1g7r_A | 594 | X-Ray Structure Of Translation Initiation Factor If | 2e-12 |
| >pdb|1G7S|A Chain A, X-Ray Structure Of Translation Initiation Factor If2EIF5B Complexed With Gdp Length = 594 | Back alignment and structure |
|
| >pdb|1G7R|A Chain A, X-Ray Structure Of Translation Initiation Factor If2EIF5B Length = 594 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 145 | |||
| 1g7s_A | 594 | Translation initiation factor IF2/EIF5B; translati | 3e-41 |
| >1g7s_A Translation initiation factor IF2/EIF5B; translational GTPase; HET: GDP; 2.00A {Methanothermobacterthermautotrophicus} SCOP: b.43.3.1 b.43.3.1 c.20.1.1 c.37.1.8 PDB: 1g7r_A* 1g7t_A* Length = 594 | Back alignment and structure |
|---|
Score = 143 bits (363), Expect = 3e-41
Identities = 41/141 (29%), Positives = 77/141 (54%), Gaps = 3/141 (2%)
Query: 8 IQYCQTFLKKRLMFKNELQA--TVLEVKAIPGLGTTIDTILVNGTLYEGDTVVLAGTDGP 65
+ Q +L+++L + + A T+LEVK GLG TID ++ +G L + DT+ + +
Sbjct: 213 MGLAQQYLREQLKIEEDSPARGTILEVKEETGLGMTIDAVIYDGILRKDDTIAMMTSKDV 272
Query: 66 IVTQIRSLLMPQPMQELR-VKNAYVEYKKIKGTQGVKIAAKDLEKTIAGLNLRVAKDQDE 124
I T+IRSLL P+P++E+R + + + ++ G+KI A ++ +AG LRV D ++
Sbjct: 273 ISTRIRSLLKPRPLEEMRESRKKFQKVDEVVAAAGIKIVAPGIDDVMAGSPLRVVTDPEK 332
Query: 125 IDDLCDEVARELKSALSTIKL 145
+ + ++K +
Sbjct: 333 VREEILSEIEDIKIDTDEAGV 353
|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 145 | |||
| 1g7s_A | 594 | Translation initiation factor IF2/EIF5B; translati | 99.84 | |
| 1zo1_I | 501 | IF2, translation initiation factor 2; E. coli, rib | 99.2 | |
| 3izy_P | 537 | Translation initiation factor IF-2, mitochondrial; | 98.98 | |
| 2c78_A | 405 | Elongation factor TU-A; hydrolase, GTPase, transla | 97.69 | |
| 1d2e_A | 397 | Elongation factor TU (EF-TU); G-protein, beta-barr | 97.65 | |
| 3avx_A | 1289 | Elongation factor TS, elongation factor TU, linke | 97.08 | |
| 2dy1_A | 665 | Elongation factor G; translocation, GTP complex, s | 97.03 | |
| 1jny_A | 435 | EF-1-alpha, elongation factor 1-alpha, EF-TU, TUF- | 96.98 | |
| 2elf_A | 370 | Protein translation elongation factor 1A; tRNA, py | 96.66 | |
| 1r5b_A | 467 | Eukaryotic peptide chain release factor GTP-bindi | 96.63 | |
| 1dar_A | 691 | EF-G, elongation factor G; ribosomal translocase, | 96.54 | |
| 1s0u_A | 408 | EIF-2-gamma, translation initiation factor 2 gamma | 96.43 | |
| 3sjy_A | 403 | Translation initiation factor 2 subunit gamma; zin | 96.2 | |
| 1kk1_A | 410 | EIF2gamma; initiation of translation; HET: GNP; 1. | 96.09 | |
| 3mca_A | 592 | HBS1, elongation factor 1 alpha-like protein; prot | 96.07 | |
| 2ywe_A | 600 | GTP-binding protein LEPA; G domain, beta-barrel, f | 95.93 | |
| 3p26_A | 483 | Elongation factor 1 alpha-like protein; GTP/GDP bi | 95.75 | |
| 1f60_A | 458 | Elongation factor EEF1A; protein-protein complex, | 95.68 | |
| 3izq_1 | 611 | HBS1P, elongation factor 1 alpha-like protein; NO- | 95.19 | |
| 3j2k_7 | 439 | ERF3, eukaryotic polypeptide chain release factor | 95.14 | |
| 2rdo_7 | 704 | EF-G, elongation factor G; elongation factor G, EF | 94.82 | |
| 1zun_B | 434 | Sulfate adenylate transferase, subunit 1/adenylyls | 94.58 | |
| 3cb4_D | 599 | GTP-binding protein LEPA; GTPase, OB-fold, membran | 94.43 | |
| 1wb1_A | 482 | Translation elongation factor SELB; selenocysteine | 94.42 | |
