Psyllid ID: psy9900
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 191 | ||||||
| 156385226 | 98 | predicted protein [Nematostella vectensi | 0.465 | 0.908 | 0.550 | 4e-20 | |
| 91081961 | 297 | PREDICTED: similar to Y-box binding prot | 0.413 | 0.265 | 0.594 | 3e-19 | |
| 91081963 | 286 | PREDICTED: similar to Y-box binding prot | 0.413 | 0.276 | 0.594 | 5e-19 | |
| 391342360 | 309 | PREDICTED: uncharacterized protein LOC10 | 0.434 | 0.268 | 0.554 | 7e-19 | |
| 22901742 | 317 | Y-box protein Ct-p50 [Chironomus tentans | 0.413 | 0.249 | 0.569 | 1e-18 | |
| 22901740 | 264 | Y-box protein Ct-p40 [Chironomus tentans | 0.413 | 0.299 | 0.569 | 1e-18 | |
| 30089118 | 280 | Y1 protein [Dugesia etrusca] | 0.502 | 0.342 | 0.494 | 2e-18 | |
| 342837647 | 378 | TPA_inf: Y box protein 4-like protein [S | 0.502 | 0.253 | 0.494 | 2e-18 | |
| 242008099 | 288 | Nuclease sensitive element-binding prote | 0.429 | 0.284 | 0.560 | 2e-18 | |
| 383849814 | 278 | PREDICTED: uncharacterized protein LOC10 | 0.554 | 0.381 | 0.433 | 3e-18 |
| >gi|156385226|ref|XP_001633532.1| predicted protein [Nematostella vectensis] gi|156220603|gb|EDO41469.1| predicted protein [Nematostella vectensis] | Back alignment and taxonomy information |
|---|
Score = 103 bits (256), Expect = 4e-20, Method: Compositional matrix adjust.
Identities = 49/89 (55%), Positives = 65/89 (73%)
Query: 103 FFPAVHTVRGIVKFYDSKRGFGFITRLDNKEDIFVHKSSIVKMNPKKFFQSLGLGEIVDF 162
F A V G VK+++ K G+GFI R DNKEDIFVH+++I K NPKK+ +S+G GE+V+F
Sbjct: 1 MFIAATKVTGTVKWFNVKNGYGFINRDDNKEDIFVHQTAIAKNNPKKYLRSVGDGEVVEF 60
Query: 163 NIGVGKKDIEAINVTGPNGIPVQGAPKVP 191
N+ G K +EA NVTGP+G PVQG+ P
Sbjct: 61 NVVSGTKGLEASNVTGPDGEPVQGSKYAP 89
|
Source: Nematostella vectensis Species: Nematostella vectensis Genus: Nematostella Family: Edwardsiidae Order: Actiniaria Class: Anthozoa Phylum: Cnidaria Superkingdom: Eukaryota |
| >gi|91081961|ref|XP_966594.1| PREDICTED: similar to Y-box binding protein isoform 1 [Tribolium castaneum] gi|270007364|gb|EFA03812.1| hypothetical protein TcasGA2_TC013925 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|91081963|ref|XP_975913.1| PREDICTED: similar to Y-box binding protein isoform 2 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|391342360|ref|XP_003745488.1| PREDICTED: uncharacterized protein LOC100904956 [Metaseiulus occidentalis] | Back alignment and taxonomy information |
|---|
| >gi|22901742|gb|AAN10050.1| Y-box protein Ct-p50 [Chironomus tentans] | Back alignment and taxonomy information |
|---|
| >gi|22901740|gb|AAN10049.1| Y-box protein Ct-p40 [Chironomus tentans] | Back alignment and taxonomy information |
|---|
| >gi|30089118|emb|CAD27800.1| Y1 protein [Dugesia etrusca] | Back alignment and taxonomy information |
|---|
| >gi|342837647|tpg|DAA34914.1| TPA_inf: Y box protein 4-like protein [Schmidtea mediterranea] | Back alignment and taxonomy information |
|---|
| >gi|242008099|ref|XP_002424850.1| Nuclease sensitive element-binding protein, putative [Pediculus humanus corporis] gi|212508400|gb|EEB12112.1| Nuclease sensitive element-binding protein, putative [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
| >gi|383849814|ref|XP_003700531.1| PREDICTED: uncharacterized protein LOC100878915 [Megachile rotundata] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 191 | ||||||
| UNIPROTKB|F1PB10 | 370 | CSDA "Uncharacterized protein" | 0.429 | 0.221 | 0.506 | 5.8e-22 | |
| UNIPROTKB|A5D7M4 | 360 | YBX2 "Uncharacterized protein" | 0.670 | 0.355 | 0.4 | 2.1e-20 | |
| UNIPROTKB|I3LCJ2 | 360 | YBX2 "Uncharacterized protein" | 0.670 | 0.355 | 0.4 | 6.5e-20 | |
| UNIPROTKB|P21574 | 336 | ybx2-a "Y-box-binding protein | 0.591 | 0.336 | 0.413 | 7.2e-20 | |
| UNIPROTKB|F1SFU0 | 365 | LOC100736899 "Uncharacterized | 0.670 | 0.350 | 0.4 | 7.3e-20 | |
| UNIPROTKB|E2RMN5 | 367 | YBX2 "Uncharacterized protein" | 0.670 | 0.348 | 0.4 | 7.7e-20 | |
| UNIPROTKB|Q9Y2T7 | 364 | YBX2 "Y-box-binding protein 2" | 0.602 | 0.315 | 0.416 | 9.5e-20 | |
| UNIPROTKB|P45441 | 324 | ybx2-b "Y-box-binding protein | 0.429 | 0.253 | 0.512 | 1.2e-19 | |
| UNIPROTKB|F1M1Q9 | 277 | F1M1Q9 "Uncharacterized protei | 0.465 | 0.321 | 0.472 | 1.5e-19 | |
| UNIPROTKB|D4A0L4 | 306 | Csda "DNA-binding protein A" [ | 0.591 | 0.369 | 0.418 | 1.5e-19 |
| UNIPROTKB|F1PB10 CSDA "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
Score = 228 (85.3 bits), Expect = 5.8e-22, Sum P(2) = 5.8e-22
Identities = 42/83 (50%), Positives = 63/83 (75%)
Query: 105 PAVHTVRGIVKFYDSKRGFGFITRLDNKEDIFVHKSSIVKMNPKKFFQSLGLGEIVDFNI 164
PA V G VK+++ + G+GFI R D KED+FVH+++I K NP+K+ +S+G GE V+F++
Sbjct: 87 PATK-VLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDV 145
Query: 165 GVGKKDIEAINVTGPNGIPVQGA 187
G+K EA NVTGP+G+PV+G+
Sbjct: 146 VEGEKGAEAANVTGPDGVPVEGS 168
|
|
| UNIPROTKB|A5D7M4 YBX2 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|I3LCJ2 YBX2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P21574 ybx2-a "Y-box-binding protein 2-A" [Xenopus laevis (taxid:8355)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1SFU0 LOC100736899 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2RMN5 YBX2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9Y2T7 YBX2 "Y-box-binding protein 2" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P45441 ybx2-b "Y-box-binding protein 2-B" [Xenopus laevis (taxid:8355)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1M1Q9 F1M1Q9 "Uncharacterized protein" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|D4A0L4 Csda "DNA-binding protein A" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 191 | |||
| pfam00313 | 66 | pfam00313, CSD, 'Cold-shock' DNA-binding domain | 8e-15 | |
| pfam00313 | 66 | pfam00313, CSD, 'Cold-shock' DNA-binding domain | 8e-15 | |
| cd04458 | 65 | cd04458, CSP_CDS, Cold-Shock Protein (CSP) contain | 9e-15 | |
| cd04458 | 65 | cd04458, CSP_CDS, Cold-Shock Protein (CSP) contain | 9e-15 | |
| COG1278 | 67 | COG1278, CspC, Cold shock proteins [Transcription] | 3e-10 | |
| COG1278 | 67 | COG1278, CspC, Cold shock proteins [Transcription] | 3e-10 | |
| PRK10943 | 69 | PRK10943, PRK10943, cold shock-like protein CspC; | 5e-08 | |
| PRK10943 | 69 | PRK10943, PRK10943, cold shock-like protein CspC; | 5e-08 | |
| PRK09507 | 69 | PRK09507, cspE, cold shock protein CspE; Reviewed | 9e-08 | |
| PRK09507 | 69 | PRK09507, cspE, cold shock protein CspE; Reviewed | 9e-08 | |
| PRK10354 | 70 | PRK10354, PRK10354, RNA chaperone/anti-terminator; | 1e-07 | |
| PRK10354 | 70 | PRK10354, PRK10354, RNA chaperone/anti-terminator; | 1e-07 | |
| smart00357 | 64 | smart00357, CSP, Cold shock protein domain | 2e-07 | |
| smart00357 | 64 | smart00357, CSP, Cold shock protein domain | 2e-07 | |
| PRK09890 | 70 | PRK09890, PRK09890, cold shock protein CspG; Provi | 5e-06 | |
| PRK09890 | 70 | PRK09890, PRK09890, cold shock protein CspG; Provi | 5e-06 | |
| TIGR02381 | 68 | TIGR02381, cspD, cold shock domain protein CspD | 1e-05 | |
| TIGR02381 | 68 | TIGR02381, cspD, cold shock domain protein CspD | 1e-05 | |
| PRK14998 | 73 | PRK14998, PRK14998, cold shock-like protein CspD; | 1e-04 | |
| PRK14998 | 73 | PRK14998, PRK14998, cold shock-like protein CspD; | 1e-04 | |
| PRK09937 | 74 | PRK09937, PRK09937, stationary phase/starvation in | 3e-04 | |
| PRK09937 | 74 | PRK09937, PRK09937, stationary phase/starvation in | 3e-04 | |
| PRK15463 | 70 | PRK15463, PRK15463, cold shock-like protein CspF; | 0.001 | |
| PRK15463 | 70 | PRK15463, PRK15463, cold shock-like protein CspF; | 0.001 |
| >gnl|CDD|201147 pfam00313, CSD, 'Cold-shock' DNA-binding domain | Back alignment and domain information |
|---|
Score = 65.7 bits (161), Expect = 8e-15
Identities = 30/70 (42%), Positives = 44/70 (62%), Gaps = 4/70 (5%)
Query: 9 VRGIVKFYDSKRGFGFITRLDNKEDIFVHKSSIVKMNPKKFFQSLGLGEIVDFNIGVGKK 68
+ G VK++++K+GFGFIT D +D+FVH S+I F+SL G+ V+F+I G K
Sbjct: 1 MTGTVKWFNAKKGFGFITPEDGDKDVFVHFSAIQGDG----FRSLQEGQRVEFDIVEGTK 56
Query: 69 DIEAINVTGP 78
+A NVT
Sbjct: 57 GPQAANVTLL 66
|
Length = 66 |
| >gnl|CDD|201147 pfam00313, CSD, 'Cold-shock' DNA-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|239905 cd04458, CSP_CDS, Cold-Shock Protein (CSP) contains an S1-like cold-shock domain (CSD) that is found in eukaryotes, prokaryotes, and archaea | Back alignment and domain information |
|---|
| >gnl|CDD|239905 cd04458, CSP_CDS, Cold-Shock Protein (CSP) contains an S1-like cold-shock domain (CSD) that is found in eukaryotes, prokaryotes, and archaea | Back alignment and domain information |
|---|
| >gnl|CDD|224197 COG1278, CspC, Cold shock proteins [Transcription] | Back alignment and domain information |
|---|
| >gnl|CDD|224197 COG1278, CspC, Cold shock proteins [Transcription] | Back alignment and domain information |
|---|
| >gnl|CDD|170841 PRK10943, PRK10943, cold shock-like protein CspC; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|170841 PRK10943, PRK10943, cold shock-like protein CspC; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|169931 PRK09507, cspE, cold shock protein CspE; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|169931 PRK09507, cspE, cold shock protein CspE; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|182402 PRK10354, PRK10354, RNA chaperone/anti-terminator; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|182402 PRK10354, PRK10354, RNA chaperone/anti-terminator; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|214633 smart00357, CSP, Cold shock protein domain | Back alignment and domain information |
|---|
| >gnl|CDD|214633 smart00357, CSP, Cold shock protein domain | Back alignment and domain information |
|---|
| >gnl|CDD|77467 PRK09890, PRK09890, cold shock protein CspG; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|77467 PRK09890, PRK09890, cold shock protein CspG; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|131434 TIGR02381, cspD, cold shock domain protein CspD | Back alignment and domain information |
|---|
| >gnl|CDD|131434 TIGR02381, cspD, cold shock domain protein CspD | Back alignment and domain information |
|---|
| >gnl|CDD|184960 PRK14998, PRK14998, cold shock-like protein CspD; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184960 PRK14998, PRK14998, cold shock-like protein CspD; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|77494 PRK09937, PRK09937, stationary phase/starvation inducible regulatory protein CspD; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|77494 PRK09937, PRK09937, stationary phase/starvation inducible regulatory protein CspD; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|185360 PRK15463, PRK15463, cold shock-like protein CspF; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|185360 PRK15463, PRK15463, cold shock-like protein CspF; Provisional | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 191 | |||
