Psyllid ID: psy9900


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-
MTKFEIHTVRGIVKFYDSKRGFGFITRLDNKEDIFVHKSSIVKMNPKKFFQSLGLGEIVDFNIGVGKKDIEAINVTGPNGIPVQGAPKSSSETVSGTYRNDSFFPAVHTVRGIVKFYDSKRGFGFITRLDNKEDIFVHKSSIVKMNPKKFFQSLGLGEIVDFNIGVGKKDIEAINVTGPNGIPVQGAPKVP
cccccEEEEEEEEEEEEccccEEEEEcccccccEEEEcEEEEcccccccccccccccEEEEEEEEccccccEEEEccccccccccccccccccccccccccccccccccccEEEEEEEccccEEEEEcccccccEEEEcEEEEEccccccccccccccEEEEEEEEccccccEEEEEcccccccccccccc
ccEEEEEEEEEEEEEEEccccEEEEEEccccccEEEEHHHEEccccccEEEEcccccEEEEEEEEcccccEEEEEccccccccccccccccccccccccccccccEEEEEEEEEEEEEccccEEEEEEccccccEEEEHHHEHHcccHHHHEEcccccEEEEEEEccccccEHEEEccccccccccccccc
mtkfeihtVRGIVkfydskrgfgfitrldnkedifvhkssivkmnpkkffqslglgeivdfnigvgkkdieainvtgpngipvqgapksssetvsgtyrndsffpavHTVRGIVkfydskrgfgfitrldnkedifvhkssivkmnpkkffqslglgeivdfnigvgkkdieainvtgpngipvqgapkvp
mtkfeihtvrgivkfydskrgfgFITRLDNKEDIFVHKSSIVKMNPKKFFQSLGLGEIVDFNIGVGKKDIEAINVTgpngipvqgapkssSETVSGTYRndsffpavhtvRGIVKFYDSKRGFGFITRLDNKEDIFVHKSSIVKMNPKKFFQSLGLGEIVDFNIGVGKKDIEAInvtgpngipvqgapkvp
MTKFEIHTVRGIVKFYDSKRGFGFITRLDNKEDIFVHKSSIVKMNPKKFFQSLGLGEIVDFNIGVGKKDIEAINVTGPNGIPVQGAPKSSSETVSGTYRNDSFFPAVHTVRGIVKFYDSKRGFGFITRLDNKEDIFVHKSSIVKMNPKKFFQSLGLGEIVDFNIGVGKKDIEAINVTGPNGIPVQGAPKVP
****************************************IVKMNPKKFFQSLGLGEIVDFNIGVGKKDIEAINVTGPN*****************TYRNDSFFPAVHTVRGIVKFYDSKRGFGFI***************IVKMNPKKFFQSLGLGEIVDFNIGVGKKDIEAINVTG*************
*********RGIVKFYDSKRGFGFITRLDNKEDIFVHKSSIVKMNPKKFFQSLGLGEIVDFNIGVGKKDIEAINVTGPNGIPVQGAPKSSSETVSGTYRNDSFFPAVHTVRGIVKFYDSKRGFGFITRLDNKEDIFVHKSSIVKMNPKKFFQSLGLGEIVDFNIGVGKKDIEAINVTGPNGIPVQ******
MTKFEIHTVRGIVKFYDSKRGFGFITRLDNKEDIFVHKSSIVKMNPKKFFQSLGLGEIVDFNIGVGKKDIEAINVTGPNGIPV************GTYRNDSFFPAVHTVRGIVKFYDSKRGFGFITRLDNKEDIFVHKSSIVKMNPKKFFQSLGLGEIVDFNIGVGKKDIEAINVTGPNGIPVQGAPKVP
MTKFEIHTVRGIVKFYDSKRGFGFITRLDNKEDIFVHKSSIVKMNPKKFFQSLGLGEIVDFNIGVGKKDIEAINVTGPN***********************FFPAVHTVRGIVKFYDSKRGFGFITRLDNKEDIFVHKSSIVKMNPKKFFQSLGLGEIVDFNIGVGKKDIEAINVTGPNG**********
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTKFEIHTVRGIVKFYDSKRGFGFITRLDNKEDIFVHKSSIVKMNPKKFFQSLGLGEIVDFNIGVGKKDIEAINVTGPNGIPVQGAPKSSSETVSGTYRNDSFFPAVHTVRGIVKFYDSKRGFGFITRLDNKEDIFVHKSSIVKMNPKKFFQSLGLGEIVDFNIGVGKKDIEAINVTGPNGIPVQGAPKVP
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query191 2.2.26 [Sep-21-2011]
P45441324 Y-box-binding protein 2-B N/A N/A 0.408 0.240 0.525 2e-19
P21574 336 Y-box-binding protein 2-A N/A N/A 0.408 0.232 0.525 2e-19
P21573303 Nuclease-sensitive elemen N/A N/A 0.408 0.257 0.525 3e-19
Q28618324 Nuclease-sensitive elemen no N/A 0.408 0.240 0.525 4e-19
P62961322 Nuclease-sensitive elemen yes N/A 0.408 0.242 0.525 5e-19
P62960322 Nuclease-sensitive elemen yes N/A 0.408 0.242 0.525 5e-19
P67809324 Nuclease-sensitive elemen yes N/A 0.408 0.240 0.525 5e-19
P67808324 Nuclease-sensitive elemen yes N/A 0.408 0.240 0.525 5e-19
Q06066321 Nuclease-sensitive elemen yes N/A 0.408 0.242 0.525 6e-19
Q62764361 DNA-binding protein A OS= no N/A 0.408 0.216 0.512 1e-18
>sp|P45441|YBX2B_XENLA Y-box-binding protein 2-B OS=Xenopus laevis GN=ybx2-b PE=1 SV=2 Back     alignment and function desciption
 Score = 95.1 bits (235), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 41/78 (52%), Positives = 62/78 (79%)

Query: 9   VRGIVKFYDSKRGFGFITRLDNKEDIFVHKSSIVKMNPKKFFQSLGLGEIVDFNIGVGKK 68
           V+G VK+++ + G+GFI R D+KED+FVH+++I K NP+KF +S+G GE V+F++  G+K
Sbjct: 42  VQGTVKWFNVRNGYGFINRNDSKEDVFVHQTAIKKNNPRKFLRSVGDGETVEFDVVEGEK 101

Query: 69  DIEAINVTGPNGIPVQGA 86
             EA NVTGP G+PV+G+
Sbjct: 102 GAEAANVTGPGGVPVKGS 119




Putative translation regulator. May be involved in the developmental translational regulation of maternal mRNAs.
Xenopus laevis (taxid: 8355)
>sp|P21574|YBX2A_XENLA Y-box-binding protein 2-A OS=Xenopus laevis GN=ybx2-a PE=1 SV=3 Back     alignment and function description
>sp|P21573|YBOX1_XENLA Nuclease-sensitive element-binding protein 1 OS=Xenopus laevis GN=ybx1 PE=2 SV=1 Back     alignment and function description
>sp|Q28618|YBOX1_RABIT Nuclease-sensitive element-binding protein 1 OS=Oryctolagus cuniculus GN=YBX1 PE=1 SV=3 Back     alignment and function description
>sp|P62961|YBOX1_RAT Nuclease-sensitive element-binding protein 1 OS=Rattus norvegicus GN=Ybx1 PE=1 SV=3 Back     alignment and function description
>sp|P62960|YBOX1_MOUSE Nuclease-sensitive element-binding protein 1 OS=Mus musculus GN=Ybx1 PE=1 SV=3 Back     alignment and function description
>sp|P67809|YBOX1_HUMAN Nuclease-sensitive element-binding protein 1 OS=Homo sapiens GN=YBX1 PE=1 SV=3 Back     alignment and function description
>sp|P67808|YBOX1_BOVIN Nuclease-sensitive element-binding protein 1 OS=Bos taurus GN=YBX1 PE=2 SV=3 Back     alignment and function description
>sp|Q06066|YBOX1_CHICK Nuclease-sensitive element-binding protein 1 OS=Gallus gallus GN=YBX1 PE=2 SV=1 Back     alignment and function description
>sp|Q62764|DBPA_RAT DNA-binding protein A OS=Rattus norvegicus GN=Csda PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query191
15638522698 predicted protein [Nematostella vectensi 0.465 0.908 0.550 4e-20
91081961 297 PREDICTED: similar to Y-box binding prot 0.413 0.265 0.594 3e-19
91081963286 PREDICTED: similar to Y-box binding prot 0.413 0.276 0.594 5e-19
391342360 309 PREDICTED: uncharacterized protein LOC10 0.434 0.268 0.554 7e-19
22901742 317 Y-box protein Ct-p50 [Chironomus tentans 0.413 0.249 0.569 1e-18
22901740264 Y-box protein Ct-p40 [Chironomus tentans 0.413 0.299 0.569 1e-18
30089118280 Y1 protein [Dugesia etrusca] 0.502 0.342 0.494 2e-18
342837647 378 TPA_inf: Y box protein 4-like protein [S 0.502 0.253 0.494 2e-18
242008099288 Nuclease sensitive element-binding prote 0.429 0.284 0.560 2e-18
383849814278 PREDICTED: uncharacterized protein LOC10 0.554 0.381 0.433 3e-18
>gi|156385226|ref|XP_001633532.1| predicted protein [Nematostella vectensis] gi|156220603|gb|EDO41469.1| predicted protein [Nematostella vectensis] Back     alignment and taxonomy information
 Score =  103 bits (256), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 49/89 (55%), Positives = 65/89 (73%)

Query: 103 FFPAVHTVRGIVKFYDSKRGFGFITRLDNKEDIFVHKSSIVKMNPKKFFQSLGLGEIVDF 162
            F A   V G VK+++ K G+GFI R DNKEDIFVH+++I K NPKK+ +S+G GE+V+F
Sbjct: 1   MFIAATKVTGTVKWFNVKNGYGFINRDDNKEDIFVHQTAIAKNNPKKYLRSVGDGEVVEF 60

Query: 163 NIGVGKKDIEAINVTGPNGIPVQGAPKVP 191
           N+  G K +EA NVTGP+G PVQG+   P
Sbjct: 61  NVVSGTKGLEASNVTGPDGEPVQGSKYAP 89




Source: Nematostella vectensis

Species: Nematostella vectensis

Genus: Nematostella

Family: Edwardsiidae

Order: Actiniaria

Class: Anthozoa

Phylum: Cnidaria

Superkingdom: Eukaryota

>gi|91081961|ref|XP_966594.1| PREDICTED: similar to Y-box binding protein isoform 1 [Tribolium castaneum] gi|270007364|gb|EFA03812.1| hypothetical protein TcasGA2_TC013925 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|91081963|ref|XP_975913.1| PREDICTED: similar to Y-box binding protein isoform 2 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|391342360|ref|XP_003745488.1| PREDICTED: uncharacterized protein LOC100904956 [Metaseiulus occidentalis] Back     alignment and taxonomy information
>gi|22901742|gb|AAN10050.1| Y-box protein Ct-p50 [Chironomus tentans] Back     alignment and taxonomy information
>gi|22901740|gb|AAN10049.1| Y-box protein Ct-p40 [Chironomus tentans] Back     alignment and taxonomy information
>gi|30089118|emb|CAD27800.1| Y1 protein [Dugesia etrusca] Back     alignment and taxonomy information
>gi|342837647|tpg|DAA34914.1| TPA_inf: Y box protein 4-like protein [Schmidtea mediterranea] Back     alignment and taxonomy information
>gi|242008099|ref|XP_002424850.1| Nuclease sensitive element-binding protein, putative [Pediculus humanus corporis] gi|212508400|gb|EEB12112.1| Nuclease sensitive element-binding protein, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|383849814|ref|XP_003700531.1| PREDICTED: uncharacterized protein LOC100878915 [Megachile rotundata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query191
UNIPROTKB|F1PB10 370 CSDA "Uncharacterized protein" 0.429 0.221 0.506 5.8e-22
UNIPROTKB|A5D7M4 360 YBX2 "Uncharacterized protein" 0.670 0.355 0.4 2.1e-20
UNIPROTKB|I3LCJ2 360 YBX2 "Uncharacterized protein" 0.670 0.355 0.4 6.5e-20
UNIPROTKB|P21574 336 ybx2-a "Y-box-binding protein 0.591 0.336 0.413 7.2e-20
UNIPROTKB|F1SFU0 365 LOC100736899 "Uncharacterized 0.670 0.350 0.4 7.3e-20
UNIPROTKB|E2RMN5 367 YBX2 "Uncharacterized protein" 0.670 0.348 0.4 7.7e-20
UNIPROTKB|Q9Y2T7 364 YBX2 "Y-box-binding protein 2" 0.602 0.315 0.416 9.5e-20
UNIPROTKB|P45441 324 ybx2-b "Y-box-binding protein 0.429 0.253 0.512 1.2e-19
UNIPROTKB|F1M1Q9277 F1M1Q9 "Uncharacterized protei 0.465 0.321 0.472 1.5e-19
UNIPROTKB|D4A0L4 306 Csda "DNA-binding protein A" [ 0.591 0.369 0.418 1.5e-19
UNIPROTKB|F1PB10 CSDA "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
 Score = 228 (85.3 bits), Expect = 5.8e-22, Sum P(2) = 5.8e-22
 Identities = 42/83 (50%), Positives = 63/83 (75%)