| 1g7s_A | 594 | Translation initiation factor IF2/EIF5B; translati | 94.25 | |
| 3e1y_E | 204 | Eukaryotic peptide chain release factor GTP-bindi | 93.88 | |
| 1zo1_I | 501 | IF2, translation initiation factor 2; E. coli, rib | 92.42 | |
| 4he6_A | 89 | Peptidase family U32; ultra-tight crystal packing, | 91.76 | |
| 1xe1_A | 116 | Hypothetical protein PF0907; structural genomics, | 90.65 | |
| 2xex_A | 693 | Elongation factor G; GTPase, translation, biosynth | 89.67 | |
| 2h5e_A | 529 | Peptide chain release factor RF-3; beta barrel, tr | 89.09 | |
| 3tr5_A | 528 | RF-3, peptide chain release factor 3; protein synt | 88.5 | |
| 1d1n_A | 99 | Initiation factor 2; beta-barrel, gene regulation; | 87.04 | |
| 3izy_P | 537 | Translation initiation factor IF-2, mitochondrial; | 81.2 |
| >1g7s_A Translation initiation factor IF2/EIF5B; translational GTPase; HET: GDP; 2.00A {Methanothermobacterthermautotrophicus} SCOP: b.43.3.1 b.43.3.1 c.20.1.1 c.37.1.8 PDB: 1g7r_A* 1g7t_A* | Back alignment and structure |
|---|
Probab=99.84 E-value=1.3e-20 Score=169.26 Aligned_cols=131 Identities=31% Similarity=0.584 Sum_probs=114.1
Q ss_pred hHHHHHHHHHHhhcCcc--CcceEEEEEEeeeCCcceEEEEEEEccEEcCCCEEEEccCCCceeeeeeeccCCCcchhhc
Q psy9896 6 REIQYCQTFLKKRLMFK--NELQATVLEVKAIPGLGTTIDTILVNGTLYEGDTVVLAGTDGPIVTQIRSLLMPQPMQELR 83 (145)
Q Consensus 6 ~l~gl~Q~~m~~~L~~~--~~~~gtVLEvK~~kGlG~tidvIl~~G~L~~GD~Iv~~~~~Gpi~tkIRaLl~p~Pl~E~R 83 (145)
.|..+++.++..++.++ ..+.|+|+|++.++|.|+++++.+++|+|++||+|++++.+|+..+|||+|++|+|++|||
T Consensus 211 ~I~~~~~~~~~~~l~~~~~~p~~~~V~~~~~d~g~G~v~~~rV~~G~Lk~Gd~v~~~~~~~~~~~rV~~i~~~~~~~elr 290 (594)
T 1g7s_A 211 MLMGLAQQYLREQLKIEEDSPARGTILEVKEETGLGMTIDAVIYDGILRKDDTIAMMTSKDVISTRIRSLLKPRPLEEMR 290 (594)
T ss_dssp HHHHHHHHHCSGGGEECTTSBCEEEEEEEEEETTEEEEEEEEEEESEEETTCEEEEEBSSSEEEEECCEEEEECCCC---
T ss_pred HHHhhccccchhhhccccCCCceeEEEEEEEeCCcEEEEEEEEeeCEEeeCCEEEECCCCCceeEEEeEEEeccccchhh
Confidence 45667788887677663 3489999999999999999999999999999999999999999999999999999999999
Q ss_pred -ccccceeeceeecCcCeEEecCCCCcccCCCeEEEecCcccHHHHHHHHHHHHHHH
Q psy9896 84 -VKNAYVEYKKIKGTQGVKIAAKDLEKTIAGLNLRVAKDQDEIDDLCDEVARELKSA 139 (145)
Q Consensus 84 -~k~~~~~~~~v~aa~gVkI~a~~Le~~~AGs~l~vv~~~~e~e~~~~ev~~e~~~~ 139 (145)
..++|.+++++.||+|+++++++|+++.+|++|.+++++ +++++++++|++++
T Consensus 291 ~~~~~~~~v~ea~~~aG~~v~~~~l~~~~~Gd~l~~~~~~---~~~~~~~~~~~~~~ 344 (594)
T 1g7s_A 291 ESRKKFQKVDEVVAAAGIKIVAPGIDDVMAGSPLRVVTDP---EKVREEILSEIEDI 344 (594)
T ss_dssp -CCCSEEECSEEESSEEEEEECSSCTTBCTTCEEEECSSH---HHHHHHHHHHHHTT
T ss_pred hccCCceEccEEcCCCCcEEEEcccCCCCCCCEEEecCCH---HHHHHHHHHHHHhc
Confidence 678999999999999999999999999999999999866 45677777777643
|
| >1zo1_I IF2, translation initiation factor 2; E. coli, ribosome, initiation of protein synthesis, cryo-eletron microscopy, translation/RNA complex; 13.80A {Escherichia coli} | Back alignment and structure |
|---|
| >3izy_P Translation initiation factor IF-2, mitochondrial; E coli, RNA, ribosomal; 10.80A {Bos taurus} | Back alignment and structure |
|---|
| >2c78_A Elongation factor TU-A; hydrolase, GTPase, translation elongation factor, protein synthesis, antibiotic, GTP-binding, nucleotide-binding; HET: GNP PUL; 1.4A {Thermus thermophilus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 2y0u_Z* 2y0w_Z* 2y0y_Z* 2y10_Z* 2y12_Z* 2y14_Z* 2y16_Z* 2y18_Z* 2wrn_Z* 2wrq_Z* 2c77_A* 1aip_A 1exm_A* 1ha3_A* 2xqd_Z* 3fic_Z* 4abr_Z* 1b23_P* 1ob5_A* 1ttt_A* ... | Back alignment and structure |