| COG1278 | 67 | CspC Cold shock proteins [Transcription] | 99.91 | |
| COG1278 | 67 | CspC Cold shock proteins [Transcription] | 99.91 | |
| PRK15464 | 70 | cold shock-like protein CspH; Provisional | 99.9 | |
| PRK10943 | 69 | cold shock-like protein CspC; Provisional | 99.89 | |
| PRK15463 | 70 | cold shock-like protein CspF; Provisional | 99.89 | |
| PRK10354 | 70 | RNA chaperone/anti-terminator; Provisional | 99.89 | |
| PRK09890 | 70 | cold shock protein CspG; Provisional | 99.89 | |
| PRK09507 | 69 | cspE cold shock protein CspE; Reviewed | 99.89 | |
| PRK09937 | 74 | stationary phase/starvation inducible regulatory p | 99.89 | |
| PRK15464 | 70 | cold shock-like protein CspH; Provisional | 99.88 | |
| PRK10943 | 69 | cold shock-like protein CspC; Provisional | 99.88 | |
| PRK14998 | 73 | cold shock-like protein CspD; Provisional | 99.88 | |
| PRK15463 | 70 | cold shock-like protein CspF; Provisional | 99.88 | |
| TIGR02381 | 68 | cspD cold shock domain protein CspD. This model re | 99.88 | |
| PRK09890 | 70 | cold shock protein CspG; Provisional | 99.87 | |
| PRK10354 | 70 | RNA chaperone/anti-terminator; Provisional | 99.87 | |
| PRK09507 | 69 | cspE cold shock protein CspE; Reviewed | 99.87 | |
| PRK09937 | 74 | stationary phase/starvation inducible regulatory p | 99.87 | |
| TIGR02381 | 68 | cspD cold shock domain protein CspD. This model re | 99.86 | |
| PRK14998 | 73 | cold shock-like protein CspD; Provisional | 99.86 | |
| PF00313 | 66 | CSD: 'Cold-shock' DNA-binding domain; InterPro: IP | 99.82 | |
| PF00313 | 66 | CSD: 'Cold-shock' DNA-binding domain; InterPro: IP | 99.82 | |
| cd04458 | 65 | CSP_CDS Cold-Shock Protein (CSP) contains an S1-li | 99.81 | |
| cd04458 | 65 | CSP_CDS Cold-Shock Protein (CSP) contains an S1-li | 99.8 | |
| KOG3070|consensus | 235 | 99.55 | ||
| KOG3070|consensus | 235 | 99.49 | ||
| smart00357 | 64 | CSP Cold shock protein domain. RNA-binding domain | 99.0 | |
| smart00357 | 64 | CSP Cold shock protein domain. RNA-binding domain | 98.94 | |
| PRK11642 | 813 | exoribonuclease R; Provisional | 98.72 | |
| TIGR00358 | 654 | 3_prime_RNase VacB and RNase II family 3'-5' exori | 98.51 | |
| PRK05054 | 644 | exoribonuclease II; Provisional | 98.45 | |
| PF08206 | 58 | OB_RNB: Ribonuclease B OB domain; InterPro: IPR013 | 98.37 | |
| TIGR02062 | 639 | RNase_B exoribonuclease II. This family consists o | 98.27 | |
| TIGR02063 | 709 | RNase_R ribonuclease R. This family consists of an | 98.22 | |
| PF08206 | 58 | OB_RNB: Ribonuclease B OB domain; InterPro: IPR013 | 98.15 | |
| PF14444 | 58 | S1-like: S1-like | 97.35 | |
| PF14444 | 58 | S1-like: S1-like | 97.32 | |
| COG2996 | 287 | Predicted RNA-bindining protein (contains S1 and H | 96.95 | |
| PRK13806 | 491 | rpsA 30S ribosomal protein S1; Provisional | 96.78 | |
| PF07497 | 78 | Rho_RNA_bind: Rho termination factor, RNA-binding | 96.66 | |
| COG0557 | 706 | VacB Exoribonuclease R [Transcription] | 96.59 | |
| PRK07899 | 486 | rpsA 30S ribosomal protein S1; Reviewed | 96.56 | |
| PF07497 | 78 | Rho_RNA_bind: Rho termination factor, RNA-binding | 96.45 | |
| PRK13806 | 491 | rpsA 30S ribosomal protein S1; Provisional | 96.19 | |
| PRK12269 | 863 | bifunctional cytidylate kinase/ribosomal protein S | 95.92 | |
| PRK11642 | 813 | exoribonuclease R; Provisional | 95.8 | |
| PRK12269 | 863 | bifunctional cytidylate kinase/ribosomal protein S | 95.7 | |
| cd04459 | 68 | Rho_CSD Rho_CSD: Rho protein cold-shock domain (CS | 95.7 | |
| PRK07400 | 318 | 30S ribosomal protein S1; Reviewed | 95.64 | |
| COG0539 | 541 | RpsA Ribosomal protein S1 [Translation, ribosomal | 95.59 | |
| cd04459 | 68 | Rho_CSD Rho_CSD: Rho protein cold-shock domain (CS | 95.42 | |
| PRK06676 | 390 | rpsA 30S ribosomal protein S1; Reviewed | 95.37 | |
| PRK00087 | 647 | 4-hydroxy-3-methylbut-2-enyl diphosphate reductase | 95.3 | |
| TIGR00358 | 654 | 3_prime_RNase VacB and RNase II family 3'-5' exori | 95.26 | |
| TIGR02062 | 639 | RNase_B exoribonuclease II. This family consists o | 95.11 | |
| PRK05054 | 644 | exoribonuclease II; Provisional | 95.07 | |
| TIGR00717 | 516 | rpsA ribosomal protein S1. This model provides tru | 95.01 | |
| PRK06299 | 565 | rpsA 30S ribosomal protein S1; Reviewed | 94.77 | |
| COG0539 | 541 | RpsA Ribosomal protein S1 [Translation, ribosomal | 94.75 | |
| PRK06299 | 565 | rpsA 30S ribosomal protein S1; Reviewed | 94.52 | |
| PF13509 | 61 | S1_2: S1 domain; PDB: 3GO5_A. | 94.21 | |
| TIGR02063 | 709 | RNase_R ribonuclease R. This family consists of an | 93.79 | |
| TIGR00717 | 516 | rpsA ribosomal protein S1. This model provides tru | 93.53 | |
| PRK09376 | 416 | rho transcription termination factor Rho; Provisio | 93.34 | |
| cd04453 | 88 | S1_RNase_E S1_RNase_E: RNase E and RNase G, S1-lik | 93.11 | |
| cd05698 | 70 | S1_Rrp5_repeat_hs6_sc5 S1_Rrp5_repeat_hs6_sc5: Rrp | 92.6 | |
| cd04461 | 83 | S1_Rrp5_repeat_hs8_sc7 S1_Rrp5_repeat_hs8_sc7: Rrp | 92.5 | |
| PRK07899 | 486 | rpsA 30S ribosomal protein S1; Reviewed | 92.48 | |
| PRK06676 | 390 | rpsA 30S ribosomal protein S1; Reviewed | 92.43 | |
| COG1158 | 422 | Rho Transcription termination factor [Transcriptio | 92.28 | |
| PF00575 | 74 | S1: S1 RNA binding domain; InterPro: IPR003029 Rib | 92.23 | |
| cd00164 | 65 | S1_like S1_like: Ribosomal protein S1-like RNA-bin | 91.97 | |
| PRK07400 | 318 | 30S ribosomal protein S1; Reviewed | 91.94 | |
| cd05696 | 71 | S1_Rrp5_repeat_hs4 S1_Rrp5_repeat_hs4: Rrp5 is a t | 91.48 | |
| PF00575 | 74 | S1: S1 RNA binding domain; InterPro: IPR003029 Rib | 91.4 | |
| PRK12608 | 380 | transcription termination factor Rho; Provisional | 90.57 | |
| cd05704 | 72 | S1_Rrp5_repeat_hs13 S1_Rrp5_repeat_hs13: Rrp5 is a | 90.43 | |
| COG4776 | 645 | Rnb Exoribonuclease II [Transcription] | 90.4 | |
| cd04461 | 83 | S1_Rrp5_repeat_hs8_sc7 S1_Rrp5_repeat_hs8_sc7: Rrp | 90.33 | |
| PRK08582 | 139 | hypothetical protein; Provisional | 90.23 | |
| cd05697 | 69 | S1_Rrp5_repeat_hs5 S1_Rrp5_repeat_hs5: Rrp5 is a t | 90.11 | |
| cd00164 | 65 | S1_like S1_like: Ribosomal protein S1-like RNA-bin | 90.1 | |
| PRK08582 | 139 | hypothetical protein; Provisional | 90.0 | |
| PRK12608 | 380 | transcription termination factor Rho; Provisional | 89.63 | |
| cd04472 | 68 | S1_PNPase S1_PNPase: Polynucleotide phosphorylase | 89.63 | |
| cd04453 | 88 | S1_RNase_E S1_RNase_E: RNase E and RNase G, S1-lik | 89.23 | |
| cd05696 | 71 | S1_Rrp5_repeat_hs4 S1_Rrp5_repeat_hs4: Rrp5 is a t | 89.2 | |
| cd05698 | 70 | S1_Rrp5_repeat_hs6_sc5 S1_Rrp5_repeat_hs6_sc5: Rrp | 89.15 | |
| smart00316 | 72 | S1 Ribosomal protein S1-like RNA-binding domain. | 89.13 | |
| cd05692 | 69 | S1_RPS1_repeat_hs4 S1_RPS1_repeat_hs4: Ribosomal p | 89.08 | |
| PRK09376 | 416 | rho transcription termination factor Rho; Provisio | 88.88 | |
| cd05692 | 69 | S1_RPS1_repeat_hs4 S1_RPS1_repeat_hs4: Ribosomal p | 88.86 | |
| cd04472 | 68 | S1_PNPase S1_PNPase: Polynucleotide phosphorylase | 88.7 | |
| cd05706 | 73 | S1_Rrp5_repeat_sc10 S1_Rrp5_repeat_sc10: Rrp5 is a | 88.56 | |
| PF13509 | 61 | S1_2: S1 domain; PDB: 3GO5_A. | 88.36 | |
| PRK12678 | 672 | transcription termination factor Rho; Provisional | 88.21 | |
| cd05691 | 73 | S1_RPS1_repeat_ec6 S1_RPS1_repeat_ec6: Ribosomal p | 88.07 | |
| smart00316 | 72 | S1 Ribosomal protein S1-like RNA-binding domain. | 87.88 | |
| cd05697 | 69 | S1_Rrp5_repeat_hs5 S1_Rrp5_repeat_hs5: Rrp5 is a t | 86.93 | |
| cd05694 | 74 | S1_Rrp5_repeat_hs2_sc2 S1_Rrp5_repeat_hs2_sc2: Rrp | 86.86 | |
| COG1158 | 422 | Rho Transcription termination factor [Transcriptio | 86.85 | |
| cd05703 | 73 | S1_Rrp5_repeat_hs12_sc9 S1_Rrp5_repeat_hs12_sc9: R | 86.58 | |
| cd05689 | 72 | S1_RPS1_repeat_ec4 S1_RPS1_repeat_ec4: Ribosomal p | 86.57 | |
| cd05706 | 73 | S1_Rrp5_repeat_sc10 S1_Rrp5_repeat_sc10: Rrp5 is a | 86.16 | |
| cd05691 | 73 | S1_RPS1_repeat_ec6 S1_RPS1_repeat_ec6: Ribosomal p | 85.08 | |
| PRK07252 | 120 | hypothetical protein; Provisional | 84.89 | |
| cd04473 | 77 | S1_RecJ_like S1_RecJ_like: The S1 domain of the ar | 84.84 | |
| PRK00087 | 647 | 4-hydroxy-3-methylbut-2-enyl diphosphate reductase | 84.82 | |
| TIGR00767 | 415 | rho transcription termination factor Rho. Members | 84.62 | |
| cd05687 | 70 | S1_RPS1_repeat_ec1_hs1 S1_RPS1_repeat_ec1_hs1: Rib | 84.41 | |
| PRK07252 | 120 | hypothetical protein; Provisional | 84.2 | |
| cd05704 | 72 | S1_Rrp5_repeat_hs13 S1_Rrp5_repeat_hs13: Rrp5 is a | 83.93 | |
| cd05690 | 69 | S1_RPS1_repeat_ec5 S1_RPS1_repeat_ec5: Ribosomal p | 83.92 | |
| PRK05807 | 136 | hypothetical protein; Provisional | 83.83 | |
| cd05705 | 74 | S1_Rrp5_repeat_hs14 S1_Rrp5_repeat_hs14: Rrp5 is a | 83.68 | |
| PF11604 | 70 | CusF_Ec: Copper binding periplasmic protein CusF; | 83.67 | |
| cd05707 | 68 | S1_Rrp5_repeat_sc11 S1_Rrp5_repeat_sc11: Rrp5 is a | 82.78 | |
| TIGR00757 | 414 | RNaseEG ribonuclease, Rne/Rng family. The C-termin | 82.64 | |
| PRK08059 | 123 | general stress protein 13; Validated | 82.62 | |
| COG2996 | 287 | Predicted RNA-bindining protein (contains S1 and H | 82.58 | |
| TIGR00767 | 415 | rho transcription termination factor Rho. Members | 82.49 | |
| cd05686 | 73 | S1_pNO40 S1_pNO40: pNO40 , S1-like RNA-binding dom | 82.28 | |
| cd05689 | 72 | S1_RPS1_repeat_ec4 S1_RPS1_repeat_ec4: Ribosomal p | 82.17 | |
| cd05690 | 69 | S1_RPS1_repeat_ec5 S1_RPS1_repeat_ec5: Ribosomal p | 81.88 | |
| cd05686 | 73 | S1_pNO40 S1_pNO40: pNO40 , S1-like RNA-binding dom | 81.33 | |
| cd05684 | 79 | S1_DHX8_helicase S1_DHX8_helicase: The N-terminal | 81.29 | |
| cd05687 | 70 | S1_RPS1_repeat_ec1_hs1 S1_RPS1_repeat_ec1_hs1: Rib | 81.04 | |
| PRK05807 | 136 | hypothetical protein; Provisional | 81.03 | |
| cd04452 | 76 | S1_IF2_alpha S1_IF2_alpha: The alpha subunit of tr | 80.42 | |
| cd04473 | 77 | S1_RecJ_like S1_RecJ_like: The S1 domain of the ar | 80.4 | |
| cd04455 | 67 | S1_NusA S1_NusA: N-utilizing substance A protein ( | 80.27 |
| >COG1278 CspC Cold shock proteins [Transcription] | Back alignment and domain information |
|---|
Probab=99.91 E-value=2.1e-24 Score=142.62 Aligned_cols=66 Identities=39% Similarity=0.693 Sum_probs=62.8
Q ss_pred ccceEEEEeeCCCCeeEEEeCCCCccEEEEeeeheecCCCCCcccCCCCCEEEEEEEEcCCCceeeEeec
Q psy9900 8 TVRGIVKFYDSKRGFGFITRLDNKEDIFVHKSSIVKMNPKKFFQSLGLGEIVDFNIGVGKKDIEAINVTG 77 (191)
Q Consensus 8 ~~~G~vk~~~~~kGfGFI~~~~~~~dvFvh~s~l~~~~~~~g~~~l~~Gd~V~f~~~~~~~g~~A~~v~~ 77 (191)
+.+|+|||||..||||||.++++++|||||+|+++.. |++.|.+|++|+|++.++++|++|.+|..