Query:   105 PAVHTVRGIVKFYDSKRGFGFITRLDNKEDIFVHKSSIVKMNPKKFFQSLGLGEIVDFNI 164
             PA   V G VK+++ + G+GFI R D KED+FVH+++I K NP+K+ +S+G GE V+F++
Sbjct:    87 PATK-VLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDV 145

Query:   165 GVGKKDIEAINVTGPNGIPVQGA 187
               G+K  EA NVTGP+G+PV+G+
Sbjct:   146 VEGEKGAEAANVTGPDGVPVEGS 168


GO:0006355 "regulation of transcription, DNA-dependent" evidence=IEA
GO:0003677 "DNA binding" evidence=IEA
UNIPROTKB|A5D7M4 YBX2 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|I3LCJ2 YBX2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|P21574 ybx2-a "Y-box-binding protein 2-A" [Xenopus laevis (taxid:8355)] Back     alignment and assigned GO terms
UNIPROTKB|F1SFU0 LOC100736899 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|E2RMN5 YBX2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q9Y2T7 YBX2 "Y-box-binding protein 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|P45441 ybx2-b "Y-box-binding protein 2-B" [Xenopus laevis (taxid:8355)] Back     alignment and assigned GO terms
UNIPROTKB|F1M1Q9 F1M1Q9 "Uncharacterized protein" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|D4A0L4 Csda "DNA-binding protein A" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q06066YBOX1_CHICKNo assigned EC number0.52560.40830.2429yesN/A
P67809YBOX1_HUMANNo assigned EC number0.52560.40830.2407yesN/A
P67808YBOX1_BOVINNo assigned EC number0.52560.40830.2407yesN/A
P62961YBOX1_RATNo assigned EC number0.52560.40830.2422yesN/A
P62960YBOX1_MOUSENo assigned EC number0.52560.40830.2422yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query191
pfam0031366 pfam00313, CSD, 'Cold-shock' DNA-binding domain 8e-15
pfam0031366 pfam00313, CSD, 'Cold-shock' DNA-binding domain 8e-15
cd0445865 cd04458, CSP_CDS, Cold-Shock Protein (CSP) contain 9e-15
cd0445865 cd04458, CSP_CDS, Cold-Shock Protein (CSP) contain 9e-15
COG127867 COG1278, CspC, Cold shock proteins [Transcription] 3e-10
COG127867 COG1278, CspC, Cold shock proteins [Transcription] 3e-10
PRK1094369 PRK10943, PRK10943, cold shock-like protein CspC; 5e-08
PRK1094369 PRK10943, PRK10943, cold shock-like protein CspC; 5e-08
PRK0950769 PRK09507, cspE, cold shock protein CspE; Reviewed 9e-08
PRK0950769 PRK09507, cspE, cold shock protein CspE; Reviewed 9e-08
PRK1035470 PRK10354, PRK10354, RNA chaperone/anti-terminator; 1e-07
PRK1035470 PRK10354, PRK10354, RNA chaperone/anti-terminator; 1e-07
smart0035764 smart00357, CSP, Cold shock protein domain 2e-07
smart0035764 smart00357, CSP, Cold shock protein domain 2e-07
PRK0989070 PRK09890, PRK09890, cold shock protein CspG; Provi 5e-06
PRK0989070 PRK09890, PRK09890, cold shock protein CspG; Provi 5e-06
TIGR0238168 TIGR02381, cspD, cold shock domain protein CspD 1e-05
TIGR0238168 TIGR02381, cspD, cold shock domain protein CspD 1e-05
PRK1499873 PRK14998, PRK14998, cold shock-like protein CspD; 1e-04
PRK1499873 PRK14998, PRK14998, cold shock-like protein CspD; 1e-04
PRK0993774 PRK09937, PRK09937, stationary phase/starvation in 3e-04
PRK0993774 PRK09937, PRK09937, stationary phase/starvation in 3e-04
PRK1546370 PRK15463, PRK15463, cold shock-like protein CspF; 0.001
PRK1546370 PRK15463, PRK15463, cold shock-like protein CspF; 0.001
>gnl|CDD|201147 pfam00313, CSD, 'Cold-shock' DNA-binding domain Back     alignment and domain information
 Score = 65.7 bits (161), Expect = 8e-15
 Identities = 30/70 (42%), Positives = 44/70 (62%), Gaps = 4/70 (5%)

Query: 9  VRGIVKFYDSKRGFGFITRLDNKEDIFVHKSSIVKMNPKKFFQSLGLGEIVDFNIGVGKK 68
          + G VK++++K+GFGFIT  D  +D+FVH S+I        F+SL  G+ V+F+I  G K
Sbjct: 1  MTGTVKWFNAKKGFGFITPEDGDKDVFVHFSAIQGDG----FRSLQEGQRVEFDIVEGTK 56

Query: 69 DIEAINVTGP 78
            +A NVT  
Sbjct: 57 GPQAANVTLL 66


Length = 66

>gnl|CDD|201147 pfam00313, CSD, 'Cold-shock' DNA-binding domain Back     alignment and domain information
>gnl|CDD|239905 cd04458, CSP_CDS, Cold-Shock Protein (CSP) contains an S1-like cold-shock domain (CSD) that is found in eukaryotes, prokaryotes, and archaea Back     alignment and domain information
>gnl|CDD|239905 cd04458, CSP_CDS, Cold-Shock Protein (CSP) contains an S1-like cold-shock domain (CSD) that is found in eukaryotes, prokaryotes, and archaea Back     alignment and domain information
>gnl|CDD|224197 COG1278, CspC, Cold shock proteins [Transcription] Back     alignment and domain information
>gnl|CDD|224197 COG1278, CspC, Cold shock proteins [Transcription] Back     alignment and domain information
>gnl|CDD|170841 PRK10943, PRK10943, cold shock-like protein CspC; Provisional Back     alignment and domain information
>gnl|CDD|170841 PRK10943, PRK10943, cold shock-like protein CspC; Provisional Back     alignment and domain information
>gnl|CDD|169931 PRK09507, cspE, cold shock protein CspE; Reviewed Back     alignment and domain information
>gnl|CDD|169931 PRK09507, cspE, cold shock protein CspE; Reviewed Back     alignment and domain information
>gnl|CDD|182402 PRK10354, PRK10354, RNA chaperone/anti-terminator; Provisional Back     alignment and domain information
>gnl|CDD|182402 PRK10354, PRK10354, RNA chaperone/anti-terminator; Provisional Back     alignment and domain information
>gnl|CDD|214633 smart00357, CSP, Cold shock protein domain Back     alignment and domain information
>gnl|CDD|214633 smart00357, CSP, Cold shock protein domain Back     alignment and domain information
>gnl|CDD|77467 PRK09890, PRK09890, cold shock protein CspG; Provisional Back     alignment and domain information
>gnl|CDD|77467 PRK09890, PRK09890, cold shock protein CspG; Provisional Back     alignment and domain information
>gnl|CDD|131434 TIGR02381, cspD, cold shock domain protein CspD Back     alignment and domain information
>gnl|CDD|131434 TIGR02381, cspD, cold shock domain protein CspD Back     alignment and domain information
>gnl|CDD|184960 PRK14998, PRK14998, cold shock-like protein CspD; Provisional Back     alignment and domain information
>gnl|CDD|184960 PRK14998, PRK14998, cold shock-like protein CspD; Provisional Back     alignment and domain information
>gnl|CDD|77494 PRK09937, PRK09937, stationary phase/starvation inducible regulatory protein CspD; Provisional Back     alignment and domain information
>gnl|CDD|77494 PRK09937, PRK09937, stationary phase/starvation inducible regulatory protein CspD; Provisional Back     alignment and domain information
>gnl|CDD|185360 PRK15463, PRK15463, cold shock-like protein CspF; Provisional Back     alignment and domain information
>gnl|CDD|185360 PRK15463, PRK15463, cold shock-like protein CspF; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 191
COG127867 CspC Cold shock proteins [Transcription] 99.91
COG127867 CspC Cold shock proteins [Transcription] 99.91
PRK1546470 cold shock-like protein CspH; Provisional 99.9
PRK1094369 cold shock-like protein CspC; Provisional 99.89
PRK1546370 cold shock-like protein CspF; Provisional 99.89
PRK1035470 RNA chaperone/anti-terminator; Provisional 99.89
PRK0989070 cold shock protein CspG; Provisional 99.89
PRK0950769 cspE cold shock protein CspE; Reviewed 99.89
PRK0993774 stationary phase/starvation inducible regulatory p 99.89
PRK1546470 cold shock-like protein CspH; Provisional 99.88
PRK1094369 cold shock-like protein CspC; Provisional 99.88
PRK1499873 cold shock-like protein CspD; Provisional 99.88
PRK1546370 cold shock-like protein CspF; Provisional 99.88
TIGR0238168 cspD cold shock domain protein CspD. This model re 99.88
PRK0989070 cold shock protein CspG; Provisional 99.87
PRK1035470 RNA chaperone/anti-terminator; Provisional 99.87
PRK0950769 cspE cold shock protein CspE; Reviewed 99.87
PRK0993774 stationary phase/starvation inducible regulatory p 99.87
TIGR0238168 cspD cold shock domain protein CspD. This model re 99.86
PRK1499873 cold shock-like protein CspD; Provisional 99.86
PF0031366 CSD: 'Cold-shock' DNA-binding domain; InterPro: IP 99.82
PF0031366 CSD: 'Cold-shock' DNA-binding domain; InterPro: IP 99.82
cd0445865 CSP_CDS Cold-Shock Protein (CSP) contains an S1-li 99.81
cd0445865 CSP_CDS Cold-Shock Protein (CSP) contains an S1-li 99.8
KOG3070|consensus235 99.55
KOG3070|consensus235 99.49
smart0035764 CSP Cold shock protein domain. RNA-binding domain 99.0
smart0035764 CSP Cold shock protein domain. RNA-binding domain 98.94
PRK11642 813 exoribonuclease R; Provisional 98.72
TIGR00358 654 3_prime_RNase VacB and RNase II family 3'-5' exori 98.51
PRK05054 644 exoribonuclease II; Provisional 98.45
PF0820658 OB_RNB: Ribonuclease B OB domain; InterPro: IPR013 98.37
TIGR02062 639 RNase_B exoribonuclease II. This family consists o 98.27
TIGR02063 709 RNase_R ribonuclease R. This family consists of an 98.22
PF0820658 OB_RNB: Ribonuclease B OB domain; InterPro: IPR013 98.15
PF1444458 S1-like: S1-like 97.35
PF1444458 S1-like: S1-like 97.32
COG2996 287 Predicted RNA-bindining protein (contains S1 and H 96.95
PRK13806491 rpsA 30S ribosomal protein S1; Provisional 96.78
PF0749778 Rho_RNA_bind: Rho termination factor, RNA-binding 96.66
COG0557 706 VacB Exoribonuclease R [Transcription] 96.59
PRK07899 486 rpsA 30S ribosomal protein S1; Reviewed 96.56
PF0749778 Rho_RNA_bind: Rho termination factor, RNA-binding 96.45
PRK13806 491 rpsA 30S ribosomal protein S1; Provisional 96.19
PRK12269 863 bifunctional cytidylate kinase/ribosomal protein S 95.92
PRK11642 813 exoribonuclease R; Provisional 95.8
PRK12269 863 bifunctional cytidylate kinase/ribosomal protein S 95.7
cd0445968 Rho_CSD Rho_CSD: Rho protein cold-shock domain (CS 95.7
PRK07400318 30S ribosomal protein S1; Reviewed 95.64
COG0539 541 RpsA Ribosomal protein S1 [Translation, ribosomal 95.59
cd0445968 Rho_CSD Rho_CSD: Rho protein cold-shock domain (CS 95.42
PRK06676390 rpsA 30S ribosomal protein S1; Reviewed 95.37
PRK00087647 4-hydroxy-3-methylbut-2-enyl diphosphate reductase 95.3
TIGR00358 654 3_prime_RNase VacB and RNase II family 3'-5' exori 95.26
TIGR02062 639 RNase_B exoribonuclease II. This family consists o 95.11
PRK05054 644 exoribonuclease II; Provisional 95.07
TIGR00717516 rpsA ribosomal protein S1. This model provides tru 95.01
PRK06299 565 rpsA 30S ribosomal protein S1; Reviewed 94.77
COG0539541 RpsA Ribosomal protein S1 [Translation, ribosomal 94.75
PRK06299565 rpsA 30S ribosomal protein S1; Reviewed 94.52
PF1350961 S1_2: S1 domain; PDB: 3GO5_A. 94.21
TIGR02063 709 RNase_R ribonuclease R. This family consists of an 93.79
TIGR00717516 rpsA ribosomal protein S1. This model provides tru 93.53
PRK09376 416 rho transcription termination factor Rho; Provisio 93.34
cd0445388 S1_RNase_E S1_RNase_E: RNase E and RNase G, S1-lik 93.11
cd0569870 S1_Rrp5_repeat_hs6_sc5 S1_Rrp5_repeat_hs6_sc5: Rrp 92.6
cd0446183 S1_Rrp5_repeat_hs8_sc7 S1_Rrp5_repeat_hs8_sc7: Rrp 92.5
PRK07899 486 rpsA 30S ribosomal protein S1; Reviewed 92.48
PRK06676 390 rpsA 30S ribosomal protein S1; Reviewed 92.43
COG1158 422 Rho Transcription termination factor [Transcriptio 92.28
PF0057574 S1: S1 RNA binding domain; InterPro: IPR003029 Rib 92.23
cd0016465 S1_like S1_like: Ribosomal protein S1-like RNA-bin 91.97
PRK07400 318 30S ribosomal protein S1; Reviewed 91.94
cd0569671 S1_Rrp5_repeat_hs4 S1_Rrp5_repeat_hs4: Rrp5 is a t 91.48
PF0057574 S1: S1 RNA binding domain; InterPro: IPR003029 Rib 91.4
PRK12608 380 transcription termination factor Rho; Provisional 90.57
cd0570472 S1_Rrp5_repeat_hs13 S1_Rrp5_repeat_hs13: Rrp5 is a 90.43
COG4776 645 Rnb Exoribonuclease II [Transcription] 90.4
cd0446183 S1_Rrp5_repeat_hs8_sc7 S1_Rrp5_repeat_hs8_sc7: Rrp 90.33
PRK08582139 hypothetical protein; Provisional 90.23
cd0569769 S1_Rrp5_repeat_hs5 S1_Rrp5_repeat_hs5: Rrp5 is a t 90.11
cd0016465 S1_like S1_like: Ribosomal protein S1-like RNA-bin 90.1
PRK08582139 hypothetical protein; Provisional 90.0
PRK12608 380 transcription termination factor Rho; Provisional 89.63
cd0447268 S1_PNPase S1_PNPase: Polynucleotide phosphorylase 89.63
cd0445388 S1_RNase_E S1_RNase_E: RNase E and RNase G, S1-lik 89.23
cd0569671 S1_Rrp5_repeat_hs4 S1_Rrp5_repeat_hs4: Rrp5 is a t 89.2
cd0569870 S1_Rrp5_repeat_hs6_sc5 S1_Rrp5_repeat_hs6_sc5: Rrp 89.15
smart0031672 S1 Ribosomal protein S1-like RNA-binding domain. 89.13
cd0569269 S1_RPS1_repeat_hs4 S1_RPS1_repeat_hs4: Ribosomal p 89.08
PRK09376 416 rho transcription termination factor Rho; Provisio 88.88
cd0569269 S1_RPS1_repeat_hs4 S1_RPS1_repeat_hs4: Ribosomal p 88.86
cd0447268 S1_PNPase S1_PNPase: Polynucleotide phosphorylase 88.7
cd0570673 S1_Rrp5_repeat_sc10 S1_Rrp5_repeat_sc10: Rrp5 is a 88.56
PF1350961 S1_2: S1 domain; PDB: 3GO5_A. 88.36
PRK12678 672 transcription termination factor Rho; Provisional 88.21
cd0569173 S1_RPS1_repeat_ec6 S1_RPS1_repeat_ec6: Ribosomal p 88.07
smart0031672 S1 Ribosomal protein S1-like RNA-binding domain. 87.88
cd0569769 S1_Rrp5_repeat_hs5 S1_Rrp5_repeat_hs5: Rrp5 is a t 86.93
cd0569474 S1_Rrp5_repeat_hs2_sc2 S1_Rrp5_repeat_hs2_sc2: Rrp 86.86
COG1158 422 Rho Transcription termination factor [Transcriptio 86.85
cd0570373 S1_Rrp5_repeat_hs12_sc9 S1_Rrp5_repeat_hs12_sc9: R 86.58
cd0568972 S1_RPS1_repeat_ec4 S1_RPS1_repeat_ec4: Ribosomal p 86.57
cd0570673 S1_Rrp5_repeat_sc10 S1_Rrp5_repeat_sc10: Rrp5 is a 86.16
cd0569173 S1_RPS1_repeat_ec6 S1_RPS1_repeat_ec6: Ribosomal p 85.08
PRK07252120 hypothetical protein; Provisional 84.89
cd0447377 S1_RecJ_like S1_RecJ_like: The S1 domain of the ar 84.84
PRK00087 647 4-hydroxy-3-methylbut-2-enyl diphosphate reductase 84.82
TIGR00767 415 rho transcription termination factor Rho. Members 84.62
cd0568770 S1_RPS1_repeat_ec1_hs1 S1_RPS1_repeat_ec1_hs1: Rib 84.41
PRK07252120 hypothetical protein; Provisional 84.2
cd0570472 S1_Rrp5_repeat_hs13 S1_Rrp5_repeat_hs13: Rrp5 is a 83.93
cd0569069 S1_RPS1_repeat_ec5 S1_RPS1_repeat_ec5: Ribosomal p 83.92
PRK05807136 hypothetical protein; Provisional 83.83
cd0570574 S1_Rrp5_repeat_hs14 S1_Rrp5_repeat_hs14: Rrp5 is a 83.68
PF1160470 CusF_Ec: Copper binding periplasmic protein CusF; 83.67
cd0570768 S1_Rrp5_repeat_sc11 S1_Rrp5_repeat_sc11: Rrp5 is a 82.78
TIGR00757 414 RNaseEG ribonuclease, Rne/Rng family. The C-termin 82.64
PRK08059123 general stress protein 13; Validated 82.62
COG2996287 Predicted RNA-bindining protein (contains S1 and H 82.58
TIGR00767 415 rho transcription termination factor Rho. Members 82.49
cd0568673 S1_pNO40 S1_pNO40: pNO40 , S1-like RNA-binding dom 82.28
cd0568972 S1_RPS1_repeat_ec4 S1_RPS1_repeat_ec4: Ribosomal p 82.17
cd0569069 S1_RPS1_repeat_ec5 S1_RPS1_repeat_ec5: Ribosomal p 81.88
cd0568673 S1_pNO40 S1_pNO40: pNO40 , S1-like RNA-binding dom 81.33
cd0568479 S1_DHX8_helicase S1_DHX8_helicase: The N-terminal 81.29
cd0568770 S1_RPS1_repeat_ec1_hs1 S1_RPS1_repeat_ec1_hs1: Rib 81.04
PRK05807136 hypothetical protein; Provisional 81.03
cd0445276 S1_IF2_alpha S1_IF2_alpha: The alpha subunit of tr 80.42
cd0447377 S1_RecJ_like S1_RecJ_like: The S1 domain of the ar 80.4
cd0445567 S1_NusA S1_NusA: N-utilizing substance A protein ( 80.27
>COG1278 CspC Cold shock proteins [Transcription] Back     alignment and domain information
Probab=99.91  E-value=2.1e-24  Score=142.62  Aligned_cols=66  Identities=39%  Similarity=0.693  Sum_probs=62.8