|---|
| >1d2e_A Elongation factor TU (EF-TU); G-protein, beta-barrel, RNA binding protein; HET: GDP; 1.94A {Bos taurus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1xb2_A* 2hcj_A* 2hdn_A* | Back alignment and structure |
|---|
| >3avx_A Elongation factor TS, elongation factor TU, linke replicase; RNA polymerase, translation, transferase-RNA complex; HET: GH3; 2.41A {Escherichia coli O157} PDB: 3agq_A 3agp_A* 3avu_A 3avv_A 3avt_A* 3avw_A* 3avy_A* 3mmp_A* 3mmp_G* 1efu_B | Back alignment and structure |
|---|
| >2dy1_A Elongation factor G; translocation, GTP complex, structural genomics, NPPSFA; HET: GTP; 1.60A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1wdt_A* | Back alignment and structure |
|---|
| >1jny_A EF-1-alpha, elongation factor 1-alpha, EF-TU, TUF-1; GTPase, alpha/beta structure, protein biosynthesis, translation; HET: GDP; 1.80A {Sulfolobus solfataricus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1skq_A* 3agj_A* | Back alignment and structure |
|---|
| >2elf_A Protein translation elongation factor 1A; tRNA, pyrrolysine, structural genomics, NPPSFA; HET: CIT; 1.70A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >1r5b_A Eukaryotic peptide chain release factor GTP-bindi subunit; translation termination, peptide release, GTPase, translatio; 2.35A {Schizosaccharomyces pombe} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1r5n_A* 1r5o_A* 3e20_A | Back alignment and structure |
|---|
| >1dar_A EF-G, elongation factor G; ribosomal translocase, translational GTPase; HET: GDP; 2.40A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 PDB: 1elo_A 1ktv_A 2om7_L* 2wri_Y* 2wrk_Y* 2xsy_Y* 2xuy_Y* 2j7k_A* 2efg_A* 1jqm_B 1efg_A* 1fnm_A* 1pn6_A 2bm1_A* 2bm0_A* 2bv3_A* 3izp_E 1zn0_B 1jqs_C 2bcw_C ... | Back alignment and structure |
|---|
| >1s0u_A EIF-2-gamma, translation initiation factor 2 gamma subunit; GTPase, EF-1A, tRNA; 2.40A {Methanocaldococcus jannaschii} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 | Back alignment and structure |
|---|
| >3sjy_A Translation initiation factor 2 subunit gamma; zinc finger, initiate translation, tRNA binding, mRNA bindin binding; HET: GCP GDP; 2.00A {Sulfolobus solfataricus P2} PDB: 3pen_A* 3sjz_A* 2qn6_A* 2aho_A 2qmu_A* 2plf_A* 3v11_A* 3i1f_A* 3cw2_A 2pmd_A* 3p3m_A* 3qsy_A* | Back alignment and structure |
|---|
| >1kk1_A EIF2gamma; initiation of translation; HET: GNP; 1.80A {Pyrococcus abyssi} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1kjz_A* 1kk2_A* 1kk3_A* 1kk0_A* 2d74_A 2dcu_A* | Back alignment and structure |
|---|
| >3mca_A HBS1, elongation factor 1 alpha-like protein; protein protein complex, translation regulation; 2.74A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >2ywe_A GTP-binding protein LEPA; G domain, beta-barrel, ferredoxin-like domain, structural GE NPPSFA; 2.05A {Aquifex aeolicus} PDB: 2ywf_A* 2ywg_A* 2ywh_A* | Back alignment and structure |
|---|
| >3p26_A Elongation factor 1 alpha-like protein; GTP/GDP binding domain, beta-barrel, translational GTPase, D structural genomics; 2.50A {Saccharomyces cerevisiae} PDB: 3p27_A* | Back alignment and structure |