T Consensus 1 ~~~GtVKwfn~~KGfGFI~p~~G~~DvFVH~Sai~~~----g~~~L~eGQ~V~f~~~~g~kgp~A~nv~~ 66 (67)
T COG1278 1 MATGTVKWFNATKGFGFITPEDGGKDVFVHISAIQRA----GFRTLREGQKVEFEVEQGRKGPSAANVRA 66 (67)
T ss_pred CCcceEEEeeCCCcceEcCCCCCCcCEEEEeeeeccC----CCcccCCCCEEEEEEecCCCCCceeEEEe
Confidence 4689999999999999999999999999999999987 79999999999999999999999999974
|
|
| >COG1278 CspC Cold shock proteins [Transcription] | Back alignment and domain information |
|---|
| >PRK15464 cold shock-like protein CspH; Provisional | Back alignment and domain information |
|---|
| >PRK10943 cold shock-like protein CspC; Provisional | Back alignment and domain information |
|---|
| >PRK15463 cold shock-like protein CspF; Provisional | Back alignment and domain information |
|---|
| >PRK10354 RNA chaperone/anti-terminator; Provisional | Back alignment and domain information |
|---|
| >PRK09890 cold shock protein CspG; Provisional | Back alignment and domain information |
|---|
| >PRK09507 cspE cold shock protein CspE; Reviewed | Back alignment and domain information |
|---|
| >PRK09937 stationary phase/starvation inducible regulatory protein CspD; Provisional | Back alignment and domain information |
|---|
| >PRK15464 cold shock-like protein CspH; Provisional | Back alignment and domain information |
|---|
| >PRK10943 cold shock-like protein CspC; Provisional | Back alignment and domain information |
|---|
| >PRK14998 cold shock-like protein CspD; Provisional | Back alignment and domain information |
|---|
| >PRK15463 cold shock-like protein CspF; Provisional | Back alignment and domain information |
|---|
| >TIGR02381 cspD cold shock domain protein CspD | Back alignment and domain information |
|---|
| >PRK09890 cold shock protein CspG; Provisional | Back alignment and domain information |
|---|
| >PRK10354 RNA chaperone/anti-terminator; Provisional | Back alignment and domain information |
|---|
| >PRK09507 cspE cold shock protein CspE; Reviewed | Back alignment and domain information |
|---|
| >PRK09937 stationary phase/starvation inducible regulatory protein CspD; Provisional | Back alignment and domain information |
|---|
| >TIGR02381 cspD cold shock domain protein CspD | Back alignment and domain information |
|---|
| >PRK14998 cold shock-like protein CspD; Provisional | Back alignment and domain information |
|---|
| >PF00313 CSD: 'Cold-shock' DNA-binding domain; InterPro: IPR002059 When Escherichia coli is exposed to a temperature drop from 37 to 10 degrees centigrade, a 4-5 hour lag phase occurs, after which growth is resumed at a reduced rate [] | Back alignment and domain information |
|---|
| >PF00313 CSD: 'Cold-shock' DNA-binding domain; InterPro: IPR002059 When Escherichia coli is exposed to a temperature drop from 37 to 10 degrees centigrade, a 4-5 hour lag phase occurs, after which growth is resumed at a reduced rate [] | Back alignment and domain information |
|---|
| >cd04458 CSP_CDS Cold-Shock Protein (CSP) contains an S1-like cold-shock domain (CSD) that is found in eukaryotes, prokaryotes, and archaea | Back alignment and domain information |
|---|
| >cd04458 CSP_CDS Cold-Shock Protein (CSP) contains an S1-like cold-shock domain (CSD) that is found in eukaryotes, prokaryotes, and archaea | Back alignment and domain information |
|---|
| >KOG3070|consensus | Back alignment and domain information |
|---|
| >KOG3070|consensus | Back alignment and domain information |
|---|
| >smart00357 CSP Cold shock protein domain | Back alignment and domain information |
|---|
| >smart00357 CSP Cold shock protein domain | Back alignment and domain information |
|---|
| >PRK11642 exoribonuclease R; Provisional | Back alignment and domain information |
|---|
| >TIGR00358 3_prime_RNase VacB and RNase II family 3'-5' exoribonucleases | Back alignment and domain information |
|---|
| >PRK05054 exoribonuclease II; Provisional | Back alignment and domain information |
|---|
| >PF08206 OB_RNB: Ribonuclease B OB domain; InterPro: IPR013223 This domain includes the N-terminal OB domain found in ribonuclease B proteins in one or two copies | Back alignment and domain information |
|---|
| >TIGR02062 RNase_B exoribonuclease II | Back alignment and domain information |
|---|
| >TIGR02063 RNase_R ribonuclease R | Back alignment and domain information |
|---|
| >PF08206 OB_RNB: Ribonuclease B OB domain; InterPro: IPR013223 This domain includes the N-terminal OB domain found in ribonuclease B proteins in one or two copies | Back alignment and domain information |
|---|
| >PF14444 S1-like: S1-like | Back alignment and domain information |
|---|
| >PF14444 S1-like: S1-like | Back alignment and domain information |
|---|
| >COG2996 Predicted RNA-bindining protein (contains S1 and HTH domains) [General function prediction only] | Back alignment and domain information |
|---|
| >PRK13806 rpsA 30S ribosomal protein S1; Provisional | Back alignment and domain information |
|---|
| >PF07497 Rho_RNA_bind: Rho termination factor, RNA-binding domain; InterPro: IPR011113 The Rho termination factor disengages newly transcribed RNA from its DNA template at certain, specific transcripts | Back alignment and domain information |
|---|
| >COG0557 VacB Exoribonuclease R [Transcription] | Back alignment and domain information |
|---|
| >PRK07899 rpsA 30S ribosomal protein S1; Reviewed | Back alignment and domain information |
|---|
| >PF07497 Rho_RNA_bind: Rho termination factor, RNA-binding domain; InterPro: IPR011113 The Rho termination factor disengages newly transcribed RNA from its DNA template at certain, specific transcripts | Back alignment and domain information |
|---|
| >PRK13806 rpsA 30S ribosomal protein S1; Provisional | Back alignment and domain information |
|---|
| >PRK12269 bifunctional cytidylate kinase/ribosomal protein S1; Provisional | Back alignment and domain information |
|---|
| >PRK11642 exoribonuclease R; Provisional | Back alignment and domain information |
|---|
| >PRK12269 bifunctional cytidylate kinase/ribosomal protein S1; Provisional | Back alignment and domain information |
|---|
| >cd04459 Rho_CSD Rho_CSD: Rho protein cold-shock domain (CSD) | Back alignment and domain information |
|---|
| >PRK07400 30S ribosomal protein S1; Reviewed | Back alignment and domain information |
|---|
| >COG0539 RpsA Ribosomal protein S1 [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >cd04459 Rho_CSD Rho_CSD: Rho protein cold-shock domain (CSD) | Back alignment and domain information |
|---|
| >PRK06676 rpsA 30S ribosomal protein S1; Reviewed | Back alignment and domain information |
|---|
| >PRK00087 4-hydroxy-3-methylbut-2-enyl diphosphate reductase/S1 RNA-binding domain protein; Reviewed | Back alignment and domain information |
|---|
| >TIGR00358 3_prime_RNase VacB and RNase II family 3'-5' exoribonucleases | Back alignment and domain information |
|---|
| >TIGR02062 RNase_B exoribonuclease II | Back alignment and domain information |
|---|
| >PRK05054 exoribonuclease II; Provisional | Back alignment and domain information |
|---|
| >TIGR00717 rpsA ribosomal protein S1 | Back alignment and domain information |
|---|
| >PRK06299 rpsA 30S ribosomal protein S1; Reviewed | Back alignment and domain information |
|---|
| >COG0539 RpsA Ribosomal protein S1 [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK06299 rpsA 30S ribosomal protein S1; Reviewed | Back alignment and domain information |
|---|
| >PF13509 S1_2: S1 domain; PDB: 3GO5_A | Back alignment and domain information |
|---|
| >TIGR02063 RNase_R ribonuclease R | Back alignment and domain information |
|---|
| >TIGR00717 rpsA ribosomal protein S1 | Back alignment and domain information |
|---|
| >PRK09376 rho transcription termination factor Rho; Provisional | Back alignment and domain information |
|---|
| >cd04453 S1_RNase_E S1_RNase_E: RNase E and RNase G, S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >cd05698 S1_Rrp5_repeat_hs6_sc5 S1_Rrp5_repeat_hs6_sc5: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >cd04461 S1_Rrp5_repeat_hs8_sc7 S1_Rrp5_repeat_hs8_sc7: Rrp5 Homo sapiens S1 repeat 8 (hs8) and Saccharomyces cerevisiae S1 repeat 7 (sc7)-like domains | Back alignment and domain information |
|---|
| >PRK07899 rpsA 30S ribosomal protein S1; Reviewed | Back alignment and domain information |
|---|
| >PRK06676 rpsA 30S ribosomal protein S1; Reviewed | Back alignment and domain information |
|---|
| >COG1158 Rho Transcription termination factor [Transcription] | Back alignment and domain information |
|---|
| >PF00575 S1: S1 RNA binding domain; InterPro: IPR003029 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms | Back alignment and domain information |
|---|
| >cd00164 S1_like S1_like: Ribosomal protein S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >PRK07400 30S ribosomal protein S1; Reviewed | Back alignment and domain information |
|---|
| >cd05696 S1_Rrp5_repeat_hs4 S1_Rrp5_repeat_hs4: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >PF00575 S1: S1 RNA binding domain; InterPro: IPR003029 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms | Back alignment and domain information |
|---|
| >PRK12608 transcription termination factor Rho; Provisional | Back alignment and domain information |
|---|
| >cd05704 S1_Rrp5_repeat_hs13 S1_Rrp5_repeat_hs13: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >COG4776 Rnb Exoribonuclease II [Transcription] | Back alignment and domain information |
|---|
| >cd04461 S1_Rrp5_repeat_hs8_sc7 S1_Rrp5_repeat_hs8_sc7: Rrp5 Homo sapiens S1 repeat 8 (hs8) and Saccharomyces cerevisiae S1 repeat 7 (sc7)-like domains | Back alignment and domain information |
|---|
| >PRK08582 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd05697 S1_Rrp5_repeat_hs5 S1_Rrp5_repeat_hs5: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >cd00164 S1_like S1_like: Ribosomal protein S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >PRK08582 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK12608 transcription termination factor Rho; Provisional | Back alignment and domain information |
|---|
| >cd04472 S1_PNPase S1_PNPase: Polynucleotide phosphorylase (PNPase), ), S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >cd04453 S1_RNase_E S1_RNase_E: RNase E and RNase G, S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >cd05696 S1_Rrp5_repeat_hs4 S1_Rrp5_repeat_hs4: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >cd05698 S1_Rrp5_repeat_hs6_sc5 S1_Rrp5_repeat_hs6_sc5: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >smart00316 S1 Ribosomal protein S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >cd05692 S1_RPS1_repeat_hs4 S1_RPS1_repeat_hs4: Ribosomal protein S1 (RPS1) domain | Back alignment and domain information |
|---|
| >PRK09376 rho transcription termination factor Rho; Provisional | Back alignment and domain information |
|---|