Q ss_pred             ccceEEEEeeCCCCeeEEEeCCCCccEEEEeeeheecCCCCCcccCCCCCEEEEEEEEcCCCceeeEeec
Q psy9900           8 TVRGIVKFYDSKRGFGFITRLDNKEDIFVHKSSIVKMNPKKFFQSLGLGEIVDFNIGVGKKDIEAINVTG   77 (191)
Q Consensus         8 ~~~G~vk~~~~~kGfGFI~~~~~~~dvFvh~s~l~~~~~~~g~~~l~~Gd~V~f~~~~~~~g~~A~~v~~   77 (191)
                      +.+|+|||||..||||||.++++++|||||+|+++..    |++.|.+|++|+|++.++++|++|.+|..
T Consensus         1 ~~~GtVKwfn~~KGfGFI~p~~G~~DvFVH~Sai~~~----g~~~L~eGQ~V~f~~~~g~kgp~A~nv~~   66 (67)
T COG1278           1 MATGTVKWFNATKGFGFITPEDGGKDVFVHISAIQRA----GFRTLREGQKVEFEVEQGRKGPSAANVRA   66 (67)
T ss_pred             CCcceEEEeeCCCcceEcCCCCCCcCEEEEeeeeccC----CCcccCCCCEEEEEEecCCCCCceeEEEe
Confidence            4689999999999999999999999999999999987    79999999999999999999999999974