|---|
| >1f60_A Elongation factor EEF1A; protein-protein complex, translation; 1.67A {Saccharomyces cerevisiae} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1g7c_A* 1ije_A* 1ijf_A* 2b7b_A* 2b7c_A | Back alignment and structure |
|---|
| >3izq_1 HBS1P, elongation factor 1 alpha-like protein; NO-GO mRNA decay, ribosomal protein,hydrolase; 9.50A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3j2k_7 ERF3, eukaryotic polypeptide chain release factor 3; rabbit 80S ribosome, ribosome-translation complex; 17.00A {Oryctolagus cuniculus} | Back alignment and structure |
|---|
| >2rdo_7 EF-G, elongation factor G; elongation factor G, EF-G, RRF, GDPNP, 50S subunit, cryo-EM, REAL-space refinement, ribonucleoprotein; 9.10A {Escherichia coli} PDB: 3j0e_H | Back alignment and structure |
|---|
| >1zun_B Sulfate adenylate transferase, subunit 1/adenylylsulfate kinase; beta barrel, switch domain, heterodimer, pyrophosphate, G protein; HET: GDP AGS; 2.70A {Pseudomonas syringae PV} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 | Back alignment and structure |
|---|
| >3cb4_D GTP-binding protein LEPA; GTPase, OB-fold, membrane, nucleotide-binding, translation; 2.80A {Escherichia coli} PDB: 3deg_C* | Back alignment and structure |
|---|
| >1wb1_A Translation elongation factor SELB; selenocysteine, protein synthesis, selenium, ribosome; HET: GDP DXC; 3.0A {Methanococcus maripaludis} SCOP: b.43.3.1 b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1wb2_A* 1wb3_A* | Back alignment and structure |
|---|
| >1g7s_A Translation initiation factor IF2/EIF5B; translational GTPase; HET: GDP; 2.00A {Methanothermobacterthermautotrophicus} SCOP: b.43.3.1 b.43.3.1 c.20.1.1 c.37.1.8 PDB: 1g7r_A* 1g7t_A* | Back alignment and structure |
|---|
| >3e1y_E Eukaryotic peptide chain release factor GTP-bindi ERF3A; translation termination, peptide release, PTC, P biosynthesis, GTP-binding; HET: ATP; 3.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1zo1_I IF2, translation initiation factor 2; E. coli, ribosome, initiation of protein synthesis, cryo-eletron microscopy, translation/RNA complex; 13.80A {Escherichia coli} | Back alignment and structure |
|---|
| >4he6_A Peptidase family U32; ultra-tight crystal packing, unknown function; 1.10A {Geobacillus thermoleovorans} PDB: 4he5_A | Back alignment and structure |
|---|
| >1xe1_A Hypothetical protein PF0907; structural genomics, unknown function, protein structure INI secsg, conserved hypothetical protein; HET: MSE; 2.00A {Pyrococcus furiosus} SCOP: b.43.3.1 | Back alignment and structure |
|---|
| >2xex_A Elongation factor G; GTPase, translation, biosynthetic protein; 1.90A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >2h5e_A Peptide chain release factor RF-3; beta barrel, translation; HET: GDP; 2.80A {Escherichia coli} PDB: 2o0f_A 3sfs_W* 3zvo_Y* 3uoq_W* | Back alignment and structure |
|---|
| >3tr5_A RF-3, peptide chain release factor 3; protein synthesis, translation; HET: GDP; 2.11A {Coxiella burnetii} | Back alignment and structure |
|---|
| >1d1n_A Initiation factor 2; beta-barrel, gene regulation; NMR {Geobacillus stearothermophilus} SCOP: b.43.3.1 | Back alignment and structure |
|---|
| >3izy_P Translation initiation factor IF-2, mitochondrial; E coli, RNA, ribosomal; 10.80A {Bos taurus} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 145 | ||||