| >cd05692 S1_RPS1_repeat_hs4 S1_RPS1_repeat_hs4: Ribosomal protein S1 (RPS1) domain | Back alignment and domain information |
|---|
| >cd04472 S1_PNPase S1_PNPase: Polynucleotide phosphorylase (PNPase), ), S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >cd05706 S1_Rrp5_repeat_sc10 S1_Rrp5_repeat_sc10: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >PF13509 S1_2: S1 domain; PDB: 3GO5_A | Back alignment and domain information |
|---|
| >PRK12678 transcription termination factor Rho; Provisional | Back alignment and domain information |
|---|
| >cd05691 S1_RPS1_repeat_ec6 S1_RPS1_repeat_ec6: Ribosomal protein S1 (RPS1) domain | Back alignment and domain information |
|---|
| >smart00316 S1 Ribosomal protein S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >cd05697 S1_Rrp5_repeat_hs5 S1_Rrp5_repeat_hs5: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >cd05694 S1_Rrp5_repeat_hs2_sc2 S1_Rrp5_repeat_hs2_sc2: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >COG1158 Rho Transcription termination factor [Transcription] | Back alignment and domain information |
|---|
| >cd05703 S1_Rrp5_repeat_hs12_sc9 S1_Rrp5_repeat_hs12_sc9: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >cd05689 S1_RPS1_repeat_ec4 S1_RPS1_repeat_ec4: Ribosomal protein S1 (RPS1) domain | Back alignment and domain information |
|---|
| >cd05706 S1_Rrp5_repeat_sc10 S1_Rrp5_repeat_sc10: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >cd05691 S1_RPS1_repeat_ec6 S1_RPS1_repeat_ec6: Ribosomal protein S1 (RPS1) domain | Back alignment and domain information |
|---|
| >PRK07252 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd04473 S1_RecJ_like S1_RecJ_like: The S1 domain of the archaea-specific RecJ-like exonuclease | Back alignment and domain information |
|---|
| >PRK00087 4-hydroxy-3-methylbut-2-enyl diphosphate reductase/S1 RNA-binding domain protein; Reviewed | Back alignment and domain information |
|---|
| >TIGR00767 rho transcription termination factor Rho | Back alignment and domain information |
|---|
| >cd05687 S1_RPS1_repeat_ec1_hs1 S1_RPS1_repeat_ec1_hs1: Ribosomal protein S1 (RPS1) domain | Back alignment and domain information |
|---|
| >PRK07252 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd05704 S1_Rrp5_repeat_hs13 S1_Rrp5_repeat_hs13: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >cd05690 S1_RPS1_repeat_ec5 S1_RPS1_repeat_ec5: Ribosomal protein S1 (RPS1) domain | Back alignment and domain information |
|---|
| >PRK05807 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd05705 S1_Rrp5_repeat_hs14 S1_Rrp5_repeat_hs14: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >PF11604 CusF_Ec: Copper binding periplasmic protein CusF; InterPro: IPR021647 CusF is a periplasmic protein involved in copper and silver resistance in Escherichia coil | Back alignment and domain information |
|---|
| >cd05707 S1_Rrp5_repeat_sc11 S1_Rrp5_repeat_sc11: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >TIGR00757 RNaseEG ribonuclease, Rne/Rng family | Back alignment and domain information |
|---|
| >PRK08059 general stress protein 13; Validated | Back alignment and domain information |
|---|
| >COG2996 Predicted RNA-bindining protein (contains S1 and HTH domains) [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00767 rho transcription termination factor Rho | Back alignment and domain information |
|---|
| >cd05686 S1_pNO40 S1_pNO40: pNO40 , S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >cd05689 S1_RPS1_repeat_ec4 S1_RPS1_repeat_ec4: Ribosomal protein S1 (RPS1) domain | Back alignment and domain information |
|---|
| >cd05690 S1_RPS1_repeat_ec5 S1_RPS1_repeat_ec5: Ribosomal protein S1 (RPS1) domain | Back alignment and domain information |
|---|
| >cd05686 S1_pNO40 S1_pNO40: pNO40 , S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >cd05684 S1_DHX8_helicase S1_DHX8_helicase: The N-terminal S1 domain of human ATP-dependent RNA helicase DHX8, a DEAH (Asp-Glu-Ala-His) box polypeptide | Back alignment and domain information |
|---|
| >cd05687 S1_RPS1_repeat_ec1_hs1 S1_RPS1_repeat_ec1_hs1: Ribosomal protein S1 (RPS1) domain | Back alignment and domain information |
|---|
| >PRK05807 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd04452 S1_IF2_alpha S1_IF2_alpha: The alpha subunit of translation Initiation Factor 2, S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >cd04473 S1_RecJ_like S1_RecJ_like: The S1 domain of the archaea-specific RecJ-like exonuclease | Back alignment and domain information |
|---|
| >cd04455 S1_NusA S1_NusA: N-utilizing substance A protein (NusA), S1-like RNA-binding domain | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 191 | ||||
| 1h95_A | 79 | Solution Structure Of The Single-Stranded Dna-Bindi | 6e-16 | ||
| 1h95_A | 79 | Solution Structure Of The Single-Stranded Dna-Bindi | 9e-16 | ||
| 1g6p_A | 66 | Solution Nmr Structure Of The Cold Shock Protein Fr | 1e-07 | ||
| 1g6p_A | 66 | Solution Nmr Structure Of The Cold Shock Protein Fr | 1e-07 | ||
| 3trz_A | 148 | Mouse Lin28a In Complex With Let-7d Microrna Pre-El | 2e-07 | ||
| 3ts0_A | 146 | Mouse Lin28a In Complex With Let-7f-1 Microrna Pre- | 3e-07 | ||
| 3ulj_A | 90 | Crystal Structure Of Apo Lin28b Cold Shock Domain L | 4e-07 | ||
| 4a4i_A | 90 | Crystal Structure Of The Human Lin28b Cold Shock Do | 9e-07 | ||
| 4a4i_A | 90 | Crystal Structure Of The Human Lin28b Cold Shock Do | 1e-06 | ||
| 3i2z_B | 71 | Structure Of Cold Shock Protein E From Salmonella T | 1e-06 | ||
| 3i2z_B | 71 | Structure Of Cold Shock Protein E From Salmonella T | 1e-06 | ||
| 1mjc_A | 69 | Crystal Structure Of Cspa, The Major Cold Shock Pro | 3e-06 | ||
| 1mjc_A | 69 | Crystal Structure Of Cspa, The Major Cold Shock Pro | 3e-06 | ||
| 2l15_A | 70 | Solution Structure Of Cold Shock Protein Cspa Using | 4e-06 | ||
| 2l15_A | 70 | Solution Structure Of Cold Shock Protein Cspa Using | 4e-06 | ||
| 3mef_A | 69 | Major Cold-Shock Protein From Escherichia Coli Solu | 4e-06 | ||
| 3mef_A | 69 | Major Cold-Shock Protein From Escherichia Coli Solu | 4e-06 | ||
| 3cam_A | 67 | Crystal Structure Of The Cold Shock Domain Protein | 2e-05 | ||
| 3cam_A | 67 | Crystal Structure Of The Cold Shock Domain Protein | 2e-05 | ||
| 2i5l_X | 67 | Crystal Structure Of Bacillus Subtilis Cold Shock P | 4e-05 | ||
| 2i5l_X | 67 | Crystal Structure Of Bacillus Subtilis Cold Shock P | 4e-05 | ||
| 2es2_A | 67 | Crystal Structure Analysis Of The Bacillus Subtilis | 5e-05 | ||
| 2es2_A | 67 | Crystal Structure Analysis Of The Bacillus Subtilis | 5e-05 | ||
| 3a0j_A | 73 | Crystal Structure Of Cold Shock Protein 1 From Ther | 7e-05 | ||
| 3a0j_A | 73 | Crystal Structure Of Cold Shock Protein 1 From Ther | 7e-05 | ||
| 2i5m_X | 67 | Crystal Structure Of Bacillus Subtilis Cold Shock P | 2e-04 | ||
| 2i5m_X | 67 | Crystal Structure Of Bacillus Subtilis Cold Shock P | 2e-04 | ||
| 2bh8_A | 101 | Combinatorial Protein 1b11 Length = 101 | 4e-04 | ||
| 2bh8_A | 101 | Combinatorial Protein 1b11 Length = 101 | 6e-04 | ||
| 1hza_A | 67 | Bacillus Caldolyticus Cold-Shock Protein Mutants To | 8e-04 | ||
| 1hza_A | 67 | Bacillus Caldolyticus Cold-Shock Protein Mutants To | 8e-04 |
| >pdb|1H95|A Chain A, Solution Structure Of The Single-Stranded Dna-Binding Cold Shock Domain (Csd) Of Human Y-Box Protein 1 (Yb1) Determined By Nmr (10 Lowest Energy Structures) Length = 79 | Back alignment and structure |
|
| >pdb|1H95|A Chain A, Solution Structure Of The Single-Stranded Dna-Binding Cold Shock Domain (Csd) Of Human Y-Box Protein 1 (Yb1) Determined By Nmr (10 Lowest Energy Structures) Length = 79 | Back alignment and structure |
| >pdb|1G6P|A Chain A, Solution Nmr Structure Of The Cold Shock Protein From The Hyperthermophilic Bacterium Thermotoga Maritima Length = 66 | Back alignment and structure |
| >pdb|1G6P|A Chain A, Solution Nmr Structure Of The Cold Shock Protein From The Hyperthermophilic Bacterium Thermotoga Maritima Length = 66 | Back alignment and structure |
| >pdb|3TRZ|A Chain A, Mouse Lin28a In Complex With Let-7d Microrna Pre-Element Length = 148 | Back alignment and structure |
| >pdb|3TS0|A Chain A, Mouse Lin28a In Complex With Let-7f-1 Microrna Pre-Element Length = 146 | Back alignment and structure |
| >pdb|3ULJ|A Chain A, Crystal Structure Of Apo Lin28b Cold Shock Domain Length = 90 | Back alignment and structure |
| >pdb|4A4I|A Chain A, Crystal Structure Of The Human Lin28b Cold Shock Domain Length = 90 | Back alignment and structure |
| >pdb|4A4I|A Chain A, Crystal Structure Of The Human Lin28b Cold Shock Domain Length = 90 | Back alignment and structure |
| >pdb|3I2Z|B Chain B, Structure Of Cold Shock Protein E From Salmonella Typhimurium Length = 71 | Back alignment and structure |
| >pdb|3I2Z|B Chain B, Structure Of Cold Shock Protein E From Salmonella Typhimurium Length = 71 | Back alignment and structure |
| >pdb|1MJC|A Chain A, Crystal Structure Of Cspa, The Major Cold Shock Protein Of Escherichia Coli Length = 69 | Back alignment and structure |
| >pdb|1MJC|A Chain A, Crystal Structure Of Cspa, The Major Cold Shock Protein Of Escherichia Coli Length = 69 | Back alignment and structure |
| >pdb|2L15|A Chain A, Solution Structure Of Cold Shock Protein Cspa Using Combined Nmr And Cs-Rosetta Method Length = 70 | Back alignment and structure |
| >pdb|2L15|A Chain A, Solution Structure Of Cold Shock Protein Cspa Using Combined Nmr And Cs-Rosetta Method Length = 70 | Back alignment and structure |
| >pdb|3MEF|A Chain A, Major Cold-Shock Protein From Escherichia Coli Solution Nmr Structure Length = 69 | Back alignment and structure |
| >pdb|3MEF|A Chain A, Major Cold-Shock Protein From Escherichia Coli Solution Nmr Structure Length = 69 | Back alignment and structure |
| >pdb|3CAM|A Chain A, Crystal Structure Of The Cold Shock Domain Protein From Neisseria Meningitidis Length = 67 | Back alignment and structure |
| >pdb|3CAM|A Chain A, Crystal Structure Of The Cold Shock Domain Protein From Neisseria Meningitidis Length = 67 | Back alignment and structure |
| >pdb|2I5L|X Chain X, Crystal Structure Of Bacillus Subtilis Cold Shock Protein Variant Bs-Cspb M1rE3KK65I Length = 67 | Back alignment and structure |
| >pdb|2I5L|X Chain X, Crystal Structure Of Bacillus Subtilis Cold Shock Protein Variant Bs-Cspb M1rE3KK65I Length = 67 | Back alignment and structure |
| >pdb|2ES2|A Chain A, Crystal Structure Analysis Of The Bacillus Subtilis Cold Shock Protein Bs-Cspb In Complex With Hexathymidine Length = 67 | Back alignment and structure |
| >pdb|2ES2|A Chain A, Crystal Structure Analysis Of The Bacillus Subtilis Cold Shock Protein Bs-Cspb In Complex With Hexathymidine Length = 67 | Back alignment and structure |
| >pdb|3A0J|A Chain A, Crystal Structure Of Cold Shock Protein 1 From Thermus Thermophilus Hb8 Length = 73 | Back alignment and structure |