>COG1278 CspC Cold shock proteins [Transcription] Back     alignment and domain information
>PRK15464 cold shock-like protein CspH; Provisional Back     alignment and domain information
>PRK10943 cold shock-like protein CspC; Provisional Back     alignment and domain information
>PRK15463 cold shock-like protein CspF; Provisional Back     alignment and domain information
>PRK10354 RNA chaperone/anti-terminator; Provisional Back     alignment and domain information
>PRK09890 cold shock protein CspG; Provisional Back     alignment and domain information
>PRK09507 cspE cold shock protein CspE; Reviewed Back     alignment and domain information
>PRK09937 stationary phase/starvation inducible regulatory protein CspD; Provisional Back     alignment and domain information
>PRK15464 cold shock-like protein CspH; Provisional Back     alignment and domain information
>PRK10943 cold shock-like protein CspC; Provisional Back     alignment and domain information
>PRK14998 cold shock-like protein CspD; Provisional Back     alignment and domain information
>PRK15463 cold shock-like protein CspF; Provisional Back     alignment and domain information
>TIGR02381 cspD cold shock domain protein CspD Back     alignment and domain information
>PRK09890 cold shock protein CspG; Provisional Back     alignment and domain information
>PRK10354 RNA chaperone/anti-terminator; Provisional Back     alignment and domain information
>PRK09507 cspE cold shock protein CspE; Reviewed Back     alignment and domain information
>PRK09937 stationary phase/starvation inducible regulatory protein CspD; Provisional Back     alignment and domain information
>TIGR02381 cspD cold shock domain protein CspD Back     alignment and domain information
>PRK14998 cold shock-like protein CspD; Provisional Back     alignment and domain information
>PF00313 CSD: 'Cold-shock' DNA-binding domain; InterPro: IPR002059 When Escherichia coli is exposed to a temperature drop from 37 to 10 degrees centigrade, a 4-5 hour lag phase occurs, after which growth is resumed at a reduced rate [] Back     alignment and domain information
>PF00313 CSD: 'Cold-shock' DNA-binding domain; InterPro: IPR002059 When Escherichia coli is exposed to a temperature drop from 37 to 10 degrees centigrade, a 4-5 hour lag phase occurs, after which growth is resumed at a reduced rate [] Back     alignment and domain information
>cd04458 CSP_CDS Cold-Shock Protein (CSP) contains an S1-like cold-shock domain (CSD) that is found in eukaryotes, prokaryotes, and archaea Back     alignment and domain information
>cd04458 CSP_CDS Cold-Shock Protein (CSP) contains an S1-like cold-shock domain (CSD) that is found in eukaryotes, prokaryotes, and archaea Back     alignment and domain information
>KOG3070|consensus Back     alignment and domain information
>KOG3070|consensus Back     alignment and domain information
>smart00357 CSP Cold shock protein domain Back     alignment and domain information
>smart00357 CSP Cold shock protein domain Back     alignment and domain information
>PRK11642 exoribonuclease R; Provisional Back     alignment and domain information
>TIGR00358 3_prime_RNase VacB and RNase II family 3'-5' exoribonucleases Back     alignment and domain information
>PRK05054 exoribonuclease II; Provisional Back     alignment and domain information
>PF08206 OB_RNB: Ribonuclease B OB domain; InterPro: IPR013223 This domain includes the N-terminal OB domain found in ribonuclease B proteins in one or two copies Back     alignment and domain information
>TIGR02062 RNase_B exoribonuclease II Back     alignment and domain information
>TIGR02063 RNase_R ribonuclease R Back     alignment and domain information
>PF08206 OB_RNB: Ribonuclease B OB domain; InterPro: IPR013223 This domain includes the N-terminal OB domain found in ribonuclease B proteins in one or two copies Back     alignment and domain information
>PF14444 S1-like: S1-like Back     alignment and domain information
>PF14444 S1-like: S1-like Back     alignment and domain information
>COG2996 Predicted RNA-bindining protein (contains S1 and HTH domains) [General function prediction only] Back     alignment and domain information
>PRK13806 rpsA 30S ribosomal protein S1; Provisional Back     alignment and domain information
>PF07497 Rho_RNA_bind: Rho termination factor, RNA-binding domain; InterPro: IPR011113 The Rho termination factor disengages newly transcribed RNA from its DNA template at certain, specific transcripts Back     alignment and domain information
>COG0557 VacB Exoribonuclease R [Transcription] Back     alignment and domain information
>PRK07899 rpsA 30S ribosomal protein S1; Reviewed Back     alignment and domain information
>PF07497 Rho_RNA_bind: Rho termination factor, RNA-binding domain; InterPro: IPR011113 The Rho termination factor disengages newly transcribed RNA from its DNA template at certain, specific transcripts Back     alignment and domain information
>PRK13806 rpsA 30S ribosomal protein S1; Provisional Back     alignment and domain information
>PRK12269 bifunctional cytidylate kinase/ribosomal protein S1; Provisional Back     alignment and domain information
>PRK11642 exoribonuclease R; Provisional Back     alignment and domain information
>PRK12269 bifunctional cytidylate kinase/ribosomal protein S1; Provisional Back     alignment and domain information
>cd04459 Rho_CSD Rho_CSD: Rho protein cold-shock domain (CSD) Back     alignment and domain information
>PRK07400 30S ribosomal protein S1; Reviewed Back     alignment and domain information
>COG0539 RpsA Ribosomal protein S1 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd04459 Rho_CSD Rho_CSD: Rho protein cold-shock domain (CSD) Back     alignment and domain information
>PRK06676 rpsA 30S ribosomal protein S1; Reviewed Back     alignment and domain information
>PRK00087 4-hydroxy-3-methylbut-2-enyl diphosphate reductase/S1 RNA-binding domain protein; Reviewed Back     alignment and domain information
>TIGR00358 3_prime_RNase VacB and RNase II family 3'-5' exoribonucleases Back     alignment and domain information
>TIGR02062 RNase_B exoribonuclease II Back     alignment and domain information
>PRK05054 exoribonuclease II; Provisional Back     alignment and domain information
>TIGR00717 rpsA ribosomal protein S1 Back     alignment and domain information
>PRK06299 rpsA 30S ribosomal protein S1; Reviewed Back     alignment and domain information
>COG0539 RpsA Ribosomal protein S1 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK06299 rpsA 30S ribosomal protein S1; Reviewed Back     alignment and domain information
>PF13509 S1_2: S1 domain; PDB: 3GO5_A Back     alignment and domain information
>TIGR02063 RNase_R ribonuclease R Back     alignment and domain information
>TIGR00717 rpsA ribosomal protein S1 Back     alignment and domain information
>PRK09376 rho transcription termination factor Rho; Provisional Back     alignment and domain information
>cd04453 S1_RNase_E S1_RNase_E: RNase E and RNase G, S1-like RNA-binding domain Back     alignment and domain information
>cd05698 S1_Rrp5_repeat_hs6_sc5 S1_Rrp5_repeat_hs6_sc5: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits Back     alignment and domain information
>cd04461 S1_Rrp5_repeat_hs8_sc7 S1_Rrp5_repeat_hs8_sc7: Rrp5 Homo sapiens S1 repeat 8 (hs8) and Saccharomyces cerevisiae S1 repeat 7 (sc7)-like domains Back     alignment and domain information
>PRK07899 rpsA 30S ribosomal protein S1; Reviewed Back     alignment and domain information
>PRK06676 rpsA 30S ribosomal protein S1; Reviewed Back     alignment and domain information
>COG1158 Rho Transcription termination factor [Transcription] Back     alignment and domain information
>PF00575 S1: S1 RNA binding domain; InterPro: IPR003029 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>cd00164 S1_like S1_like: Ribosomal protein S1-like RNA-binding domain Back     alignment and domain information
>PRK07400 30S ribosomal protein S1; Reviewed Back     alignment and domain information
>cd05696 S1_Rrp5_repeat_hs4 S1_Rrp5_repeat_hs4: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits Back     alignment and domain information
>PF00575 S1: S1 RNA binding domain; InterPro: IPR003029 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>PRK12608 transcription termination factor Rho; Provisional Back     alignment and domain information
>cd05704 S1_Rrp5_repeat_hs13 S1_Rrp5_repeat_hs13: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits Back     alignment and domain information
>COG4776 Rnb Exoribonuclease II [Transcription] Back     alignment and domain information
>cd04461 S1_Rrp5_repeat_hs8_sc7 S1_Rrp5_repeat_hs8_sc7: Rrp5 Homo sapiens S1 repeat 8 (hs8) and Saccharomyces cerevisiae S1 repeat 7 (sc7)-like domains Back     alignment and domain information
>PRK08582 hypothetical protein; Provisional Back     alignment and domain information
>cd05697 S1_Rrp5_repeat_hs5 S1_Rrp5_repeat_hs5: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits Back     alignment and domain information
>cd00164 S1_like S1_like: Ribosomal protein S1-like RNA-binding domain Back     alignment and domain information
>PRK08582 hypothetical protein; Provisional Back     alignment and domain information
>PRK12608 transcription termination factor Rho; Provisional Back     alignment and domain information
>cd04472 S1_PNPase S1_PNPase: Polynucleotide phosphorylase (PNPase), ), S1-like RNA-binding domain Back     alignment and domain information
>cd04453 S1_RNase_E S1_RNase_E: RNase E and RNase G, S1-like RNA-binding domain Back     alignment and domain information
>cd05696 S1_Rrp5_repeat_hs4 S1_Rrp5_repeat_hs4: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits Back     alignment and domain information
>cd05698 S1_Rrp5_repeat_hs6_sc5 S1_Rrp5_repeat_hs6_sc5: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits Back     alignment and domain information
>smart00316 S1 Ribosomal protein S1-like RNA-binding domain Back     alignment and domain information
>cd05692 S1_RPS1_repeat_hs4 S1_RPS1_repeat_hs4: Ribosomal protein S1 (RPS1) domain Back     alignment and domain information
>PRK09376 rho transcription termination factor Rho; Provisional Back     alignment and domain information
>cd05692 S1_RPS1_repeat_hs4 S1_RPS1_repeat_hs4: Ribosomal protein S1 (RPS1) domain Back     alignment and domain information
>cd04472 S1_PNPase S1_PNPase: Polynucleotide phosphorylase (PNPase), ), S1-like RNA-binding domain Back     alignment and domain information
>cd05706 S1_Rrp5_repeat_sc10 S1_Rrp5_repeat_sc10: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits Back     alignment and domain information
>PF13509 S1_2: S1 domain; PDB: 3GO5_A Back     alignment and domain information
>PRK12678 transcription termination factor Rho; Provisional Back     alignment and domain information
>cd05691 S1_RPS1_repeat_ec6 S1_RPS1_repeat_ec6: Ribosomal protein S1 (RPS1) domain Back     alignment and domain information
>smart00316 S1 Ribosomal protein S1-like RNA-binding domain Back     alignment and domain information
>cd05697 S1_Rrp5_repeat_hs5 S1_Rrp5_repeat_hs5: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits Back     alignment and domain information
>cd05694 S1_Rrp5_repeat_hs2_sc2 S1_Rrp5_repeat_hs2_sc2: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits Back     alignment and domain information
>COG1158 Rho Transcription termination factor [Transcription] Back     alignment and domain information
>cd05703 S1_Rrp5_repeat_hs12_sc9 S1_Rrp5_repeat_hs12_sc9: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits Back     alignment and domain information
>cd05689 S1_RPS1_repeat_ec4 S1_RPS1_repeat_ec4: Ribosomal protein S1 (RPS1) domain Back     alignment and domain information
>cd05706 S1_Rrp5_repeat_sc10 S1_Rrp5_repeat_sc10: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits Back     alignment and domain information
>cd05691 S1_RPS1_repeat_ec6 S1_RPS1_repeat_ec6: Ribosomal protein S1 (RPS1) domain Back     alignment and domain information
>PRK07252 hypothetical protein; Provisional Back     alignment and domain information
>cd04473 S1_RecJ_like S1_RecJ_like: The S1 domain of the archaea-specific RecJ-like exonuclease Back     alignment and domain information
>PRK00087 4-hydroxy-3-methylbut-2-enyl diphosphate reductase/S1 RNA-binding domain protein; Reviewed Back     alignment and domain information
>TIGR00767 rho transcription termination factor Rho Back     alignment and domain information
>cd05687 S1_RPS1_repeat_ec1_hs1 S1_RPS1_repeat_ec1_hs1: Ribosomal protein S1 (RPS1) domain Back     alignment and domain information
>PRK07252 hypothetical protein; Provisional Back     alignment and domain information
>cd05704 S1_Rrp5_repeat_hs13 S1_Rrp5_repeat_hs13: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits Back     alignment and domain information
>cd05690 S1_RPS1_repeat_ec5 S1_RPS1_repeat_ec5: Ribosomal protein S1 (RPS1) domain Back     alignment and domain information
>PRK05807 hypothetical protein; Provisional Back     alignment and domain information
>cd05705 S1_Rrp5_repeat_hs14 S1_Rrp5_repeat_hs14: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits Back     alignment and domain information
>PF11604 CusF_Ec: Copper binding periplasmic protein CusF; InterPro: IPR021647 CusF is a periplasmic protein involved in copper and silver resistance in Escherichia coil Back     alignment and domain information
>cd05707 S1_Rrp5_repeat_sc11 S1_Rrp5_repeat_sc11: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits Back     alignment and domain information
>TIGR00757 RNaseEG ribonuclease, Rne/Rng family Back     alignment and domain information
>PRK08059 general stress protein 13; Validated Back     alignment and domain information
>COG2996 Predicted RNA-bindining protein (contains S1 and HTH domains) [General function prediction only] Back     alignment and domain information
>TIGR00767 rho transcription termination factor Rho Back     alignment and domain information
>cd05686 S1_pNO40 S1_pNO40: pNO40 , S1-like RNA-binding domain Back     alignment and domain information
>cd05689 S1_RPS1_repeat_ec4 S1_RPS1_repeat_ec4: Ribosomal protein S1 (RPS1) domain Back     alignment and domain information
>cd05690 S1_RPS1_repeat_ec5 S1_RPS1_repeat_ec5: Ribosomal protein S1 (RPS1) domain Back     alignment and domain information
>cd05686 S1_pNO40 S1_pNO40: pNO40 , S1-like RNA-binding domain Back     alignment and domain information
>cd05684 S1_DHX8_helicase S1_DHX8_helicase: The N-terminal S1 domain of human ATP-dependent RNA helicase DHX8, a DEAH (Asp-Glu-Ala-His) box polypeptide Back     alignment and domain information
>cd05687 S1_RPS1_repeat_ec1_hs1 S1_RPS1_repeat_ec1_hs1: Ribosomal protein S1 (RPS1) domain Back     alignment and domain information
>PRK05807 hypothetical protein; Provisional Back     alignment and domain information
>cd04452 S1_IF2_alpha S1_IF2_alpha: The alpha subunit of translation Initiation Factor 2, S1-like RNA-binding domain Back     alignment and domain information
>cd04473 S1_RecJ_like S1_RecJ_like: The S1 domain of the archaea-specific RecJ-like exonuclease Back     alignment and domain information
>cd04455 S1_NusA S1_NusA: N-utilizing substance A protein (NusA), S1-like RNA-binding domain Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query191
1h95_A79 Solution Structure Of The Single-Stranded Dna-Bindi 6e-16
1h95_A79 Solution Structure Of The Single-Stranded Dna-Bindi 9e-16
1g6p_A66 Solution Nmr Structure Of The Cold Shock Protein Fr 1e-07
1g6p_A66 Solution Nmr Structure Of The Cold Shock Protein Fr 1e-07
3trz_A148 Mouse Lin28a In Complex With Let-7d Microrna Pre-El 2e-07
3ts0_A146 Mouse Lin28a In Complex With Let-7f-1 Microrna Pre- 3e-07
3ulj_A90 Crystal Structure Of Apo Lin28b Cold Shock Domain L 4e-07
4a4i_A90 Crystal Structure Of The Human Lin28b Cold Shock Do 9e-07
4a4i_A90 Crystal Structure Of The Human Lin28b Cold Shock Do 1e-06
3i2z_B71 Structure Of Cold Shock Protein E From Salmonella T 1e-06
3i2z_B71 Structure Of Cold Shock Protein E From Salmonella T 1e-06
1mjc_A69 Crystal Structure Of Cspa, The Major Cold Shock Pro 3e-06
1mjc_A69 Crystal Structure Of Cspa, The Major Cold Shock Pro 3e-06
2l15_A70 Solution Structure Of Cold Shock Protein Cspa Using 4e-06
2l15_A70 Solution Structure Of Cold Shock Protein Cspa Using 4e-06
3mef_A69 Major Cold-Shock Protein From Escherichia Coli Solu 4e-06
3mef_A69 Major Cold-Shock Protein From Escherichia Coli Solu 4e-06
3cam_A67 Crystal Structure Of The Cold Shock Domain Protein 2e-05
3cam_A67 Crystal Structure Of The Cold Shock Domain Protein 2e-05
2i5l_X67 Crystal Structure Of Bacillus Subtilis Cold Shock P 4e-05
2i5l_X67 Crystal Structure Of Bacillus Subtilis Cold Shock P 4e-05
2es2_A67 Crystal Structure Analysis Of The Bacillus Subtilis 5e-05
2es2_A67 Crystal Structure Analysis Of The Bacillus Subtilis 5e-05
3a0j_A73 Crystal Structure Of Cold Shock Protein 1 From Ther 7e-05
3a0j_A73 Crystal Structure Of Cold Shock Protein 1 From Ther 7e-05
2i5m_X67 Crystal Structure Of Bacillus Subtilis Cold Shock P 2e-04
2i5m_X67 Crystal Structure Of Bacillus Subtilis Cold Shock P 2e-04
2bh8_A101 Combinatorial Protein 1b11 Length = 101 4e-04
2bh8_A101 Combinatorial Protein 1b11 Length = 101 6e-04
1hza_A67 Bacillus Caldolyticus Cold-Shock Protein Mutants To 8e-04
1hza_A67 Bacillus Caldolyticus Cold-Shock Protein Mutants To 8e-04
>pdb|1H95|A Chain A, Solution Structure Of The Single-Stranded Dna-Binding Cold Shock Domain (Csd) Of Human Y-Box Protein 1 (Yb1) Determined By Nmr (10 Lowest Energy Structures) Length = 79 Back     alignment and structure

