Diaphorina citri psyllid: psy9900


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-
MTKFEIHTVRGIVKFYDSKRGFGFITRLDNKEDIFVHKSSIVKMNPKKFFQSLGLGEIVDFNIGVGKKDIEAINVTGPNGIPVQGAPKSSSETVSGTYRNDSFFPAVHTVRGIVKFYDSKRGFGFITRLDNKEDIFVHKSSIVKMNPKKFFQSLGLGEIVDFNIGVGKKDIEAINVTGPNGIPVQGAPKVP
cccccEEEEEEEEEEEEccccEEEEEcccccccEEEEcEEEEcccccccccccccccEEEEEEEEccccccEEEEccccccccccccccccccccccccccccccccccccEEEEEEEccccEEEEEcccccccEEEEcEEEEEccccccccccccccEEEEEEECccccccEEEECcccccccccccccc
*********RGIVKFYDSKRGFGFITRLDNKEDIFVHKSSIVKMNPKKFFQSLGLGEIVDFNIGVGKKDIEAINVTGPNGIPV************GTYRNDSFFPAVHTVRGIVKFYDSKRGFGFITRLDNKEDIFVHKSSIVKMNPKKFFQSLGLGEIVDFNIGVGKKDIEAINVTGPNGIPVQ******
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTKFEIHTVRGIVKFYDSKRGFGFITRLDNKEDIFVHKSSIVKMNPKKFFQSLGLGEIVDFNIGVGKKDIEAINVTGPNGIPVQGAPKSSSETVSGTYRNDSFFPAVHTVRGIVKFYDSKRGFGFITRLDNKEDIFVHKSSIVKMNPKKFFQSLGLGEIVDFNIGVGKKDIEAINVTGPNGIPVQGAPKVP

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Nuclease-sensitive element-binding protein 1 The secreted form acts as an extracellular mitogen and stimulates cell migration and proliferation.confidentP67809
Nuclease-sensitive element-binding protein 1 The secreted form acts as an extracellular mitogen and stimulates cell migration and proliferation.confidentP67808
Nuclease-sensitive element-binding protein 1 Mediates pre-mRNA alternative splicing regulation. Binds to splice sites in pre-mRNA and regulates splice site selection. Binds and stabilizes cytoplasmic mRNA. Binds to promoters that contain a Y-box (5'-CTGATTGGCCAA-3'). Regulates the transcription of numerous genes (By similarity). Component of the coding region determinant (CRD)-mediated complex that promotes mRNA stability.confidentQ06066

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0051154 [BP]negative regulation of striated muscle cell differentiationprobableGO:0051093, GO:0051153, GO:0050793, GO:0050794, GO:0008150, GO:0045596, GO:0045595, GO:0065007, GO:0051147, GO:0048519, GO:0051148, GO:0050789, GO:0048523
GO:0070937 [CC]CRD-mediated mRNA stability complexprobableGO:0043234, GO:0005737, GO:0032991, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0048471 [CC]perinuclear region of cytoplasmprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0043021 [MF]ribonucleoprotein complex bindingprobableGO:0003674, GO:0005488
GO:0043565 [MF]sequence-specific DNA bindingprobableGO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:0003677, GO:1901363
GO:0071011 [CC]precatalytic spliceosomeprobableGO:0005575, GO:0032991, GO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0030529, GO:0044446, GO:0043229, GO:0044428, GO:0044422, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0005681
GO:0071013 [CC]catalytic step 2 spliceosomeprobableGO:0005575, GO:0032991, GO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0030529, GO:0044446, GO:0043229, GO:0044428, GO:0044422, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0005681
GO:0043066 [BP]negative regulation of apoptotic processprobableGO:0043069, GO:0050794, GO:0008150, GO:0043067, GO:0065007, GO:0060548, GO:0048519, GO:0010941, GO:0042981, GO:0050789, GO:0048523
GO:0005689 [CC]U12-type spliceosomal complexprobableGO:0005575, GO:0032991, GO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0030529, GO:0044446, GO:0043229, GO:0044428, GO:0044422, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0005681
GO:0071204 [CC]histone pre-mRNA 3'end processing complexprobableGO:0005575, GO:0032991, GO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0030529, GO:0044446, GO:0043229, GO:0044428, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0044422
GO:0010494 [CC]cytoplasmic stress granuleprobableGO:0005737, GO:0035770, GO:0043232, GO:0044464, GO:0043229, GO:0005623, GO:0030529, GO:0005575, GO:0044444, GO:0043228, GO:0044424, GO:0032991, GO:0005622, GO:0043226
GO:0009409 [BP]response to coldprobableGO:0009628, GO:0006950, GO:0008150, GO:0050896, GO:0009266
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0060567 [BP]negative regulation of DNA-dependent transcription, terminationprobableGO:0009892, GO:0080090, GO:0009890, GO:0031327, GO:0031326, GO:0031324, GO:0031323, GO:0051129, GO:0051128, GO:0010629, GO:0043244, GO:0031554, GO:0050789, GO:0044699, GO:0043242, GO:0010605, GO:0019222, GO:2000112, GO:2000113, GO:0008150, GO:0019219, GO:0065007, GO:0048519, GO:0010468, GO:0045934, GO:0060255, GO:0009987, GO:0009889, GO:0050794, GO:0044763, GO:0051171, GO:0051172, GO:2001141, GO:0051253, GO:0051252, GO:0006355, GO:0010556, GO:0045892, GO:0010558, GO:0048523
GO:0003697 [MF]single-stranded DNA bindingprobableGO:0043566, GO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:0003677, GO:1901363
GO:0030425 [CC]dendriteprobableGO:0044464, GO:0005623, GO:0005575, GO:0097458, GO:0043005, GO:0042995
GO:0001072 [MF]RNA binding transcription antitermination factor activityprobableGO:0003674, GO:0001070, GO:0001071
GO:0010608 [BP]posttranscriptional regulation of gene expressionprobableGO:0019222, GO:0060255, GO:0050789, GO:0008150, GO:0065007, GO:0010468
GO:0031564 [BP]transcription antiterminationprobableGO:0080090, GO:0019222, GO:0031326, GO:0031323, GO:0051128, GO:0043244, GO:0031554, GO:0050789, GO:2000112, GO:0031555, GO:0060255, GO:0065007, GO:0010468, GO:0019219, GO:0009889, GO:0050794, GO:0008150, GO:0051171, GO:2001141, GO:0051252, GO:0006355, GO:0010556
GO:0045893 [BP]positive regulation of transcription, DNA-dependentprobableGO:0009893, GO:0019222, GO:0031328, GO:0031326, GO:0031325, GO:2001141, GO:0031323, GO:0010628, GO:0050789, GO:0080090, GO:0010604, GO:0009891, GO:2000112, GO:0019219, GO:0065007, GO:0048518, GO:0010468, GO:0045935, GO:0060255, GO:0009889, GO:0050794, GO:0008150, GO:0051171, GO:0051173, GO:0051252, GO:0051254, GO:0006355, GO:0010557, GO:0010556, GO:0048522
GO:0003729 [MF]mRNA bindingprobableGO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:1901363, GO:0003723

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1H95, chain A
Confidence level:very confident
Coverage over the Query: 1-78
View the alignment between query and template
View the model in PyMOL
Template: 1H95, chain A
Confidence level:very confident
Coverage over the Query: 105-180
View the alignment between query and template
View the model in PyMOL
Template: 2WP8, chain J
Confidence level:probable
Coverage over the Query: 8-144,155-180
View the alignment between query and template
View the model in PyMOL