| >pdb|3A0J|A Chain A, Crystal Structure Of Cold Shock Protein 1 From Thermus Thermophilus Hb8 Length = 73 | Back alignment and structure |
| >pdb|2I5M|X Chain X, Crystal Structure Of Bacillus Subtilis Cold Shock Protein Cspb Variant A46k S48r Length = 67 | Back alignment and structure |
| >pdb|2I5M|X Chain X, Crystal Structure Of Bacillus Subtilis Cold Shock Protein Cspb Variant A46k S48r Length = 67 | Back alignment and structure |
| >pdb|2BH8|A Chain A, Combinatorial Protein 1b11 Length = 101 | Back alignment and structure |
| >pdb|2BH8|A Chain A, Combinatorial Protein 1b11 Length = 101 | Back alignment and structure |
| >pdb|1HZA|A Chain A, Bacillus Caldolyticus Cold-Shock Protein Mutants To Study Determinants Of Protein Stability Length = 67 | Back alignment and structure |
| >pdb|1HZA|A Chain A, Bacillus Caldolyticus Cold-Shock Protein Mutants To Study Determinants Of Protein Stability Length = 67 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 191 | |||
| 1h95_A | 79 | CSD, Y-box binding protein; translation factor, tr | 3e-21 | |
| 1h95_A | 79 | CSD, Y-box binding protein; translation factor, tr | 3e-21 | |
| 3ts2_A | 148 | Protein LIN-28 homolog A; microrna biogenesis, pro | 1e-19 | |
| 3ts2_A | 148 | Protein LIN-28 homolog A; microrna biogenesis, pro | 3e-19 | |
| 3ulj_A | 90 | LIN28B, DNA-binding protein; beta barrel, cold sho | 2e-18 | |
| 3ulj_A | 90 | LIN28B, DNA-binding protein; beta barrel, cold sho | 2e-18 | |
| 2kcm_A | 74 | Cold shock domain family protein; nucleic acid bin | 1e-13 | |
| 2kcm_A | 74 | Cold shock domain family protein; nucleic acid bin | 1e-13 | |
| 2k5n_A | 74 | Putative cold-shock protein; GFT protein structure | 7e-12 | |
| 2k5n_A | 74 | Putative cold-shock protein; GFT protein structure | 7e-12 | |
| 3i2z_B | 71 | RNA chaperone, negative regulator of CSPA transcri | 2e-11 | |
| 3i2z_B | 71 | RNA chaperone, negative regulator of CSPA transcri | 2e-11 | |
| 1g6p_A | 66 | Cold shock protein TMCSP; greek-KEY, beta barrel, | 1e-10 | |
| 1g6p_A | 66 | Cold shock protein TMCSP; greek-KEY, beta barrel, | 1e-10 | |
| 3cam_A | 67 | Cold-shock domain family protein; cold shock prote | 1e-10 | |
| 3cam_A | 67 | Cold-shock domain family protein; cold shock prote | 1e-10 | |
| 2lss_A | 70 | Cold shock-like protein; CSD, CSP, oligonucleotide | 2e-10 | |
| 2lss_A | 70 | Cold shock-like protein; CSD, CSP, oligonucleotide | 2e-10 | |
| 1c9o_A | 66 | CSPB, cold-shock protein; beta barrel, homodimer, | 5e-10 | |
| 1c9o_A | 66 | CSPB, cold-shock protein; beta barrel, homodimer, | 5e-10 | |
| 2ytx_A | 97 | Cold shock domain-containing protein E1; cell-free | 7e-10 | |
| 2ytx_A | 97 | Cold shock domain-containing protein E1; cell-free | 7e-10 | |
| 3aqq_A | 147 | Calcium-regulated heat stable protein 1; compact b | 1e-09 | |
| 3aqq_A | 147 | Calcium-regulated heat stable protein 1; compact b | 1e-08 | |
| 3a0j_A | 73 | Cold shock protein; OB-fold, cytoplasm, transcript | 9e-09 | |
| 3a0j_A | 73 | Cold shock protein; OB-fold, cytoplasm, transcript | 9e-09 | |
| 2yty_A | 88 | Cold shock domain-containing protein E1; cell-free | 4e-08 | |
| 2yty_A | 88 | Cold shock domain-containing protein E1; cell-free | 4e-08 | |
| 2bh8_A | 101 | 1B11; transcription, molecular evolution, unique a | 5e-08 | |
| 2bh8_A | 101 | 1B11; transcription, molecular evolution, unique a | 9e-08 | |
| 1wfq_A | 89 | UNR protein; beta-barrel, translational regulation | 5e-05 | |
| 1wfq_A | 89 | UNR protein; beta-barrel, translational regulation | 5e-05 | |
| 1x65_A | 89 | UNR protein; cell-free protein synthesis, beta-bar | 4e-04 |
| >1h95_A CSD, Y-box binding protein; translation factor, transcription factor, OB-fold, 5- stranded anti-parallel beta-barrel, single stranded DNA binding; NMR {Homo sapiens} SCOP: b.40.4.5 Length = 79 | Back alignment and structure |
|---|
Score = 82.0 bits (203), Expect = 3e-21
Identities = 36/70 (51%), Positives = 53/70 (75%)
Query: 9 VRGIVKFYDSKRGFGFITRLDNKEDIFVHKSSIVKMNPKKFFQSLGLGEIVDFNIGVGKK 68
V G VK+++ + G+GFI R D KED+FVH+++I K NP+K+ +S+G GE V+F++ G+K
Sbjct: 9 VLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEK 68
Query: 69 DIEAINVTGP 78
EA NVTGP
Sbjct: 69 GAEAANVTGP 78
|
| >1h95_A CSD, Y-box binding protein; translation factor, transcription factor, OB-fold, 5- stranded anti-parallel beta-barrel, single stranded DNA binding; NMR {Homo sapiens} SCOP: b.40.4.5 Length = 79 | Back alignment and structure |
|---|
| >3ts2_A Protein LIN-28 homolog A; microrna biogenesis, protein-RNA complex, PRE-element, CCHC knuckle; HET: GMP; 2.01A {Mus musculus} PDB: 3trz_A* 3ts0_A* Length = 148 | Back alignment and structure |
|---|
| >3ts2_A Protein LIN-28 homolog A; microrna biogenesis, protein-RNA complex, PRE-element, CCHC knuckle; HET: GMP; 2.01A {Mus musculus} PDB: 3trz_A* 3ts0_A* Length = 148 | Back alignment and structure |
|---|
| >3ulj_A LIN28B, DNA-binding protein; beta barrel, cold shock domain fold, nucleic acid binding, D binding protein; 1.06A {Silurana} PDB: 4a4i_A Length = 90 | Back alignment and structure |
|---|
| >3ulj_A LIN28B, DNA-binding protein; beta barrel, cold shock domain fold, nucleic acid binding, D binding protein; 1.06A {Silurana} PDB: 4a4i_A Length = 90 | Back alignment and structure |
|---|
| >2kcm_A Cold shock domain family protein; nucleic acid binding protein, beta barrel, structural genomi 2, protein structure initiative; NMR {Shewanella oneidensis} Length = 74 | Back alignment and structure |
|---|
| >2kcm_A Cold shock domain family protein; nucleic acid binding protein, beta barrel, structural genomi 2, protein structure initiative; NMR {Shewanella oneidensis} Length = 74 | Back alignment and structure |
|---|
| >2k5n_A Putative cold-shock protein; GFT protein structure, PSI, nesgc, OB fold, cold shock structural genomics; NMR {Pectobacterium atrosepticum} Length = 74 | Back alignment and structure |
|---|
| >2k5n_A Putative cold-shock protein; GFT protein structure, PSI, nesgc, OB fold, cold shock structural genomics; NMR {Pectobacterium atrosepticum} Length = 74 | Back alignment and structure |
|---|
| >3i2z_B RNA chaperone, negative regulator of CSPA transcription; beta barrel, DNA binding protein/transcription, cytoplasm, gene regulation; 1.10A {Salmonella typhimurium} PDB: 2l15_A 1mjc_A 3mef_A Length = 71 | Back alignment and structure |
|---|
| >3i2z_B RNA chaperone, negative regulator of CSPA transcription; beta barrel, DNA binding protein/transcription, cytoplasm, gene regulation; 1.10A {Salmonella typhimurium} PDB: 2l15_A 1mjc_A 3mef_A Length = 71 | Back alignment and structure |
|---|
| >1g6p_A Cold shock protein TMCSP; greek-KEY, beta barrel, OB-fold, structural genomics; NMR {Thermotoga maritima} SCOP: b.40.4.5 Length = 66 | Back alignment and structure |
|---|
| >1g6p_A Cold shock protein TMCSP; greek-KEY, beta barrel, OB-fold, structural genomics; NMR {Thermotoga maritima} SCOP: b.40.4.5 Length = 66 | Back alignment and structure |
|---|
| >3cam_A Cold-shock domain family protein; cold shock protein, chain SWAP, STRU genomics, oxford protein production facility, OPPF, gene RE; 2.60A {Neisseria meningitidis MC58} Length = 67 | Back alignment and structure |
|---|
| >3cam_A Cold-shock domain family protein; cold shock protein, chain SWAP, STRU genomics, oxford protein production facility, OPPF, gene RE; 2.60A {Neisseria meningitidis MC58} Length = 67 | Back alignment and structure |
|---|
| >2lss_A Cold shock-like protein; CSD, CSP, oligonucleotide binding F fold, RNA binding protein, DNA binding protein; NMR {Rickettsia rickettsii} Length = 70 | Back alignment and structure |
|---|
| >2lss_A Cold shock-like protein; CSD, CSP, oligonucleotide binding F fold, RNA binding protein, DNA binding protein; NMR {Rickettsia rickettsii} Length = 70 | Back alignment and structure |
|---|
| >1c9o_A CSPB, cold-shock protein; beta barrel, homodimer, transcription; 1.17A {Bacillus caldolyticus} SCOP: b.40.4.5 PDB: 2hax_A 1hz9_A 1hzb_A 1i5f_A 1hza_A 1hzc_A 3pf4_A 1csq_A 1nmf_A 1nmg_A 1csp_A 2f52_A 2es2_A 3pf5_A 2i5m_X 2i5l_X Length = 66 | Back alignment and structure |
|---|
| >1c9o_A CSPB, cold-shock protein; beta barrel, homodimer, transcription; 1.17A {Bacillus caldolyticus} SCOP: b.40.4.5 PDB: 2hax_A 1hz9_A 1hzb_A 1i5f_A 1hza_A 1hzc_A 3pf4_A 1csq_A 1nmf_A 1nmg_A 1csp_A 2f52_A 2es2_A 3pf5_A 2i5m_X 2i5l_X Length = 66 | Back alignment and structure |
|---|
| >2ytx_A Cold shock domain-containing protein E1; cell-free protein synthesis, beta-barrel, translational REGU RNA chaperone, RNA/DNA binding, QB fold; NMR {Homo sapiens} Length = 97 | Back alignment and structure |
|---|
| >2ytx_A Cold shock domain-containing protein E1; cell-free protein synthesis, beta-barrel, translational REGU RNA chaperone, RNA/DNA binding, QB fold; NMR {Homo sapiens} Length = 97 | Back alignment and structure |
|---|
| >3aqq_A Calcium-regulated heat stable protein 1; compact beta-barrel, cold shock domain, ssDNA binding, DNA B protein; 2.80A {Homo sapiens} Length = 147 | Back alignment and structure |
|---|
| >3aqq_A Calcium-regulated heat stable protein 1; compact beta-barrel, cold shock domain, ssDNA binding, DNA B protein; 2.80A {Homo sapiens} Length = 147 | Back alignment and structure |
|---|
| >3a0j_A Cold shock protein; OB-fold, cytoplasm, transcription, structural genomics, NPPSFA; 1.65A {Thermus thermophilus} Length = 73 | Back alignment and structure |
|---|
| >3a0j_A Cold shock protein; OB-fold, cytoplasm, transcription, structural genomics, NPPSFA; 1.65A {Thermus thermophilus} Length = 73 | Back alignment and structure |
|---|
| >2yty_A Cold shock domain-containing protein E1; cell-free protein synthesis, beta-barrel, translational REGU RNA chaperone, RNA/DNA binding, QB fold; NMR {Homo sapiens} Length = 88 | Back alignment and structure |
|---|
| >2yty_A Cold shock domain-containing protein E1; cell-free protein synthesis, beta-barrel, translational REGU RNA chaperone, RNA/DNA binding, QB fold; NMR {Homo sapiens} Length = 88 | Back alignment and structure |
|---|
| >2bh8_A 1B11; transcription, molecular evolution, unique architecture, transcription regulation, phosphorylation; 1.9A {Escherichia coli} Length = 101 | Back alignment and structure |
|---|
| >2bh8_A 1B11; transcription, molecular evolution, unique architecture, transcription regulation, phosphorylation; 1.9A {Escherichia coli} Length = 101 | Back alignment and structure |
|---|
| >1wfq_A UNR protein; beta-barrel, translational regulation, RNA chaperone, RNA/DN binding, QB fold, greek-KEY topology, structur genomics; NMR {Homo sapiens} SCOP: b.40.4.5 Length = 89 | Back alignment and structure |
|---|
| >1wfq_A UNR protein; beta-barrel, translational regulation, RNA chaperone, RNA/DN binding, QB fold, greek-KEY topology, structur genomics; NMR {Homo sapiens} SCOP: b.40.4.5 Length = 89 | Back alignment and structure |
|---|