Iteration: 1

Score = 80.1 bits (196), Expect = 6e-16, Method: Compositional matrix adjust. Identities = 38/78 (48%), Positives = 55/78 (70%) Query: 1 MTKFEIHTVRGIVKFYDSKRGFGFITRLDNKEDIFVHKSSIVKMNPKKFFQSLGLGEIVD 60 M K V G VK+++ + G+GFI R D KED+FVH+++I K NP+K+ +S+G GE V+ Sbjct: 1 MKKVIATKVLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVE 60 Query: 61 FNIGVGKKDIEAINVTGP 78 F++ G+K EA NVTGP Sbjct: 61 FDVVEGEKGAEAANVTGP 78
>pdb|1H95|A Chain A, Solution Structure Of The Single-Stranded Dna-Binding Cold Shock Domain (Csd) Of Human Y-Box Protein 1 (Yb1) Determined By Nmr (10 Lowest Energy Structures) Length = 79 Back     alignment and structure
>pdb|1G6P|A Chain A, Solution Nmr Structure Of The Cold Shock Protein From The Hyperthermophilic Bacterium Thermotoga Maritima Length = 66 Back     alignment and structure
>pdb|1G6P|A Chain A, Solution Nmr Structure Of The Cold Shock Protein From The Hyperthermophilic Bacterium Thermotoga Maritima Length = 66 Back     alignment and structure
>pdb|3TRZ|A Chain A, Mouse Lin28a In Complex With Let-7d Microrna Pre-Element Length = 148 Back     alignment and structure
>pdb|3TS0|A Chain A, Mouse Lin28a In Complex With Let-7f-1 Microrna Pre-Element Length = 146 Back     alignment and structure
>pdb|3ULJ|A Chain A, Crystal Structure Of Apo Lin28b Cold Shock Domain Length = 90 Back     alignment and structure
>pdb|4A4I|A Chain A, Crystal Structure Of The Human Lin28b Cold Shock Domain Length = 90 Back     alignment and structure
>pdb|4A4I|A Chain A, Crystal Structure Of The Human Lin28b Cold Shock Domain Length = 90 Back     alignment and structure
>pdb|3I2Z|B Chain B, Structure Of Cold Shock Protein E From Salmonella Typhimurium Length = 71 Back     alignment and structure
>pdb|3I2Z|B Chain B, Structure Of Cold Shock Protein E From Salmonella Typhimurium Length = 71 Back     alignment and structure
>pdb|1MJC|A Chain A, Crystal Structure Of Cspa, The Major Cold Shock Protein Of Escherichia Coli Length = 69 Back     alignment and structure
>pdb|1MJC|A Chain A, Crystal Structure Of Cspa, The Major Cold Shock Protein Of Escherichia Coli Length = 69 Back     alignment and structure
>pdb|2L15|A Chain A, Solution Structure Of Cold Shock Protein Cspa Using Combined Nmr And Cs-Rosetta Method Length = 70 Back     alignment and structure
>pdb|2L15|A Chain A, Solution Structure Of Cold Shock Protein Cspa Using Combined Nmr And Cs-Rosetta Method Length = 70 Back     alignment and structure
>pdb|3MEF|A Chain A, Major Cold-Shock Protein From Escherichia Coli Solution Nmr Structure Length = 69 Back     alignment and structure
>pdb|3MEF|A Chain A, Major Cold-Shock Protein From Escherichia Coli Solution Nmr Structure Length = 69 Back     alignment and structure
>pdb|3CAM|A Chain A, Crystal Structure Of The Cold Shock Domain Protein From Neisseria Meningitidis Length = 67 Back     alignment and structure
>pdb|3CAM|A Chain A, Crystal Structure Of The Cold Shock Domain Protein From Neisseria Meningitidis Length = 67 Back     alignment and structure
>pdb|2I5L|X Chain X, Crystal Structure Of Bacillus Subtilis Cold Shock Protein Variant Bs-Cspb M1rE3KK65I Length = 67 Back     alignment and structure
>pdb|2I5L|X Chain X, Crystal Structure Of Bacillus Subtilis Cold Shock Protein Variant Bs-Cspb M1rE3KK65I Length = 67 Back     alignment and structure
>pdb|2ES2|A Chain A, Crystal Structure Analysis Of The Bacillus Subtilis Cold Shock Protein Bs-Cspb In Complex With Hexathymidine Length = 67 Back     alignment and structure
>pdb|2ES2|A Chain A, Crystal Structure Analysis Of The Bacillus Subtilis Cold Shock Protein Bs-Cspb In Complex With Hexathymidine Length = 67 Back     alignment and structure
>pdb|3A0J|A Chain A, Crystal Structure Of Cold Shock Protein 1 From Thermus Thermophilus Hb8 Length = 73 Back     alignment and structure
>pdb|3A0J|A Chain A, Crystal Structure Of Cold Shock Protein 1 From Thermus Thermophilus Hb8 Length = 73 Back     alignment and structure
>pdb|2I5M|X Chain X, Crystal Structure Of Bacillus Subtilis Cold Shock Protein Cspb Variant A46k S48r Length = 67 Back     alignment and structure
>pdb|2I5M|X Chain X, Crystal Structure Of Bacillus Subtilis Cold Shock Protein Cspb Variant A46k S48r Length = 67 Back     alignment and structure
>pdb|2BH8|A Chain A, Combinatorial Protein 1b11 Length = 101 Back     alignment and structure
>pdb|2BH8|A Chain A, Combinatorial Protein 1b11 Length = 101 Back     alignment and structure
>pdb|1HZA|A Chain A, Bacillus Caldolyticus Cold-Shock Protein Mutants To Study Determinants Of Protein Stability Length = 67 Back     alignment and structure
>pdb|1HZA|A Chain A, Bacillus Caldolyticus Cold-Shock Protein Mutants To Study Determinants Of Protein Stability Length = 67 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query191
1h95_A79 CSD, Y-box binding protein; translation factor, tr 3e-21
1h95_A79 CSD, Y-box binding protein; translation factor, tr 3e-21
3ts2_A148 Protein LIN-28 homolog A; microrna biogenesis, pro 1e-19
3ts2_A148 Protein LIN-28 homolog A; microrna biogenesis, pro 3e-19
3ulj_A90 LIN28B, DNA-binding protein; beta barrel, cold sho 2e-18
3ulj_A90 LIN28B, DNA-binding protein; beta barrel, cold sho 2e-18
2kcm_A74 Cold shock domain family protein; nucleic acid bin 1e-13
2kcm_A74 Cold shock domain family protein; nucleic acid bin 1e-13
2k5n_A74 Putative cold-shock protein; GFT protein structure 7e-12
2k5n_A74 Putative cold-shock protein; GFT protein structure 7e-12
3i2z_B71 RNA chaperone, negative regulator of CSPA transcri 2e-11
3i2z_B71 RNA chaperone, negative regulator of CSPA transcri 2e-11
1g6p_A66 Cold shock protein TMCSP; greek-KEY, beta barrel, 1e-10
1g6p_A66 Cold shock protein TMCSP; greek-KEY, beta barrel, 1e-10
3cam_A67 Cold-shock domain family protein; cold shock prote 1e-10
3cam_A67 Cold-shock domain family protein; cold shock prote 1e-10
2lss_A70 Cold shock-like protein; CSD, CSP, oligonucleotide 2e-10
2lss_A70 Cold shock-like protein; CSD, CSP, oligonucleotide 2e-10
1c9o_A66 CSPB, cold-shock protein; beta barrel, homodimer, 5e-10
1c9o_A66 CSPB, cold-shock protein; beta barrel, homodimer, 5e-10
2ytx_A97 Cold shock domain-containing protein E1; cell-free 7e-10
2ytx_A97 Cold shock domain-containing protein E1; cell-free 7e-10
3aqq_A147 Calcium-regulated heat stable protein 1; compact b 1e-09
3aqq_A147 Calcium-regulated heat stable protein 1; compact b 1e-08
3a0j_A73 Cold shock protein; OB-fold, cytoplasm, transcript 9e-09
3a0j_A73 Cold shock protein; OB-fold, cytoplasm, transcript 9e-09
2yty_A88 Cold shock domain-containing protein E1; cell-free 4e-08
2yty_A88 Cold shock domain-containing protein E1; cell-free 4e-08
2bh8_A101 1B11; transcription, molecular evolution, unique a 5e-08
2bh8_A101 1B11; transcription, molecular evolution, unique a 9e-08
1wfq_A89 UNR protein; beta-barrel, translational regulation 5e-05
1wfq_A89 UNR protein; beta-barrel, translational regulation 5e-05
1x65_A89 UNR protein; cell-free protein synthesis, beta-bar 4e-04
>1h95_A CSD, Y-box binding protein; translation factor, transcription factor, OB-fold, 5- stranded anti-parallel beta-barrel, single stranded DNA binding; NMR {Homo sapiens} SCOP: b.40.4.5 Length = 79 Back     alignment and structure
 Score = 82.0 bits (203), Expect = 3e-21
 Identities = 36/70 (51%), Positives = 53/70 (75%)

Query: 9  VRGIVKFYDSKRGFGFITRLDNKEDIFVHKSSIVKMNPKKFFQSLGLGEIVDFNIGVGKK 68
          V G VK+++ + G+GFI R D KED+FVH+++I K NP+K+ +S+G GE V+F++  G+K
Sbjct: 9  VLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEK 68