| d1g7sa1 | 101 | b.43.3.1 (A:228-328) Initiation factor IF2/eIF5b, | 6e-29 |
| >d1g7sa1 b.43.3.1 (A:228-328) Initiation factor IF2/eIF5b, domains 2 and 4 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Length = 101 | Back information, alignment and structure |
|---|
class: All beta proteins fold: Reductase/isomerase/elongation factor common domain superfamily: Translation proteins family: Elongation factors domain: Initiation factor IF2/eIF5b, domains 2 and 4 species: Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]
Score = 99.8 bits (249), Expect = 6e-29
Identities = 35/94 (37%), Positives = 58/94 (61%), Gaps = 1/94 (1%)
Query: 26 QATVLEVKAIPGLGTTIDTILVNGTLYEGDTVVLAGTDGPIVTQIRSLLMPQPMQELR-V 84
+ T+LEVK GLG TID ++ +G L + DT+ + + I T+IRSLL P+P++E+R
Sbjct: 6 RGTILEVKEETGLGMTIDAVIYDGILRKDDTIAMMTSKDVISTRIRSLLKPRPLEEMRES 65
Query: 85 KNAYVEYKKIKGTQGVKIAAKDLEKTIAGLNLRV 118
+ + + ++ G+KI A ++ +AG LRV
Sbjct: 66 RKKFQKVDEVVAAAGIKIVAPGIDDVMAGSPLRV 99
|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 145 | |||
| d1g7sa1 | 101 | Initiation factor IF2/eIF5b, domains 2 and 4 {Arch | 100.0 | |
| d2bv3a1 | 121 | Elongation factor G (EF-G), domain II {Thermus the | 96.77 | |
| d1f60a1 | 94 | Elongation factor eEF-1alpha, domain 2 {Baker's ye | 96.71 | |
| d1xe1a_ | 91 | Hypothetical protein PF0907 {Pyrococcus furiosus [ | 96.67 | |
| d1efca1 | 92 | Elongation factor Tu (EF-Tu), domain 2 {Escherichi | 96.57 | |
| d1d2ea1 | 98 | Elongation factor Tu (EF-Tu), domain 2 {Cow (Bos t | 96.56 | |
| d2dy1a1 | 103 | Elongation factor G (EF-G), domain II {Thermus the | 96.35 | |
| d1jnya1 | 95 | Elongation factor eEF-1alpha, domain 2 {Archaeon S | 96.28 | |
| d2c78a1 | 100 | Elongation factor Tu (EF-Tu), domain 2 {Thermus th | 96.15 | |
| d1g7sa2 | 128 | Initiation factor IF2/eIF5b, domains 2 and 4 {Arch | 95.87 | |
| d1r5ba1 | 95 | Eukaryotic peptide chain release factor ERF2, post | 95.47 | |
| d1wb1a1 | 92 | Elongation factor SelB, domains 2 and 4 {Methanoco | 94.67 | |
| d1zunb1 | 92 | Sulfate adenylate transferase subunit cysN/C, EF-T | 94.26 | |
| d1n0ua1 | 138 | Elongation factor 2 (eEF-2), domain II {Baker's ye | 94.21 | |
| d1kk1a1 | 121 | Initiation factor eIF2 gamma subunit, domain II {A | 93.81 | |
| d1s0ua1 | 118 | Initiation factor eIF2 gamma subunit, domain II {A | 92.53 | |
| d2qn6a1 | 114 | Initiation factor eIF2 gamma subunit, domain II {S | 92.15 | |
| d1d1na_ | 99 | Initiation factor IF2/eIF5b, domains 2 and 4 {Baci | 88.1 |
| >d1g7sa1 b.43.3.1 (A:228-328) Initiation factor IF2/eIF5b, domains 2 and 4 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
class: All beta proteins fold: Reductase/isomerase/elongation factor common domain superfamily: Translation proteins family: Elongation factors domain: Initiation factor IF2/eIF5b, domains 2 and 4 species: Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]
Probab=100.00 E-value=4.5e-39 Score=234.24 Aligned_cols=97 Identities=36% Similarity=0.641 Sum_probs=91.7
Q ss_pred cceEEEEEEeeeCCcceEEEEEEEccEEcCCCEEEEccCCCceeeeeeeccCCCcchhhc-ccccceeeceeecCcCeEE
Q psy9896 24 ELQATVLEVKAIPGLGTTIDTILVNGTLYEGDTVVLAGTDGPIVTQIRSLLMPQPMQELR-VKNAYVEYKKIKGTQGVKI 102 (145)