| >1x65_A UNR protein; cell-free protein synthesis, beta-barrel, translational REGU RNA chaperone, RNA/DNA binding, QB fold, greek-KEY topology protein; NMR {Homo sapiens} Length = 89 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 191 | |||
| 3ulj_A | 90 | LIN28B, DNA-binding protein; beta barrel, cold sho | 99.93 | |
| 1h95_A | 79 | CSD, Y-box binding protein; translation factor, tr | 99.92 | |
| 3ulj_A | 90 | LIN28B, DNA-binding protein; beta barrel, cold sho | 99.91 | |
| 1h95_A | 79 | CSD, Y-box binding protein; translation factor, tr | 99.91 | |
| 3i2z_B | 71 | RNA chaperone, negative regulator of CSPA transcri | 99.9 | |
| 3cam_A | 67 | Cold-shock domain family protein; cold shock prote | 99.9 | |
| 3cam_A | 67 | Cold-shock domain family protein; cold shock prote | 99.89 | |
| 3i2z_B | 71 | RNA chaperone, negative regulator of CSPA transcri | 99.88 | |
| 1c9o_A | 66 | CSPB, cold-shock protein; beta barrel, homodimer, | 99.88 | |
| 3a0j_A | 73 | Cold shock protein; OB-fold, cytoplasm, transcript | 99.88 | |
| 1c9o_A | 66 | CSPB, cold-shock protein; beta barrel, homodimer, | 99.87 | |
| 3ts2_A | 148 | Protein LIN-28 homolog A; microrna biogenesis, pro | 99.87 | |
| 2kcm_A | 74 | Cold shock domain family protein; nucleic acid bin | 99.87 | |
| 3a0j_A | 73 | Cold shock protein; OB-fold, cytoplasm, transcript | 99.87 | |
| 2kcm_A | 74 | Cold shock domain family protein; nucleic acid bin | 99.87 | |
| 1g6p_A | 66 | Cold shock protein TMCSP; greek-KEY, beta barrel, | 99.87 | |
| 2lss_A | 70 | Cold shock-like protein; CSD, CSP, oligonucleotide | 99.78 | |
| 1g6p_A | 66 | Cold shock protein TMCSP; greek-KEY, beta barrel, | 99.87 | |
| 2k5n_A | 74 | Putative cold-shock protein; GFT protein structure | 99.86 | |
| 2k5n_A | 74 | Putative cold-shock protein; GFT protein structure | 99.86 | |
| 2lss_A | 70 | Cold shock-like protein; CSD, CSP, oligonucleotide | 99.76 | |
| 3ts2_A | 148 | Protein LIN-28 homolog A; microrna biogenesis, pro | 99.85 | |
| 1wfq_A | 89 | UNR protein; beta-barrel, translational regulation | 99.84 | |
| 1wfq_A | 89 | UNR protein; beta-barrel, translational regulation | 99.83 | |
| 2yty_A | 88 | Cold shock domain-containing protein E1; cell-free | 99.82 | |
| 3aqq_A | 147 | Calcium-regulated heat stable protein 1; compact b | 99.82 | |
| 3aqq_A | 147 | Calcium-regulated heat stable protein 1; compact b | 99.8 | |
| 2ytx_A | 97 | Cold shock domain-containing protein E1; cell-free | 99.8 | |
| 2yty_A | 88 | Cold shock domain-containing protein E1; cell-free | 99.8 | |
| 1x65_A | 89 | UNR protein; cell-free protein synthesis, beta-bar | 99.79 | |
| 2ytx_A | 97 | Cold shock domain-containing protein E1; cell-free | 99.77 | |
| 1x65_A | 89 | UNR protein; cell-free protein synthesis, beta-bar | 99.75 | |
| 2ytv_A | 79 | Cold shock domain-containing protein E1; cell-free | 99.73 | |
| 2ytv_A | 79 | Cold shock domain-containing protein E1; cell-free | 99.73 | |
| 2bh8_A | 101 | 1B11; transcription, molecular evolution, unique a | 99.62 | |
| 2bh8_A | 101 | 1B11; transcription, molecular evolution, unique a | 99.52 | |
| 2id0_A | 644 | Exoribonuclease 2; RNAse, exonuclease, hydrolyase, | 98.43 | |
| 3go5_A | 285 | Multidomain protein with S1 RNA-binding domains; s | 97.85 | |
| 3go5_A | 285 | Multidomain protein with S1 RNA-binding domains; s | 97.63 | |
| 1a62_A | 130 | RHO; transcription termination, termination, RNA b | 97.45 | |
| 2vnu_D | 760 | Exosome complex exonuclease RRP44; hydrolase-RNA c | 97.38 | |
| 1a62_A | 130 | RHO; transcription termination, termination, RNA b | 97.05 | |
| 2wp8_J | 977 | Exosome complex exonuclease DIS3; nucleus, hydrola | 96.76 | |
| 2id0_A | 644 | Exoribonuclease 2; RNAse, exonuclease, hydrolyase, | 95.79 | |
| 3l0o_A | 427 | Transcription termination factor RHO; helicase, RH | 93.52 | |
| 2k52_A | 80 | Uncharacterized protein MJ1198; metal-binding, zin | 92.11 | |
| 2cqo_A | 119 | Nucleolar protein of 40 kDa; S1 domain, OB-fold, s | 91.7 | |
| 2k52_A | 80 | Uncharacterized protein MJ1198; metal-binding, zin | 91.5 | |
| 2eqs_A | 103 | ATP-dependent RNA helicase DHX8; S1 domain, OB-fol | 90.27 | |
| 2khi_A | 115 | 30S ribosomal protein S1; acetylation, phosphoprot | 89.61 | |
| 2k4k_A | 130 | GSP13, general stress protein 13; cytoplasm, stres | 89.31 | |
| 3l0o_A | 427 | Transcription termination factor RHO; helicase, RH | 89.06 | |
| 2khi_A | 115 | 30S ribosomal protein S1; acetylation, phosphoprot | 87.94 | |
| 2bx2_L | 517 | Ribonuclease E, RNAse E; RNA-binding, RNA turnover | 87.49 | |
| 2k4k_A | 130 | GSP13, general stress protein 13; cytoplasm, stres | 87.4 | |
| 2khj_A | 109 | 30S ribosomal protein S1; OB fold, acetylation, ph | 87.08 | |
| 3ice_A | 422 | Transcription termination factor RHO; transcriptio | 86.13 | |
| 2b8k_G | 215 | B16, DNA-directed RNA polymerase II 19 kDa polypep | 85.83 | |
| 2eqs_A | 103 | ATP-dependent RNA helicase DHX8; S1 domain, OB-fol | 85.62 | |
| 2cqo_A | 119 | Nucleolar protein of 40 kDa; S1 domain, OB-fold, s | 85.25 | |
| 1y14_B | 171 | B16, RPB7, DNA-directed RNA polymerase II 19 kDa p | 84.0 | |
| 2khj_A | 109 | 30S ribosomal protein S1; OB fold, acetylation, ph | 83.71 | |
| 2bx2_L | 517 | Ribonuclease E, RNAse E; RNA-binding, RNA turnover | 83.59 | |
| 3ice_A | 422 | Transcription termination factor RHO; transcriptio | 83.01 | |
| 1q8k_A | 308 | Eukaryotic translation initiation factor 2 subunit | 82.76 | |
| 2qcp_X | 80 | Cation efflux system protein CUSF; silver-binding, | 82.36 | |
| 1y14_B | 171 | B16, RPB7, DNA-directed RNA polymerase II 19 kDa p | 81.99 | |
| 2vb2_X | 88 | Copper protein, cation efflux system protein CUSF; | 81.97 | |
| 2b8k_G | 215 | B16, DNA-directed RNA polymerase II 19 kDa polypep | 81.8 | |
| 2l55_A | 82 | SILB,silver efflux protein, MFP component of the c | 81.75 | |
| 2a19_A | 175 | EIF-2- alpha, eukaryotic translation initiation fa | 80.96 | |
| 2a19_A | 175 | EIF-2- alpha, eukaryotic translation initiation fa | 80.23 | |
| 2vnu_D | 760 | Exosome complex exonuclease RRP44; hydrolase-RNA c | 80.01 |
| >3ulj_A LIN28B, DNA-binding protein; beta barrel, cold shock domain fold, nucleic acid binding, D binding protein; 1.06A {Silurana} PDB: 4a4i_A | Back alignment and structure |
|---|
Probab=99.93 E-value=6.6e-26 Score=158.68 Aligned_cols=78 Identities=40% Similarity=0.667 Sum_probs=71.7
Q ss_pred ceeeeeeEEEeecCCCceeEE-------eCCCCCcEEEeccchhccCcccccccCCCCCEEEEEEEEcCCCceeEEeecC
Q psy9900 107 VHTVRGIVKFYDSKRGFGFIT-------RLDNKEDIFVHKSSIVKMNPKKFFQSLGLGEIVDFNIGVGKKDIEAINVTGP 179 (191)
Q Consensus 107 ~~~~~G~Vk~~~~~kgfGFI~-------~~d~~~dvF~h~s~~~~~~~~~~~~~l~~G~~V~f~i~~~~kg~~A~~V~~~ 179 (191)
..+.+|+|||||..||||||+ ++++++|||||+|+|... +++.|.+|++|+|++.+++||++|++|+.+
T Consensus 6 ~~r~tG~VKWFn~~KGfGFI~~~~~~~~p~dgg~DvFVH~s~i~~~----g~~~L~eG~~V~f~v~~g~kG~~A~~Vtg~ 81 (90)
T 3ulj_A 6 VLRGSGHCKWFNVRMGFGFISMTSREGSPLENPVDVFVHQSKLYME----GFRSLKEGEPVEFTFKKSSKGFESLRVTGP 81 (90)
T ss_dssp CEEEEEEEEEEETTTTEEEEEEEEETTEEEEEEEEEEEEGGGBCCS----SSCCCCTTCEEEEEEEEETTEEEEEEEECG
T ss_pred ccccceEEEEeeCCCCeEEeEecCcCcCCCCCCccEEEEeehhccc----CCCccCCCCEEEEEEEECCCCcEEEEEECC
Confidence 457899999999999999998 456678999999999874 689999999999999999999999999999
Q ss_pred CCCCCCCCC
Q psy9900 180 NGIPVQGAP 188 (191)
Q Consensus 180 ~~~~~~~~~ 188 (191)
+|+|+++++
T Consensus 82 ~G~p~~gse 90 (90)
T 3ulj_A 82 GGNPCLGNE 90 (90)
T ss_dssp GGCCCCCCC
T ss_pred CCccccCCC
Confidence 999999985
|
| >1h95_A CSD, Y-box binding protein; translation factor, transcription factor, OB-fold, 5- stranded anti-parallel beta-barrel, single stranded DNA binding; NMR {Homo sapiens} SCOP: b.40.4.5 | Back alignment and structure |
|---|
| >3ulj_A LIN28B, DNA-binding protein; beta barrel, cold shock domain fold, nucleic acid binding, D binding protein; 1.06A {Silurana} PDB: 4a4i_A | Back alignment and structure |
|---|
| >1h95_A CSD, Y-box binding protein; translation factor, transcription factor, OB-fold, 5- stranded anti-parallel beta-barrel, single stranded DNA binding; NMR {Homo sapiens} SCOP: b.40.4.5 | Back alignment and structure |
|---|
| >3i2z_B RNA chaperone, negative regulator of CSPA transcription; beta barrel, DNA binding protein/transcription, cytoplasm, gene regulation; 1.10A {Salmonella typhimurium} SCOP: b.40.4.5 PDB: 2l15_A 1mjc_A 3mef_A | Back alignment and structure |
|---|
| >3cam_A Cold-shock domain family protein; cold shock protein, chain SWAP, STRU genomics, oxford protein production facility, OPPF, gene RE; 2.60A {Neisseria meningitidis MC58} | Back alignment and structure |
|---|
| >3cam_A Cold-shock domain family protein; cold shock protein, chain SWAP, STRU genomics, oxford protein production facility, OPPF, gene RE; 2.60A {Neisseria meningitidis MC58} | Back alignment and structure |
|---|
| >3i2z_B RNA chaperone, negative regulator of CSPA transcription; beta barrel, DNA binding protein/transcription, cytoplasm, gene regulation; 1.10A {Salmonella typhimurium} SCOP: b.40.4.5 PDB: 2l15_A 1mjc_A 3mef_A | Back alignment and structure |
|---|
| >1c9o_A CSPB, cold-shock protein; beta barrel, homodimer, transcription; 1.17A {Bacillus caldolyticus} SCOP: b.40.4.5 PDB: 2hax_A 1hz9_A 1hzb_A 1i5f_A 1hza_A 1hzc_A 3pf4_A 1csq_A 1nmf_A 1nmg_A 1csp_A 2f52_A 2es2_A 3pf5_A 2i5m_X 2i5l_X | Back alignment and structure |
|---|
| >3a0j_A Cold shock protein; OB-fold, cytoplasm, transcription, structural genomics, NPPSFA; 1.65A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1c9o_A CSPB, cold-shock protein; beta barrel, homodimer, transcription; 1.17A {Bacillus caldolyticus} SCOP: b.40.4.5 PDB: 2hax_A 1hz9_A 1hzb_A 1i5f_A 1hza_A 1hzc_A 3pf4_A 1csq_A 1nmf_A 1nmg_A 1csp_A 2f52_A 2es2_A 3pf5_A 2i5m_X 2i5l_X | Back alignment and structure |
|---|
| >3ts2_A Protein LIN-28 homolog A; microrna biogenesis, protein-RNA complex, PRE-element, CCHC knuckle; HET: GMP; 2.01A {Mus musculus} PDB: 3trz_A* 3ts0_A* | Back alignment and structure |
|---|
| >2kcm_A Cold shock domain family protein; nucleic acid binding protein, beta barrel, structural genomi 2, protein structure initiative; NMR {Shewanella oneidensis} | Back alignment and structure |
|---|
| >3a0j_A Cold shock protein; OB-fold, cytoplasm, transcription, structural genomics, NPPSFA; 1.65A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2kcm_A Cold shock domain family protein; nucleic acid binding protein, beta barrel, structural genomi 2, protein structure initiative; NMR {Shewanella oneidensis} | Back alignment and structure |
|---|
| >1g6p_A Cold shock protein TMCSP; greek-KEY, beta barrel, OB-fold, structural genomics; NMR {Thermotoga maritima} SCOP: b.40.4.5 | Back alignment and structure |
|---|
| >2lss_A Cold shock-like protein; CSD, CSP, oligonucleotide binding F fold, RNA binding protein, DNA binding protein; NMR {Rickettsia rickettsii} | Back alignment and structure |
|---|
| >1g6p_A Cold shock protein TMCSP; greek-KEY, beta barrel, OB-fold, structural genomics; NMR {Thermotoga maritima} SCOP: b.40.4.5 | Back alignment and structure |