Query: 69 DIEAINVTGP 78
            EA NVTGP
Sbjct: 69 GAEAANVTGP 78


>1h95_A CSD, Y-box binding protein; translation factor, transcription factor, OB-fold, 5- stranded anti-parallel beta-barrel, single stranded DNA binding; NMR {Homo sapiens} SCOP: b.40.4.5 Length = 79 Back     alignment and structure
>3ts2_A Protein LIN-28 homolog A; microrna biogenesis, protein-RNA complex, PRE-element, CCHC knuckle; HET: GMP; 2.01A {Mus musculus} PDB: 3trz_A* 3ts0_A* Length = 148 Back     alignment and structure
>3ts2_A Protein LIN-28 homolog A; microrna biogenesis, protein-RNA complex, PRE-element, CCHC knuckle; HET: GMP; 2.01A {Mus musculus} PDB: 3trz_A* 3ts0_A* Length = 148 Back     alignment and structure
>3ulj_A LIN28B, DNA-binding protein; beta barrel, cold shock domain fold, nucleic acid binding, D binding protein; 1.06A {Silurana} PDB: 4a4i_A Length = 90 Back     alignment and structure
>3ulj_A LIN28B, DNA-binding protein; beta barrel, cold shock domain fold, nucleic acid binding, D binding protein; 1.06A {Silurana} PDB: 4a4i_A Length = 90 Back     alignment and structure
>2kcm_A Cold shock domain family protein; nucleic acid binding protein, beta barrel, structural genomi 2, protein structure initiative; NMR {Shewanella oneidensis} Length = 74 Back     alignment and structure
>2kcm_A Cold shock domain family protein; nucleic acid binding protein, beta barrel, structural genomi 2, protein structure initiative; NMR {Shewanella oneidensis} Length = 74 Back     alignment and structure
>2k5n_A Putative cold-shock protein; GFT protein structure, PSI, nesgc, OB fold, cold shock structural genomics; NMR {Pectobacterium atrosepticum} Length = 74 Back     alignment and structure
>2k5n_A Putative cold-shock protein; GFT protein structure, PSI, nesgc, OB fold, cold shock structural genomics; NMR {Pectobacterium atrosepticum} Length = 74 Back     alignment and structure
>3i2z_B RNA chaperone, negative regulator of CSPA transcription; beta barrel, DNA binding protein/transcription, cytoplasm, gene regulation; 1.10A {Salmonella typhimurium} PDB: 2l15_A 1mjc_A 3mef_A Length = 71 Back     alignment and structure
>3i2z_B RNA chaperone, negative regulator of CSPA transcription; beta barrel, DNA binding protein/transcription, cytoplasm, gene regulation; 1.10A {Salmonella typhimurium} PDB: 2l15_A 1mjc_A 3mef_A Length = 71 Back     alignment and structure
>1g6p_A Cold shock protein TMCSP; greek-KEY, beta barrel, OB-fold, structural genomics; NMR {Thermotoga maritima} SCOP: b.40.4.5 Length = 66 Back     alignment and structure
>1g6p_A Cold shock protein TMCSP; greek-KEY, beta barrel, OB-fold, structural genomics; NMR {Thermotoga maritima} SCOP: b.40.4.5 Length = 66 Back     alignment and structure
>3cam_A Cold-shock domain family protein; cold shock protein, chain SWAP, STRU genomics, oxford protein production facility, OPPF, gene RE; 2.60A {Neisseria meningitidis MC58} Length = 67 Back     alignment and structure
>3cam_A Cold-shock domain family protein; cold shock protein, chain SWAP, STRU genomics, oxford protein production facility, OPPF, gene RE; 2.60A {Neisseria meningitidis MC58} Length = 67 Back     alignment and structure
>2lss_A Cold shock-like protein; CSD, CSP, oligonucleotide binding F fold, RNA binding protein, DNA binding protein; NMR {Rickettsia rickettsii} Length = 70 Back     alignment and structure
>2lss_A Cold shock-like protein; CSD, CSP, oligonucleotide binding F fold, RNA binding protein, DNA binding protein; NMR {Rickettsia rickettsii} Length = 70 Back     alignment and structure
>1c9o_A CSPB, cold-shock protein; beta barrel, homodimer, transcription; 1.17A {Bacillus caldolyticus} SCOP: b.40.4.5 PDB: 2hax_A 1hz9_A 1hzb_A 1i5f_A 1hza_A 1hzc_A 3pf4_A 1csq_A 1nmf_A 1nmg_A 1csp_A 2f52_A 2es2_A 3pf5_A 2i5m_X 2i5l_X Length = 66 Back     alignment and structure
>1c9o_A CSPB, cold-shock protein; beta barrel, homodimer, transcription; 1.17A {Bacillus caldolyticus} SCOP: b.40.4.5 PDB: 2hax_A 1hz9_A 1hzb_A 1i5f_A 1hza_A 1hzc_A 3pf4_A 1csq_A 1nmf_A 1nmg_A 1csp_A 2f52_A 2es2_A 3pf5_A 2i5m_X 2i5l_X Length = 66 Back     alignment and structure
>2ytx_A Cold shock domain-containing protein E1; cell-free protein synthesis, beta-barrel, translational REGU RNA chaperone, RNA/DNA binding, QB fold; NMR {Homo sapiens} Length = 97 Back     alignment and structure
>2ytx_A Cold shock domain-containing protein E1; cell-free protein synthesis, beta-barrel, translational REGU RNA chaperone, RNA/DNA binding, QB fold; NMR {Homo sapiens} Length = 97 Back     alignment and structure
>3aqq_A Calcium-regulated heat stable protein 1; compact beta-barrel, cold shock domain, ssDNA binding, DNA B protein; 2.80A {Homo sapiens} Length = 147 Back     alignment and structure
>3aqq_A Calcium-regulated heat stable protein 1; compact beta-barrel, cold shock domain, ssDNA binding, DNA B protein; 2.80A {Homo sapiens} Length = 147 Back     alignment and structure
>3a0j_A Cold shock protein; OB-fold, cytoplasm, transcription, structural genomics, NPPSFA; 1.65A {Thermus thermophilus} Length = 73 Back     alignment and structure
>3a0j_A Cold shock protein; OB-fold, cytoplasm, transcription, structural genomics, NPPSFA; 1.65A {Thermus thermophilus} Length = 73 Back     alignment and structure
>2yty_A Cold shock domain-containing protein E1; cell-free protein synthesis, beta-barrel, translational REGU RNA chaperone, RNA/DNA binding, QB fold; NMR {Homo sapiens} Length = 88 Back     alignment and structure
>2yty_A Cold shock domain-containing protein E1; cell-free protein synthesis, beta-barrel, translational REGU RNA chaperone, RNA/DNA binding, QB fold; NMR {Homo sapiens} Length = 88 Back     alignment and structure
>2bh8_A 1B11; transcription, molecular evolution, unique architecture, transcription regulation, phosphorylation; 1.9A {Escherichia coli} Length = 101 Back     alignment and structure
>2bh8_A 1B11; transcription, molecular evolution, unique architecture, transcription regulation, phosphorylation; 1.9A {Escherichia coli} Length = 101 Back     alignment and structure
>1wfq_A UNR protein; beta-barrel, translational regulation, RNA chaperone, RNA/DN binding, QB fold, greek-KEY topology, structur genomics; NMR {Homo sapiens} SCOP: b.40.4.5 Length = 89 Back     alignment and structure
>1wfq_A UNR protein; beta-barrel, translational regulation, RNA chaperone, RNA/DN binding, QB fold, greek-KEY topology, structur genomics; NMR {Homo sapiens} SCOP: b.40.4.5 Length = 89 Back     alignment and structure
>1x65_A UNR protein; cell-free protein synthesis, beta-barrel, translational REGU RNA chaperone, RNA/DNA binding, QB fold, greek-KEY topology protein; NMR {Homo sapiens} Length = 89 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query191
3ulj_A90 LIN28B, DNA-binding protein; beta barrel, cold sho 99.93
1h95_A79 CSD, Y-box binding protein; translation factor, tr 99.92
3ulj_A90 LIN28B, DNA-binding protein; beta barrel, cold sho 99.91
1h95_A79 CSD, Y-box binding protein; translation factor, tr 99.91
3i2z_B71 RNA chaperone, negative regulator of CSPA transcri 99.9
3cam_A67 Cold-shock domain family protein; cold shock prote 99.9
3cam_A67 Cold-shock domain family protein; cold shock prote 99.89
3i2z_B71 RNA chaperone, negative regulator of CSPA transcri 99.88
1c9o_A66 CSPB, cold-shock protein; beta barrel, homodimer, 99.88
3a0j_A73 Cold shock protein; OB-fold, cytoplasm, transcript 99.88
1c9o_A66 CSPB, cold-shock protein; beta barrel, homodimer, 99.87
3ts2_A148 Protein LIN-28 homolog A; microrna biogenesis, pro 99.87
2kcm_A74 Cold shock domain family protein; nucleic acid bin 99.87
3a0j_A73 Cold shock protein; OB-fold, cytoplasm, transcript 99.87
2kcm_A74 Cold shock domain family protein; nucleic acid bin 99.87
1g6p_A66 Cold shock protein TMCSP; greek-KEY, beta barrel, 99.87
2lss_A70 Cold shock-like protein; CSD, CSP, oligonucleotide 99.78
1g6p_A66 Cold shock protein TMCSP; greek-KEY, beta barrel, 99.87
2k5n_A74 Putative cold-shock protein; GFT protein structure 99.86
2k5n_A74 Putative cold-shock protein; GFT protein structure 99.86
2lss_A70 Cold shock-like protein; CSD, CSP, oligonucleotide 99.76
3ts2_A148 Protein LIN-28 homolog A; microrna biogenesis, pro 99.85
1wfq_A89 UNR protein; beta-barrel, translational regulation 99.84
1wfq_A89 UNR protein; beta-barrel, translational regulation 99.83
2yty_A88 Cold shock domain-containing protein E1; cell-free 99.82
3aqq_A147 Calcium-regulated heat stable protein 1; compact b 99.82
3aqq_A147 Calcium-regulated heat stable protein 1; compact b 99.8
2ytx_A97 Cold shock domain-containing protein E1; cell-free 99.8
2yty_A88 Cold shock domain-containing protein E1; cell-free 99.8
1x65_A89 UNR protein; cell-free protein synthesis, beta-bar 99.79
2ytx_A97 Cold shock domain-containing protein E1; cell-free 99.77
1x65_A89 UNR protein; cell-free protein synthesis, beta-bar 99.75
2ytv_A79 Cold shock domain-containing protein E1; cell-free 99.73
2ytv_A79 Cold shock domain-containing protein E1; cell-free 99.73
2bh8_A101 1B11; transcription, molecular evolution, unique a 99.62
2bh8_A101 1B11; transcription, molecular evolution, unique a 99.52
2id0_A 644 Exoribonuclease 2; RNAse, exonuclease, hydrolyase, 98.43
3go5_A 285 Multidomain protein with S1 RNA-binding domains; s 97.85
3go5_A285 Multidomain protein with S1 RNA-binding domains; s 97.63
1a62_A130 RHO; transcription termination, termination, RNA b 97.45
2vnu_D 760 Exosome complex exonuclease RRP44; hydrolase-RNA c 97.38
1a62_A130 RHO; transcription termination, termination, RNA b 97.05
2wp8_J 977 Exosome complex exonuclease DIS3; nucleus, hydrola 96.76
2id0_A 644 Exoribonuclease 2; RNAse, exonuclease, hydrolyase, 95.79
3l0o_A 427 Transcription termination factor RHO; helicase, RH 93.52
2k52_A80 Uncharacterized protein MJ1198; metal-binding, zin 92.11
2cqo_A119 Nucleolar protein of 40 kDa; S1 domain, OB-fold, s 91.7
2k52_A80 Uncharacterized protein MJ1198; metal-binding, zin 91.5
2eqs_A103 ATP-dependent RNA helicase DHX8; S1 domain, OB-fol 90.27
2khi_A115 30S ribosomal protein S1; acetylation, phosphoprot 89.61
2k4k_A130 GSP13, general stress protein 13; cytoplasm, stres 89.31
3l0o_A 427 Transcription termination factor RHO; helicase, RH 89.06
2khi_A115 30S ribosomal protein S1; acetylation, phosphoprot 87.94
2bx2_L 517 Ribonuclease E, RNAse E; RNA-binding, RNA turnover 87.49
2k4k_A130 GSP13, general stress protein 13; cytoplasm, stres 87.4
2khj_A109 30S ribosomal protein S1; OB fold, acetylation, ph 87.08
3ice_A 422 Transcription termination factor RHO; transcriptio 86.13
2b8k_G215 B16, DNA-directed RNA polymerase II 19 kDa polypep 85.83
2eqs_A103 ATP-dependent RNA helicase DHX8; S1 domain, OB-fol 85.62
2cqo_A119 Nucleolar protein of 40 kDa; S1 domain, OB-fold, s 85.25
1y14_B171 B16, RPB7, DNA-directed RNA polymerase II 19 kDa p 84.0
2khj_A109 30S ribosomal protein S1; OB fold, acetylation, ph 83.71
2bx2_L 517 Ribonuclease E, RNAse E; RNA-binding, RNA turnover 83.59
3ice_A 422 Transcription termination factor RHO; transcriptio 83.01
1q8k_A 308 Eukaryotic translation initiation factor 2 subunit 82.76
2qcp_X80 Cation efflux system protein CUSF; silver-binding, 82.36
1y14_B171 B16, RPB7, DNA-directed RNA polymerase II 19 kDa p 81.99
2vb2_X88 Copper protein, cation efflux system protein CUSF; 81.97
2b8k_G215 B16, DNA-directed RNA polymerase II 19 kDa polypep 81.8
2l55_A82 SILB,silver efflux protein, MFP component of the c 81.75
2a19_A175 EIF-2- alpha, eukaryotic translation initiation fa 80.96
2a19_A175 EIF-2- alpha, eukaryotic translation initiation fa 80.23
2vnu_D 760 Exosome complex exonuclease RRP44; hydrolase-RNA c 80.01
>3ulj_A LIN28B, DNA-binding protein; beta barrel, cold shock domain fold, nucleic acid binding, D binding protein; 1.06A {Silurana} PDB: 4a4i_A Back     alignment and structure
Probab=99.93  E-value=6.6e-26  Score=158.68  Aligned_cols=78  Identities=40%  Similarity=0.667  Sum_probs=71.7

Q ss_pred             ceeeeeeEEEeecCCCceeEE-------eCCCCCcEEEeccchhccCcccccccCCCCCEEEEEEEEcCCCceeEEeecC
Q psy9900         107 VHTVRGIVKFYDSKRGFGFIT-------RLDNKEDIFVHKSSIVKMNPKKFFQSLGLGEIVDFNIGVGKKDIEAINVTGP  179 (191)
Q Consensus       107 ~~~~~G~Vk~~~~~kgfGFI~-------~~d~~~dvF~h~s~~~~~~~~~~~~~l~~G~~V~f~i~~~~kg~~A~~V~~~  179 (191)
                      ..+.+|+|||||..||||||+       ++++++|||||+|+|...    +++.|.+|++|+|++.+++||++|++|+.+
T Consensus         6 ~~r~tG~VKWFn~~KGfGFI~~~~~~~~p~dgg~DvFVH~s~i~~~----g~~~L~eG~~V~f~v~~g~kG~~A~~Vtg~   81 (90)
T 3ulj_A            6 VLRGSGHCKWFNVRMGFGFISMTSREGSPLENPVDVFVHQSKLYME----GFRSLKEGEPVEFTFKKSSKGFESLRVTGP   81 (90)
T ss_dssp             CEEEEEEEEEEETTTTEEEEEEEEETTEEEEEEEEEEEEGGGBCCS----SSCCCCTTCEEEEEEEEETTEEEEEEEECG
T ss_pred             ccccceEEEEeeCCCCeEEeEecCcCcCCCCCCccEEEEeehhccc----CCCccCCCCEEEEEEEECCCCcEEEEEECC
Confidence            457899999999999999998       456678999999999874    689999999999999999999999999999