Q Consensus 24 ~~~gtVLEvK~~kGlG~tidvIl~~G~L~~GD~Iv~~~~~Gpi~tkIRaLl~p~Pl~E~R-~k~~~~~~~~v~aa~gVkI 102 (145)
.++|+|||+|.++|+|+++|+|+||||||+||+|++|+.+|||.|+||+||+|+||+||| .+++|++++++.||+||||
T Consensus 4 ~a~G~VlEs~~dkg~G~~atviv~~GtLk~GD~iv~g~~~G~i~~~iraLl~p~pl~emr~~~~~~~~vke~~aa~gVkI 83 (101)
T d1g7sa1 4 PARGTILEVKEETGLGMTIDAVIYDGILRKDDTIAMMTSKDVISTRIRSLLKPRPLEEMRESRKKFQKVDEVVAAAGIKI 83 (101)
T ss_dssp BCEEEEEEEEEETTEEEEEEEEEEESEEETTCEEEEEBSSSEEEEECCEEEEECCCC----CCCSEEECSEEESSEEEEE
T ss_pred CcEEEEEEEEEcCCCCeeEEEEEEcCEEccCCEEEEecCcCCEEEEeecccCCcchhhhhccccCCeECcEEeCCCceEE
Confidence 489999999999999999999999999999999999999999999999999999999999 7889999999999999999
Q ss_pred ecCCCCcccCCCeEEEec
Q psy9896 103 AAKDLEKTIAGLNLRVAK 120 (145)
Q Consensus 103 ~a~~Le~~~AGs~l~vv~ 120 (145)
+|+|||+++||++|+|++
T Consensus 84 ~a~gLe~v~aG~~~~VV~ 101 (101)
T d1g7sa1 84 VAPGIDDVMAGSPLRVVT 101 (101)
T ss_dssp ECSSCTTBCTTCEEEECS
T ss_pred EcCCCCcCCCCCEEEEeC
Confidence 999999999999999984
|
| >d2bv3a1 b.43.3.1 (A:283-403) Elongation factor G (EF-G), domain II {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1f60a1 b.43.3.1 (A:241-334) Elongation factor eEF-1alpha, domain 2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1xe1a_ b.43.3.1 (A:) Hypothetical protein PF0907 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1efca1 b.43.3.1 (A:205-296) Elongation factor Tu (EF-Tu), domain 2 {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1d2ea1 b.43.3.1 (A:251-348) Elongation factor Tu (EF-Tu), domain 2 {Cow (Bos taurus), mitochondrial [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d2dy1a1 b.43.3.1 (A:275-377) Elongation factor G (EF-G), domain II {Thermus thermophilus, EF-G-2 [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1jnya1 b.43.3.1 (A:228-322) Elongation factor eEF-1alpha, domain 2 {Archaeon Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d2c78a1 b.43.3.1 (A:213-312) Elongation factor Tu (EF-Tu), domain 2 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1g7sa2 b.43.3.1 (A:460-587) Initiation factor IF2/eIF5b, domains 2 and 4 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1r5ba1 b.43.3.1 (A:460-554) Eukaryotic peptide chain release factor ERF2, post-G domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1wb1a1 b.43.3.1 (A:180-271) Elongation factor SelB, domains 2 and 4 {Methanococcus maripaludis [TaxId: 39152]} | Back information, alignment and structure |
|---|
| >d1zunb1 b.43.3.1 (B:238-329) Sulfate adenylate transferase subunit cysN/C, EF-Tu domain 2-like domain {Pseudomonas syringae pv. tomato [TaxId: 323]} | Back information, alignment and structure |
|---|
| >d1n0ua1 b.43.3.1 (A:344-481) Elongation factor 2 (eEF-2), domain II {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1kk1a1 b.43.3.1 (A:201-321) Initiation factor eIF2 gamma subunit, domain II {Archaeon Pyrococcus abyssi [TaxId: 29292]} | Back information, alignment and structure |
|---|
| >d1s0ua1 b.43.3.1 (A:230-347) Initiation factor eIF2 gamma subunit, domain II {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d2qn6a1 b.43.3.1 (A:207-320) Initiation factor eIF2 gamma subunit, domain II {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1d1na_ b.43.3.1 (A:) Initiation factor IF2/eIF5b, domains 2 and 4 {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|