|---|
| >2k5n_A Putative cold-shock protein; GFT protein structure, PSI, nesgc, OB fold, cold shock structural genomics; NMR {Pectobacterium atrosepticum} | Back alignment and structure |
|---|
| >2k5n_A Putative cold-shock protein; GFT protein structure, PSI, nesgc, OB fold, cold shock structural genomics; NMR {Pectobacterium atrosepticum} | Back alignment and structure |
|---|
| >2lss_A Cold shock-like protein; CSD, CSP, oligonucleotide binding F fold, RNA binding protein, DNA binding protein; NMR {Rickettsia rickettsii} | Back alignment and structure |
|---|
| >3ts2_A Protein LIN-28 homolog A; microrna biogenesis, protein-RNA complex, PRE-element, CCHC knuckle; HET: GMP; 2.01A {Mus musculus} PDB: 3trz_A* 3ts0_A* | Back alignment and structure |
|---|
| >1wfq_A UNR protein; beta-barrel, translational regulation, RNA chaperone, RNA/DN binding, QB fold, greek-KEY topology, structur genomics; NMR {Homo sapiens} SCOP: b.40.4.5 | Back alignment and structure |
|---|
| >1wfq_A UNR protein; beta-barrel, translational regulation, RNA chaperone, RNA/DN binding, QB fold, greek-KEY topology, structur genomics; NMR {Homo sapiens} SCOP: b.40.4.5 | Back alignment and structure |
|---|
| >2yty_A Cold shock domain-containing protein E1; cell-free protein synthesis, beta-barrel, translational REGU RNA chaperone, RNA/DNA binding, QB fold; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3aqq_A Calcium-regulated heat stable protein 1; compact beta-barrel, cold shock domain, ssDNA binding, DNA B protein; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3aqq_A Calcium-regulated heat stable protein 1; compact beta-barrel, cold shock domain, ssDNA binding, DNA B protein; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2ytx_A Cold shock domain-containing protein E1; cell-free protein synthesis, beta-barrel, translational REGU RNA chaperone, RNA/DNA binding, QB fold; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yty_A Cold shock domain-containing protein E1; cell-free protein synthesis, beta-barrel, translational REGU RNA chaperone, RNA/DNA binding, QB fold; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x65_A UNR protein; cell-free protein synthesis, beta-barrel, translational REGU RNA chaperone, RNA/DNA binding, QB fold, greek-KEY topology protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ytx_A Cold shock domain-containing protein E1; cell-free protein synthesis, beta-barrel, translational REGU RNA chaperone, RNA/DNA binding, QB fold; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x65_A UNR protein; cell-free protein synthesis, beta-barrel, translational REGU RNA chaperone, RNA/DNA binding, QB fold, greek-KEY topology protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ytv_A Cold shock domain-containing protein E1; cell-free protein synthesis, beta-barrel, translational REGU RNA chaperone, RNA/DNA binding, QB fold; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ytv_A Cold shock domain-containing protein E1; cell-free protein synthesis, beta-barrel, translational REGU RNA chaperone, RNA/DNA binding, QB fold; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2bh8_A 1B11; transcription, molecular evolution, unique architecture, transcription regulation, phosphorylation; 1.9A {Escherichia coli} | Back alignment and structure |
|---|
| >2bh8_A 1B11; transcription, molecular evolution, unique architecture, transcription regulation, phosphorylation; 1.9A {Escherichia coli} | Back alignment and structure |
|---|
| >2id0_A Exoribonuclease 2; RNAse, exonuclease, hydrolyase, mRNA decay, RNR family, hydrolase; 2.35A {Escherichia coli} SCOP: b.40.4.5 b.40.4.5 b.40.4.5 b.40.4.16 PDB: 2ix0_A* 2ix1_A | Back alignment and structure |
|---|
| >3go5_A Multidomain protein with S1 RNA-binding domains; structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.40A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >3go5_A Multidomain protein with S1 RNA-binding domains; structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.40A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >1a62_A RHO; transcription termination, termination, RNA binding domain, transcription regulation, OB fold, F1-ATPase; 1.55A {Escherichia coli BL21} SCOP: a.140.3.1 b.40.4.5 PDB: 1a63_A 2a8v_A 1a8v_A | Back alignment and structure |
|---|
| >2vnu_D Exosome complex exonuclease RRP44; hydrolase-RNA complex, RNA degradation, RNA-binding, RNA Pro; HET: 1PE; 2.30A {Saccharomyces cerevisiae} SCOP: b.40.4.5 b.40.4.5 b.40.4.5 b.40.4.16 | Back alignment and structure |
|---|
| >1a62_A RHO; transcription termination, termination, RNA binding domain, transcription regulation, OB fold, F1-ATPase; 1.55A {Escherichia coli BL21} SCOP: a.140.3.1 b.40.4.5 PDB: 1a63_A 2a8v_A 1a8v_A | Back alignment and structure |
|---|
| >2wp8_J Exosome complex exonuclease DIS3; nucleus, hydrolase, RNA-binding, exonucle binding, mitochondrion, rRNA processing; 3.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2id0_A Exoribonuclease 2; RNAse, exonuclease, hydrolyase, mRNA decay, RNR family, hydrolase; 2.35A {Escherichia coli} SCOP: b.40.4.5 b.40.4.5 b.40.4.5 b.40.4.16 PDB: 2ix0_A* 2ix1_A | Back alignment and structure |
|---|
| >3l0o_A Transcription termination factor RHO; helicase, RHO factor, RNA capture mechanism, ATP-binding, hydrolase, nucleotide-binding, RN binding; 2.35A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2k52_A Uncharacterized protein MJ1198; metal-binding, zinc, zinc-finger, structural genomics, PSI-2, protein structure initiative; NMR {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >2cqo_A Nucleolar protein of 40 kDa; S1 domain, OB-fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2k52_A Uncharacterized protein MJ1198; metal-binding, zinc, zinc-finger, structural genomics, PSI-2, protein structure initiative; NMR {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >2eqs_A ATP-dependent RNA helicase DHX8; S1 domain, OB-fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2khi_A 30S ribosomal protein S1; acetylation, phosphoprotein, ribonucleoprotein, RNA-binding; NMR {Escherichia coli} | Back alignment and structure |
|---|
| >2k4k_A GSP13, general stress protein 13; cytoplasm, stress response, RNA binding protein; NMR {Bacillus subtilis} | Back alignment and structure |
|---|
| >3l0o_A Transcription termination factor RHO; helicase, RHO factor, RNA capture mechanism, ATP-binding, hydrolase, nucleotide-binding, RN binding; 2.35A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2khi_A 30S ribosomal protein S1; acetylation, phosphoprotein, ribonucleoprotein, RNA-binding; NMR {Escherichia coli} | Back alignment and structure |
|---|
| >2bx2_L Ribonuclease E, RNAse E; RNA-binding, RNA turnover, RNA processing, hydrolase, endonu nuclease; 2.85A {Escherichia coli} PDB: 2c0b_L 2c4r_L 2vmk_A 2vrt_A 1slj_A 1smx_A 1sn8_A | Back alignment and structure |
|---|
| >2k4k_A GSP13, general stress protein 13; cytoplasm, stress response, RNA binding protein; NMR {Bacillus subtilis} | Back alignment and structure |
|---|
| >2khj_A 30S ribosomal protein S1; OB fold, acetylation, phosphoprotein, ribonucleoprotein, RNA-binding; NMR {Escherichia coli} | Back alignment and structure |
|---|
| >3ice_A Transcription termination factor RHO; transcription, ATPase, hexamer, helicase, RNA, RECA, OB fold ATP-binding, hydrolase; HET: MSE ADP SPD; 2.80A {Escherichia coli k-12} PDB: 1pv4_A 1pvo_A* 1xpo_A* 1xpr_A* 1xpu_A* 2ht1_A | Back alignment and structure |
|---|
| >2b8k_G B16, DNA-directed RNA polymerase II 19 kDa polypeptide; DNA-dependent RNA polymerase, cellular RNA polymerase; 4.15A {Saccharomyces cerevisiae} SCOP: b.40.4.5 d.230.1.1 | Back alignment and structure |
|---|
| >2eqs_A ATP-dependent RNA helicase DHX8; S1 domain, OB-fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cqo_A Nucleolar protein of 40 kDa; S1 domain, OB-fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1y14_B B16, RPB7, DNA-directed RNA polymerase II 19 kDa polypeptide; transferase; 2.30A {Saccharomyces cerevisiae} SCOP: b.40.4.5 d.230.1.1 PDB: 1nt9_G 1wcm_G 1pqv_G 1y1v_G 1y1w_G 1y1y_G 1y77_G* 2b63_G* 2ja5_G* 2ja6_G* 2ja7_G* 2ja8_G* 2r7z_G 2r92_G 2r93_G 2vum_G* 3fki_G 3h3v_H 3hou_G* 3hov_G* ... | Back alignment and structure |
|---|
| >2khj_A 30S ribosomal protein S1; OB fold, acetylation, phosphoprotein, ribonucleoprotein, RNA-binding; NMR {Escherichia coli} | Back alignment and structure |
|---|
| >2bx2_L Ribonuclease E, RNAse E; RNA-binding, RNA turnover, RNA processing, hydrolase, endonu nuclease; 2.85A {Escherichia coli} PDB: 2c0b_L 2c4r_L 2vmk_A 2vrt_A 1slj_A 1smx_A 1sn8_A | Back alignment and structure |
|---|
| >3ice_A Transcription termination factor RHO; transcription, ATPase, hexamer, helicase, RNA, RECA, OB fold ATP-binding, hydrolase; HET: MSE ADP SPD; 2.80A {Escherichia coli k-12} PDB: 1pv4_A 1pvo_A* 1xpo_A* 1xpr_A* 1xpu_A* 2ht1_A | Back alignment and structure |
|---|
| >1q8k_A Eukaryotic translation initiation factor 2 subunit 1; NMR {Homo sapiens} SCOP: a.60.14.1 b.40.4.5 d.58.51.1 | Back alignment and structure |
|---|
| >2qcp_X Cation efflux system protein CUSF; silver-binding, copper-binding, beta barrel, OB-fold, metall metal resistance, metal-binding; 1.00A {Escherichia coli str} PDB: 1zeq_X 3e6z_X | Back alignment and structure |
|---|
| >1y14_B B16, RPB7, DNA-directed RNA polymerase II 19 kDa polypeptide; transferase; 2.30A {Saccharomyces cerevisiae} SCOP: b.40.4.5 d.230.1.1 PDB: 1nt9_G 1wcm_G 1pqv_G 1y1v_G 1y1w_G 1y1y_G 1y77_G* 2b63_G* 2ja5_G* 2ja6_G* 2ja7_G* 2ja8_G* 2r7z_G 2r92_G 2r93_G 2vum_G* 3fki_G 3h3v_H 3hou_G* 3hov_G* ... | Back alignment and structure |
|---|
| >2vb2_X Copper protein, cation efflux system protein CUSF; cation PI, metal-binding, metal transport, copper tolerance, transport; 1.70A {Escherichia coli} PDB: 2vb3_X | Back alignment and structure |
|---|
| >2b8k_G B16, DNA-directed RNA polymerase II 19 kDa polypeptide; DNA-dependent RNA polymerase, cellular RNA polymerase; 4.15A {Saccharomyces cerevisiae} SCOP: b.40.4.5 d.230.1.1 | Back alignment and structure |
|---|
| >2l55_A SILB,silver efflux protein, MFP component of the components proton antiporter metal...; APO form, AG(I)-binding site; NMR {Cupriavidus metallidurans} | Back alignment and structure |
|---|
| >2a19_A EIF-2- alpha, eukaryotic translation initiation factor 2 alpha; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Saccharomyces cerevisiae} PDB: 2a1a_A* 1q46_A | Back alignment and structure |
|---|
| >2a19_A EIF-2- alpha, eukaryotic translation initiation factor 2 alpha; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Saccharomyces cerevisiae} PDB: 2a1a_A* 1q46_A | Back alignment and structure |
|---|
| >2vnu_D Exosome complex exonuclease RRP44; hydrolase-RNA complex, RNA degradation, RNA-binding, RNA Pro; HET: 1PE; 2.30A {Saccharomyces cerevisiae} SCOP: b.40.4.5 b.40.4.5 b.40.4.5 b.40.4.16 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 191 | ||||
| d1h95a_ | 79 | b.40.4.5 (A:) Y-box protein 1 cold shock domain (Y | 4e-20 | |
| d1h95a_ | 79 | b.40.4.5 (A:) Y-box protein 1 cold shock domain (Y | 6e-20 | |
| d1mjca_ | 69 | b.40.4.5 (A:) Major cold shock protein {Escherichi | 2e-14 | |
| d1mjca_ | 69 | b.40.4.5 (A:) Major cold shock protein {Escherichi | 2e-14 | |
| d1c9oa_ | 66 | b.40.4.5 (A:) Major cold shock protein {Bacillus c | 1e-11 | |
| d1c9oa_ | 66 | b.40.4.5 (A:) Major cold shock protein {Bacillus c | 1e-11 | |
| d1g6pa_ | 66 | b.40.4.5 (A:) Major cold shock protein {Thermotoga | 1e-11 | |
| d1g6pa_ | 66 | b.40.4.5 (A:) Major cold shock protein {Thermotoga | 1e-11 | |
| d1wfqa_ | 89 | b.40.4.5 (A:) Cold shock domain protein E1 (UNR) { | 8e-08 | |
| d1wfqa_ | 89 | b.40.4.5 (A:) Cold shock domain protein E1 (UNR) { | 8e-08 |
| >d1h95a_ b.40.4.5 (A:) Y-box protein 1 cold shock domain (YB1-CSD) {Human (Homo sapiens) [TaxId: 9606]} Length = 79 | Back information, alignment and structure |
|---|
class: All beta proteins fold: OB-fold superfamily: Nucleic acid-binding proteins family: Cold shock DNA-binding domain-like domain: Y-box protein 1 cold shock domain (YB1-CSD) species: Human (Homo sapiens) [TaxId: 9606]
Score = 77.9 bits (192), Expect = 4e-20
Identities = 38/78 (48%), Positives = 55/78 (70%)
Query: 1 MTKFEIHTVRGIVKFYDSKRGFGFITRLDNKEDIFVHKSSIVKMNPKKFFQSLGLGEIVD 60
M K V G VK+++ + G+GFI R D KED+FVH+++I K NP+K+ +S+G GE V+
Sbjct: 1 MKKVIATKVLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVE 60
Query: 61 FNIGVGKKDIEAINVTGP 78
F++ G+K EA NVTGP
Sbjct: 61 FDVVEGEKGAEAANVTGP 78
|
| >d1h95a_ b.40.4.5 (A:) Y-box protein 1 cold shock domain (YB1-CSD) {Human (Homo sapiens) [TaxId: 9606]} Length = 79 | Back information, alignment and structure |
|---|
| >d1mjca_ b.40.4.5 (A:) Major cold shock protein {Escherichia coli [TaxId: 562]} Length = 69 | Back information, alignment and structure |
|---|
| >d1mjca_ b.40.4.5 (A:) Major cold shock protein {Escherichia coli [TaxId: 562]} Length = 69 | Back information, alignment and structure |
|---|
| >d1c9oa_ b.40.4.5 (A:) Major cold shock protein {Bacillus caldolyticus [TaxId: 1394]} Length = 66 | Back information, alignment and structure |
|---|
| >d1c9oa_ b.40.4.5 (A:) Major cold shock protein {Bacillus caldolyticus [TaxId: 1394]} Length = 66 | Back information, alignment and structure |
|---|
| >d1g6pa_ b.40.4.5 (A:) Major cold shock protein {Thermotoga maritima [TaxId: 2336]} Length = 66 | Back information, alignment and structure |
|---|
| >d1g6pa_ b.40.4.5 (A:) Major cold shock protein {Thermotoga maritima [TaxId: 2336]} Length = 66 | Back information, alignment and structure |
|---|
| >d1wfqa_ b.40.4.5 (A:) Cold shock domain protein E1 (UNR) {Human (Homo sapiens) [TaxId: 9606]} Length = 89 | Back information, alignment and structure |
|---|
| >d1wfqa_ b.40.4.5 (A:) Cold shock domain protein E1 (UNR) {Human (Homo sapiens) [TaxId: 9606]} Length = 89 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 191 | |||
| d1h95a_ | 79 | Y-box protein 1 cold shock domain (YB1-CSD) {Human | 99.92 | |
| d1h95a_ | 79 | Y-box protein 1 cold shock domain (YB1-CSD) {Human | 99.91 | |
| d1mjca_ | 69 | Major cold shock protein {Escherichia coli [TaxId: | 99.9 | |
| d1mjca_ | 69 | Major cold shock protein {Escherichia coli [TaxId: | 99.9 | |
| d1c9oa_ | 66 | Major cold shock protein {Bacillus caldolyticus [T | 99.87 | |
| d1g6pa_ | 66 | Major cold shock protein {Thermotoga maritima [Tax | 99.87 | |
| d1g6pa_ | 66 | Major cold shock protein {Thermotoga maritima [Tax | 99.86 | |
| d1c9oa_ | 66 | Major cold shock protein {Bacillus caldolyticus [T | 99.86 | |
| d1wfqa_ | 89 | Cold shock domain protein E1 (UNR) {Human (Homo sa | 99.68 | |
| d1wfqa_ | 89 | Cold shock domain protein E1 (UNR) {Human (Homo sa | 99.67 | |
| d2ix0a2 | 79 | Exoribonuclease 2, RNB {Escherichia coli [TaxId: 5 | 98.14 | |
| d2ix0a2 | 79 | Exoribonuclease 2, RNB {Escherichia coli [TaxId: 5 | 98.03 | |
| d1a62a2 | 78 | Rho termination factor, RNA-binding domain {Escher | 97.0 | |
| d1a62a2 | 78 | Rho termination factor, RNA-binding domain {Escher | 96.75 | |
| d2ix0a1 | 90 | Exoribonuclease 2, RNB {Escherichia coli [TaxId: 5 | 96.55 | |
| d1sroa_ | 76 | S1 RNA-binding domain of polyribonucleotide phosph | 92.62 | |
| d1kl9a2 | 86 | Eukaryotic initiation factor 2alpha, eIF2alpha, N- | 92.15 | |
| d1smxa_ | 87 | S1-domain of Ribonuclease E {Escherichia coli [Tax | 91.67 | |
| d1kl9a2 | 86 | Eukaryotic initiation factor 2alpha, eIF2alpha, N- | 91.55 | |
| d1sroa_ | 76 | S1 RNA-binding domain of polyribonucleotide phosph | 90.83 | |
| d2ix0a1 | 90 | Exoribonuclease 2, RNB {Escherichia coli [TaxId: 5 | 90.29 | |
| d2ba0a1 | 83 | S1-domain of exosome complex RNA-binding protein 1 | 89.61 | |
| d3bzka4 | 94 | Tex S1-domain {Pseudomonas aeruginosa [TaxId: 287] | 88.87 | |
| d2ahob2 | 84 | Eukaryotic initiation factor 2alpha, eIF2alpha, N- | 88.47 | |
| d1wi5a_ | 119 | S1-domain of RRP5 protein homolog (PDCD11, KIAA018 | 86.34 | |
| d3bzka4 | 94 | Tex S1-domain {Pseudomonas aeruginosa [TaxId: 287] | 85.23 | |
| d1go3e1 | 106 | C-terminal domain of RNA polymerase II subunit RBP | 84.15 | |
| d1smxa_ | 87 | S1-domain of Ribonuclease E {Escherichia coli [Tax | 83.84 | |
| d2ba0a1 | 83 | S1-domain of exosome complex RNA-binding protein 1 | 83.44 | |
| d2je6i1 | 87 | S1-domain of exosome complex RNA-binding protein 1 | 82.05 | |
| d1u0la1 | 66 | Probable GTPase EngC (YjeQ), N-terminal domain {Th | 81.71 | |
| d2ahob2 | 84 | Eukaryotic initiation factor 2alpha, eIF2alpha, N- | 80.1 | |
| d1go3e1 | 106 | C-terminal domain of RNA polymerase II subunit RBP | 80.09 |
| >d1h95a_ b.40.4.5 (A:) Y-box protein 1 cold shock domain (YB1-CSD) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: All beta proteins fold: OB-fold superfamily: Nucleic acid-binding proteins family: Cold shock DNA-binding domain-like domain: Y-box protein 1 cold shock domain (YB1-CSD) species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.92 E-value=5.4e-26 Score=154.13 Aligned_cols=78 Identities=49% Similarity=0.856 Sum_probs=71.5
Q ss_pred CceeceeccceEEEEeeCCCCeeEEEeCCCCccEEEEeeeheecCCCCCcccCCCCCEEEEEEEEcCCCceeeEeecC
Q psy9900 1 MTKFEIHTVRGIVKFYDSKRGFGFITRLDNKEDIFVHKSSIVKMNPKKFFQSLGLGEIVDFNIGVGKKDIEAINVTGP 78 (191)
Q Consensus 1 ~~~~~~~~~~G~vk~~~~~kGfGFI~~~~~~~dvFvh~s~l~~~~~~~g~~~l~~Gd~V~f~~~~~~~g~~A~~v~~~ 78 (191)
|.++|+.+.+|+|||||..||||||.++++++|||||+|+|........++.|.+|++|+|++..+++|++|.+|+.|
T Consensus 1 ~~k~~~~r~~G~VKwfn~~KGfGFI~~ddg~~DvFvH~s~i~~~g~~~~~~~L~~G~~V~f~~~~~~~G~~A~~Vtgp 78 (79)
T d1h95a_ 1 MKKVIATKVLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGP 78 (79)
T ss_dssp CCSCCEEEEEEEEEEEETTTTEEEEEEGGGTEEEEEEGGGBCSCCCSCCSCSCCSSCEEEEEEEECSSSEEEESBCCC
T ss_pred CchHhcCcccEEEEEEcCCCCeEEEEECCCCccEEEEhhHcccCCCcceeeecCCCCEEEEEEEeCCCCCeeEEEeCC
Confidence 899999999999999999999999999998899999999998763333478899999999999999999999999875
|
| >d1h95a_ b.40.4.5 (A:) Y-box protein 1 cold shock domain (YB1-CSD) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mjca_ b.40.4.5 (A:) Major cold shock protein {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1mjca_ b.40.4.5 (A:) Major cold shock protein {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1c9oa_ b.40.4.5 (A:) Major cold shock protein {Bacillus caldolyticus [TaxId: 1394]} | Back information, alignment and structure |
|---|
| >d1g6pa_ b.40.4.5 (A:) Major cold shock protein {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1g6pa_ b.40.4.5 (A:) Major cold shock protein {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1c9oa_ b.40.4.5 (A:) Major cold shock protein {Bacillus caldolyticus [TaxId: 1394]} | Back information, alignment and structure |
|---|
| >d1wfqa_ b.40.4.5 (A:) Cold shock domain protein E1 (UNR) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wfqa_ b.40.4.5 (A:) Cold shock domain protein E1 (UNR) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ix0a2 b.40.4.5 (A:4-82) Exoribonuclease 2, RNB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2ix0a2 b.40.4.5 (A:4-82) Exoribonuclease 2, RNB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1a62a2 b.40.4.5 (A:48-125) Rho termination factor, RNA-binding domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1a62a2 b.40.4.5 (A:48-125) Rho termination factor, RNA-binding domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2ix0a1 b.40.4.5 (A:83-172) Exoribonuclease 2, RNB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1sroa_ b.40.4.5 (A:) S1 RNA-binding domain of polyribonucleotide phosphorylase, PNPase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1kl9a2 b.40.4.5 (A:3-88) Eukaryotic initiation factor 2alpha, eIF2alpha, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1smxa_ b.40.4.5 (A:) S1-domain of Ribonuclease E {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1kl9a2 b.40.4.5 (A:3-88) Eukaryotic initiation factor 2alpha, eIF2alpha, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sroa_ b.40.4.5 (A:) S1 RNA-binding domain of polyribonucleotide phosphorylase, PNPase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2ix0a1 b.40.4.5 (A:83-172) Exoribonuclease 2, RNB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2ba0a1 b.40.4.5 (A:53-135) S1-domain of exosome complex RNA-binding protein 1, ECR1 {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d3bzka4 b.40.4.5 (A:637-730) Tex S1-domain {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d2ahob2 b.40.4.5 (B:1-84) Eukaryotic initiation factor 2alpha, eIF2alpha, N-terminal domain {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1wi5a_ b.40.4.5 (A:) S1-domain of RRP5 protein homolog (PDCD11, KIAA0185) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3bzka4 b.40.4.5 (A:637-730) Tex S1-domain {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1go3e1 b.40.4.5 (E:79-184) C-terminal domain of RNA polymerase II subunit RBP7 (RpoE) {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1smxa_ b.40.4.5 (A:) S1-domain of Ribonuclease E {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2ba0a1 b.40.4.5 (A:53-135) S1-domain of exosome complex RNA-binding protein 1, ECR1 {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d2je6i1 b.40.4.5 (I:66-152) S1-domain of exosome complex RNA-binding protein 1, ECR1 {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1u0la1 b.40.4.5 (A:3-68) Probable GTPase EngC (YjeQ), N-terminal domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2ahob2 b.40.4.5 (B:1-84) Eukaryotic initiation factor 2alpha, eIF2alpha, N-terminal domain {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1go3e1 b.40.4.5 (E:79-184) C-terminal domain of RNA polymerase II subunit RBP7 (RpoE) {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|