Q ss_pred             CCCCCCCCC
Q psy9900         180 NGIPVQGAP  188 (191)
Q Consensus       180 ~~~~~~~~~  188 (191)
                      +|+|+++++
T Consensus        82 ~G~p~~gse   90 (90)
T 3ulj_A           82 GGNPCLGNE   90 (90)
T ss_dssp             GGCCCCCCC
T ss_pred             CCccccCCC
Confidence            999999985



>1h95_A CSD, Y-box binding protein; translation factor, transcription factor, OB-fold, 5- stranded anti-parallel beta-barrel, single stranded DNA binding; NMR {Homo sapiens} SCOP: b.40.4.5 Back     alignment and structure
>3ulj_A LIN28B, DNA-binding protein; beta barrel, cold shock domain fold, nucleic acid binding, D binding protein; 1.06A {Silurana} PDB: 4a4i_A Back     alignment and structure
>1h95_A CSD, Y-box binding protein; translation factor, transcription factor, OB-fold, 5- stranded anti-parallel beta-barrel, single stranded DNA binding; NMR {Homo sapiens} SCOP: b.40.4.5 Back     alignment and structure
>3i2z_B RNA chaperone, negative regulator of CSPA transcription; beta barrel, DNA binding protein/transcription, cytoplasm, gene regulation; 1.10A {Salmonella typhimurium} SCOP: b.40.4.5 PDB: 2l15_A 1mjc_A 3mef_A Back     alignment and structure
>3cam_A Cold-shock domain family protein; cold shock protein, chain SWAP, STRU genomics, oxford protein production facility, OPPF, gene RE; 2.60A {Neisseria meningitidis MC58} Back     alignment and structure
>3cam_A Cold-shock domain family protein; cold shock protein, chain SWAP, STRU genomics, oxford protein production facility, OPPF, gene RE; 2.60A {Neisseria meningitidis MC58} Back     alignment and structure
>3i2z_B RNA chaperone, negative regulator of CSPA transcription; beta barrel, DNA binding protein/transcription, cytoplasm, gene regulation; 1.10A {Salmonella typhimurium} SCOP: b.40.4.5 PDB: 2l15_A 1mjc_A 3mef_A Back     alignment and structure
>1c9o_A CSPB, cold-shock protein; beta barrel, homodimer, transcription; 1.17A {Bacillus caldolyticus} SCOP: b.40.4.5 PDB: 2hax_A 1hz9_A 1hzb_A 1i5f_A 1hza_A 1hzc_A 3pf4_A 1csq_A 1nmf_A 1nmg_A 1csp_A 2f52_A 2es2_A 3pf5_A 2i5m_X 2i5l_X Back     alignment and structure
>3a0j_A Cold shock protein; OB-fold, cytoplasm, transcription, structural genomics, NPPSFA; 1.65A {Thermus thermophilus} Back     alignment and structure
>1c9o_A CSPB, cold-shock protein; beta barrel, homodimer, transcription; 1.17A {Bacillus caldolyticus} SCOP: b.40.4.5 PDB: 2hax_A 1hz9_A 1hzb_A 1i5f_A 1hza_A 1hzc_A 3pf4_A 1csq_A 1nmf_A 1nmg_A 1csp_A 2f52_A 2es2_A 3pf5_A 2i5m_X 2i5l_X Back     alignment and structure
>3ts2_A Protein LIN-28 homolog A; microrna biogenesis, protein-RNA complex, PRE-element, CCHC knuckle; HET: GMP; 2.01A {Mus musculus} PDB: 3trz_A* 3ts0_A* Back     alignment and structure
>2kcm_A Cold shock domain family protein; nucleic acid binding protein, beta barrel, structural genomi 2, protein structure initiative; NMR {Shewanella oneidensis} Back     alignment and structure
>3a0j_A Cold shock protein; OB-fold, cytoplasm, transcription, structural genomics, NPPSFA; 1.65A {Thermus thermophilus} Back     alignment and structure
>2kcm_A Cold shock domain family protein; nucleic acid binding protein, beta barrel, structural genomi 2, protein structure initiative; NMR {Shewanella oneidensis} Back     alignment and structure
>1g6p_A Cold shock protein TMCSP; greek-KEY, beta barrel, OB-fold, structural genomics; NMR {Thermotoga maritima} SCOP: b.40.4.5 Back     alignment and structure
>2lss_A Cold shock-like protein; CSD, CSP, oligonucleotide binding F fold, RNA binding protein, DNA binding protein; NMR {Rickettsia rickettsii} Back     alignment and structure
>1g6p_A Cold shock protein TMCSP; greek-KEY, beta barrel, OB-fold, structural genomics; NMR {Thermotoga maritima} SCOP: b.40.4.5 Back     alignment and structure
>2k5n_A Putative cold-shock protein; GFT protein structure, PSI, nesgc, OB fold, cold shock structural genomics; NMR {Pectobacterium atrosepticum} Back     alignment and structure
>2k5n_A Putative cold-shock protein; GFT protein structure, PSI, nesgc, OB fold, cold shock structural genomics; NMR {Pectobacterium atrosepticum} Back     alignment and structure
>2lss_A Cold shock-like protein; CSD, CSP, oligonucleotide binding F fold, RNA binding protein, DNA binding protein; NMR {Rickettsia rickettsii} Back     alignment and structure
>3ts2_A Protein LIN-28 homolog A; microrna biogenesis, protein-RNA complex, PRE-element, CCHC knuckle; HET: GMP; 2.01A {Mus musculus} PDB: 3trz_A* 3ts0_A* Back     alignment and structure
>1wfq_A UNR protein; beta-barrel, translational regulation, RNA chaperone, RNA/DN binding, QB fold, greek-KEY topology, structur genomics; NMR {Homo sapiens} SCOP: b.40.4.5 Back     alignment and structure
>1wfq_A UNR protein; beta-barrel, translational regulation, RNA chaperone, RNA/DN binding, QB fold, greek-KEY topology, structur genomics; NMR {Homo sapiens} SCOP: b.40.4.5 Back     alignment and structure
>2yty_A Cold shock domain-containing protein E1; cell-free protein synthesis, beta-barrel, translational REGU RNA chaperone, RNA/DNA binding, QB fold; NMR {Homo sapiens} Back     alignment and structure
>3aqq_A Calcium-regulated heat stable protein 1; compact beta-barrel, cold shock domain, ssDNA binding, DNA B protein; 2.80A {Homo sapiens} Back     alignment and structure
>3aqq_A Calcium-regulated heat stable protein 1; compact beta-barrel, cold shock domain, ssDNA binding, DNA B protein; 2.80A {Homo sapiens} Back     alignment and structure
>2ytx_A Cold shock domain-containing protein E1; cell-free protein synthesis, beta-barrel, translational REGU RNA chaperone, RNA/DNA binding, QB fold; NMR {Homo sapiens} Back     alignment and structure
>2yty_A Cold shock domain-containing protein E1; cell-free protein synthesis, beta-barrel, translational REGU RNA chaperone, RNA/DNA binding, QB fold; NMR {Homo sapiens} Back     alignment and structure
>1x65_A UNR protein; cell-free protein synthesis, beta-barrel, translational REGU RNA chaperone, RNA/DNA binding, QB fold, greek-KEY topology protein; NMR {Homo sapiens} Back     alignment and structure
>2ytx_A Cold shock domain-containing protein E1; cell-free protein synthesis, beta-barrel, translational REGU RNA chaperone, RNA/DNA binding, QB fold; NMR {Homo sapiens} Back     alignment and structure
>1x65_A UNR protein; cell-free protein synthesis, beta-barrel, translational REGU RNA chaperone, RNA/DNA binding, QB fold, greek-KEY topology protein; NMR {Homo sapiens} Back     alignment and structure
>2ytv_A Cold shock domain-containing protein E1; cell-free protein synthesis, beta-barrel, translational REGU RNA chaperone, RNA/DNA binding, QB fold; NMR {Homo sapiens} Back     alignment and structure
>2ytv_A Cold shock domain-containing protein E1; cell-free protein synthesis, beta-barrel, translational REGU RNA chaperone, RNA/DNA binding, QB fold; NMR {Homo sapiens} Back     alignment and structure
>2bh8_A 1B11; transcription, molecular evolution, unique architecture, transcription regulation, phosphorylation; 1.9A {Escherichia coli} Back     alignment and structure
>2bh8_A 1B11; transcription, molecular evolution, unique architecture, transcription regulation, phosphorylation; 1.9A {Escherichia coli} Back     alignment and structure
>2id0_A Exoribonuclease 2; RNAse, exonuclease, hydrolyase, mRNA decay, RNR family, hydrolase; 2.35A {Escherichia coli} SCOP: b.40.4.5 b.40.4.5 b.40.4.5 b.40.4.16 PDB: 2ix0_A* 2ix1_A Back     alignment and structure
>3go5_A Multidomain protein with S1 RNA-binding domains; structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.40A {Streptococcus pneumoniae} Back     alignment and structure
>3go5_A Multidomain protein with S1 RNA-binding domains; structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.40A {Streptococcus pneumoniae} Back     alignment and structure
>1a62_A RHO; transcription termination, termination, RNA binding domain, transcription regulation, OB fold, F1-ATPase; 1.55A {Escherichia coli BL21} SCOP: a.140.3.1 b.40.4.5 PDB: 1a63_A 2a8v_A 1a8v_A Back     alignment and structure
>2vnu_D Exosome complex exonuclease RRP44; hydrolase-RNA complex, RNA degradation, RNA-binding, RNA Pro; HET: 1PE; 2.30A {Saccharomyces cerevisiae} SCOP: b.40.4.5 b.40.4.5 b.40.4.5 b.40.4.16 Back     alignment and structure
>1a62_A RHO; transcription termination, termination, RNA binding domain, transcription regulation, OB fold, F1-ATPase; 1.55A {Escherichia coli BL21} SCOP: a.140.3.1 b.40.4.5 PDB: 1a63_A 2a8v_A 1a8v_A Back     alignment and structure
>2wp8_J Exosome complex exonuclease DIS3; nucleus, hydrolase, RNA-binding, exonucle binding, mitochondrion, rRNA processing; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2id0_A Exoribonuclease 2; RNAse, exonuclease, hydrolyase, mRNA decay, RNR family, hydrolase; 2.35A {Escherichia coli} SCOP: b.40.4.5 b.40.4.5 b.40.4.5 b.40.4.16 PDB: 2ix0_A* 2ix1_A Back     alignment and structure
>3l0o_A Transcription termination factor RHO; helicase, RHO factor, RNA capture mechanism, ATP-binding, hydrolase, nucleotide-binding, RN binding; 2.35A {Thermotoga maritima} Back     alignment and structure
>2k52_A Uncharacterized protein MJ1198; metal-binding, zinc, zinc-finger, structural genomics, PSI-2, protein structure initiative; NMR {Methanocaldococcus jannaschii} Back     alignment and structure
>2cqo_A Nucleolar protein of 40 kDa; S1 domain, OB-fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2k52_A Uncharacterized protein MJ1198; metal-binding, zinc, zinc-finger, structural genomics, PSI-2, protein structure initiative; NMR {Methanocaldococcus jannaschii} Back     alignment and structure
>2eqs_A ATP-dependent RNA helicase DHX8; S1 domain, OB-fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2khi_A 30S ribosomal protein S1; acetylation, phosphoprotein, ribonucleoprotein, RNA-binding; NMR {Escherichia coli} Back     alignment and structure
>2k4k_A GSP13, general stress protein 13; cytoplasm, stress response, RNA binding protein; NMR {Bacillus subtilis} Back     alignment and structure
>3l0o_A Transcription termination factor RHO; helicase, RHO factor, RNA capture mechanism, ATP-binding, hydrolase, nucleotide-binding, RN binding; 2.35A {Thermotoga maritima} Back     alignment and structure
>2khi_A 30S ribosomal protein S1; acetylation, phosphoprotein, ribonucleoprotein, RNA-binding; NMR {Escherichia coli} Back     alignment and structure
>2bx2_L Ribonuclease E, RNAse E; RNA-binding, RNA turnover, RNA processing, hydrolase, endonu nuclease; 2.85A {Escherichia coli} PDB: 2c0b_L 2c4r_L 2vmk_A 2vrt_A 1slj_A 1smx_A 1sn8_A Back     alignment and structure
>2k4k_A GSP13, general stress protein 13; cytoplasm, stress response, RNA binding protein; NMR {Bacillus subtilis} Back     alignment and structure
>2khj_A 30S ribosomal protein S1; OB fold, acetylation, phosphoprotein, ribonucleoprotein, RNA-binding; NMR {Escherichia coli} Back     alignment and structure
>3ice_A Transcription termination factor RHO; transcription, ATPase, hexamer, helicase, RNA, RECA, OB fold ATP-binding, hydrolase; HET: MSE ADP SPD; 2.80A {Escherichia coli k-12} PDB: 1pv4_A 1pvo_A* 1xpo_A* 1xpr_A* 1xpu_A* 2ht1_A Back     alignment and structure
>2b8k_G B16, DNA-directed RNA polymerase II 19 kDa polypeptide; DNA-dependent RNA polymerase, cellular RNA polymerase; 4.15A {Saccharomyces cerevisiae} SCOP: b.40.4.5 d.230.1.1 Back     alignment and structure
>2eqs_A ATP-dependent RNA helicase DHX8; S1 domain, OB-fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cqo_A Nucleolar protein of 40 kDa; S1 domain, OB-fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1y14_B B16, RPB7, DNA-directed RNA polymerase II 19 kDa polypeptide; transferase; 2.30A {Saccharomyces cerevisiae} SCOP: b.40.4.5 d.230.1.1 PDB: 1nt9_G 1wcm_G 1pqv_G 1y1v_G 1y1w_G 1y1y_G 1y77_G* 2b63_G* 2ja5_G* 2ja6_G* 2ja7_G* 2ja8_G* 2r7z_G 2r92_G 2r93_G 2vum_G* 3fki_G 3h3v_H 3hou_G* 3hov_G* ... Back     alignment and structure
>2khj_A 30S ribosomal protein S1; OB fold, acetylation, phosphoprotein, ribonucleoprotein, RNA-binding; NMR {Escherichia coli} Back     alignment and structure
>2bx2_L Ribonuclease E, RNAse E; RNA-binding, RNA turnover, RNA processing, hydrolase, endonu nuclease; 2.85A {Escherichia coli} PDB: 2c0b_L 2c4r_L 2vmk_A 2vrt_A 1slj_A 1smx_A 1sn8_A Back     alignment and structure
>3ice_A Transcription termination factor RHO; transcription, ATPase, hexamer, helicase, RNA, RECA, OB fold ATP-binding, hydrolase; HET: MSE ADP SPD; 2.80A {Escherichia coli k-12} PDB: 1pv4_A 1pvo_A* 1xpo_A* 1xpr_A* 1xpu_A* 2ht1_A Back     alignment and structure
>1q8k_A Eukaryotic translation initiation factor 2 subunit 1; NMR {Homo sapiens} SCOP: a.60.14.1 b.40.4.5 d.58.51.1 Back     alignment and structure
>2qcp_X Cation efflux system protein CUSF; silver-binding, copper-binding, beta barrel, OB-fold, metall metal resistance, metal-binding; 1.00A {Escherichia coli str} PDB: 1zeq_X 3e6z_X Back     alignment and structure
>1y14_B B16, RPB7, DNA-directed RNA polymerase II 19 kDa polypeptide; transferase; 2.30A {Saccharomyces cerevisiae} SCOP: b.40.4.5 d.230.1.1 PDB: 1nt9_G 1wcm_G 1pqv_G 1y1v_G 1y1w_G 1y1y_G 1y77_G* 2b63_G* 2ja5_G* 2ja6_G* 2ja7_G* 2ja8_G* 2r7z_G 2r92_G 2r93_G 2vum_G* 3fki_G 3h3v_H 3hou_G* 3hov_G* ... Back     alignment and structure
>2vb2_X Copper protein, cation efflux system protein CUSF; cation PI, metal-binding, metal transport, copper tolerance, transport; 1.70A {Escherichia coli} PDB: 2vb3_X Back     alignment and structure
>2b8k_G B16, DNA-directed RNA polymerase II 19 kDa polypeptide; DNA-dependent RNA polymerase, cellular RNA polymerase; 4.15A {Saccharomyces cerevisiae} SCOP: b.40.4.5 d.230.1.1 Back     alignment and structure
>2l55_A SILB,silver efflux protein, MFP component of the components proton antiporter metal...; APO form, AG(I)-binding site; NMR {Cupriavidus metallidurans} Back     alignment and structure
>2a19_A EIF-2- alpha, eukaryotic translation initiation factor 2 alpha; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Saccharomyces cerevisiae} PDB: 2a1a_A* 1q46_A Back     alignment and structure
>2a19_A EIF-2- alpha, eukaryotic translation initiation factor 2 alpha; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Saccharomyces cerevisiae} PDB: 2a1a_A* 1q46_A Back     alignment and structure
>2vnu_D Exosome complex exonuclease RRP44; hydrolase-RNA complex, RNA degradation, RNA-binding, RNA Pro; HET: 1PE; 2.30A {Saccharomyces cerevisiae} SCOP: b.40.4.5 b.40.4.5 b.40.4.5 b.40.4.16 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 191
d1h95a_79 b.40.4.5 (A:) Y-box protein 1 cold shock domain (Y 4e-20
d1h95a_79 b.40.4.5 (A:) Y-box protein 1 cold shock domain (Y 6e-20
d1mjca_69 b.40.4.5 (A:) Major cold shock protein {Escherichi 2e-14
d1mjca_69 b.40.4.5 (A:) Major cold shock protein {Escherichi 2e-14
d1c9oa_66 b.40.4.5 (A:) Major cold shock protein {Bacillus c 1e-11
d1c9oa_66 b.40.4.5 (A:) Major cold shock protein {Bacillus c 1e-11
d1g6pa_66 b.40.4.5 (A:) Major cold shock protein {Thermotoga 1e-11
d1g6pa_66 b.40.4.5 (A:) Major cold shock protein {Thermotoga 1e-11
d1wfqa_89 b.40.4.5 (A:) Cold shock domain protein E1 (UNR) { 8e-08
d1wfqa_89 b.40.4.5 (A:) Cold shock domain protein E1 (UNR) { 8e-08
>d1h95a_ b.40.4.5 (A:) Y-box protein 1 cold shock domain (YB1-CSD) {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure

class: All beta proteins
fold: OB-fold
superfamily: Nucleic acid-binding proteins
family: Cold shock DNA-binding domain-like
domain: Y-box protein 1 cold shock domain (YB1-CSD)
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 77.9 bits (192), Expect = 4e-20
 Identities = 38/78 (48%), Positives = 55/78 (70%)

Query: 1  MTKFEIHTVRGIVKFYDSKRGFGFITRLDNKEDIFVHKSSIVKMNPKKFFQSLGLGEIVD 60
          M K     V G VK+++ + G+GFI R D KED+FVH+++I K NP+K+ +S+G GE V+
Sbjct: 1  MKKVIATKVLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVE 60

Query: 61 FNIGVGKKDIEAINVTGP 78
          F++  G+K  EA NVTGP
Sbjct: 61 FDVVEGEKGAEAANVTGP 78


>d1h95a_ b.40.4.5 (A:) Y-box protein 1 cold shock domain (YB1-CSD) {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1mjca_ b.40.4.5 (A:) Major cold shock protein {Escherichia coli [TaxId: 562]} Length = 69 Back     information, alignment and structure
>d1mjca_ b.40.4.5 (A:) Major cold shock protein {Escherichia coli [TaxId: 562]} Length = 69 Back     information, alignment and structure
>d1c9oa_ b.40.4.5 (A:) Major cold shock protein {Bacillus caldolyticus [TaxId: 1394]} Length = 66 Back     information, alignment and structure
>d1c9oa_ b.40.4.5 (A:) Major cold shock protein {Bacillus caldolyticus [TaxId: 1394]} Length = 66 Back     information, alignment and structure
>d1g6pa_ b.40.4.5 (A:) Major cold shock protein {Thermotoga maritima [TaxId: 2336]} Length = 66 Back     information, alignment and structure
>d1g6pa_ b.40.4.5 (A:) Major cold shock protein {Thermotoga maritima [TaxId: 2336]} Length = 66 Back     information, alignment and structure
>d1wfqa_ b.40.4.5 (A:) Cold shock domain protein E1 (UNR) {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d1wfqa_ b.40.4.5 (A:) Cold shock domain protein E1 (UNR) {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query191
d1h95a_79 Y-box protein 1 cold shock domain (YB1-CSD) {Human 99.92
d1h95a_79 Y-box protein 1 cold shock domain (YB1-CSD) {Human 99.91
d1mjca_69 Major cold shock protein {Escherichia coli [TaxId: 99.9
d1mjca_69 Major cold shock protein {Escherichia coli [TaxId: 99.9
d1c9oa_66 Major cold shock protein {Bacillus caldolyticus [T 99.87
d1g6pa_66 Major cold shock protein {Thermotoga maritima [Tax 99.87
d1g6pa_66 Major cold shock protein {Thermotoga maritima [Tax 99.86
d1c9oa_66 Major cold shock protein {Bacillus caldolyticus [T 99.86
d1wfqa_89 Cold shock domain protein E1 (UNR) {Human (Homo sa 99.68
d1wfqa_89 Cold shock domain protein E1 (UNR) {Human (Homo sa 99.67
d2ix0a279 Exoribonuclease 2, RNB {Escherichia coli [TaxId: 5 98.14
d2ix0a279 Exoribonuclease 2, RNB {Escherichia coli [TaxId: 5 98.03
d1a62a278 Rho termination factor, RNA-binding domain {Escher 97.0
d1a62a278 Rho termination factor, RNA-binding domain {Escher 96.75
d2ix0a190 Exoribonuclease 2, RNB {Escherichia coli [TaxId: 5 96.55
d1sroa_76 S1 RNA-binding domain of polyribonucleotide phosph 92.62
d1kl9a286 Eukaryotic initiation factor 2alpha, eIF2alpha, N- 92.15
d1smxa_87 S1-domain of Ribonuclease E {Escherichia coli [Tax 91.67
d1kl9a286 Eukaryotic initiation factor 2alpha, eIF2alpha, N- 91.55
d1sroa_76 S1 RNA-binding domain of polyribonucleotide phosph 90.83
d2ix0a190 Exoribonuclease 2, RNB {Escherichia coli [TaxId: 5 90.29
d2ba0a183 S1-domain of exosome complex RNA-binding protein 1 89.61
d3bzka494 Tex S1-domain {Pseudomonas aeruginosa [TaxId: 287] 88.87
d2ahob284 Eukaryotic initiation factor 2alpha, eIF2alpha, N- 88.47
d1wi5a_119 S1-domain of RRP5 protein homolog (PDCD11, KIAA018 86.34
d3bzka494 Tex S1-domain {Pseudomonas aeruginosa [TaxId: 287] 85.23
d1go3e1106 C-terminal domain of RNA polymerase II subunit RBP 84.15
d1smxa_87 S1-domain of Ribonuclease E {Escherichia coli [Tax 83.84
d2ba0a183 S1-domain of exosome complex RNA-binding protein 1 83.44
d2je6i187 S1-domain of exosome complex RNA-binding protein 1 82.05
d1u0la166 Probable GTPase EngC (YjeQ), N-terminal domain {Th 81.71
d2ahob284 Eukaryotic initiation factor 2alpha, eIF2alpha, N- 80.1
d1go3e1106 C-terminal domain of RNA polymerase II subunit RBP 80.09
>d1h95a_ b.40.4.5 (A:) Y-box protein 1 cold shock domain (YB1-CSD) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All beta proteins
fold: OB-fold
superfamily: Nucleic acid-binding proteins
family: Cold shock DNA-binding domain-like
domain: Y-box protein 1 cold shock domain (YB1-CSD)
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.92  E-value=5.4e-26  Score=154.13  Aligned_cols=78  Identities=49%  Similarity=0.856  Sum_probs=71.5

Q ss_pred             CceeceeccceEEEEeeCCCCeeEEEeCCCCccEEEEeeeheecCCCCCcccCCCCCEEEEEEEEcCCCceeeEeecC
Q psy9900           1 MTKFEIHTVRGIVKFYDSKRGFGFITRLDNKEDIFVHKSSIVKMNPKKFFQSLGLGEIVDFNIGVGKKDIEAINVTGP   78 (191)
Q Consensus         1 ~~~~~~~~~~G~vk~~~~~kGfGFI~~~~~~~dvFvh~s~l~~~~~~~g~~~l~~Gd~V~f~~~~~~~g~~A~~v~~~   78 (191)
                      |.++|+.+.+|+|||||..||||||.++++++|||||+|+|........++.|.+|++|+|++..+++|++|.+|+.|
T Consensus         1 ~~k~~~~r~~G~VKwfn~~KGfGFI~~ddg~~DvFvH~s~i~~~g~~~~~~~L~~G~~V~f~~~~~~~G~~A~~Vtgp   78 (79)
T d1h95a_           1 MKKVIATKVLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGP   78 (79)
T ss_dssp             CCSCCEEEEEEEEEEEETTTTEEEEEEGGGTEEEEEEGGGBCSCCCSCCSCSCCSSCEEEEEEEECSSSEEEESBCCC
T ss_pred             CchHhcCcccEEEEEEcCCCCeEEEEECCCCccEEEEhhHcccCCCcceeeecCCCCEEEEEEEeCCCCCeeEEEeCC
Confidence            899999999999999999999999999998899999999998763333478899999999999999999999999875



>d1h95a_ b.40.4.5 (A:) Y-box protein 1 cold shock domain (YB1-CSD) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mjca_ b.40.4.5 (A:) Major cold shock protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mjca_ b.40.4.5 (A:) Major cold shock protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1c9oa_ b.40.4.5 (A:) Major cold shock protein {Bacillus caldolyticus [TaxId: 1394]} Back     information, alignment and structure
>d1g6pa_ b.40.4.5 (A:) Major cold shock protein {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1g6pa_ b.40.4.5 (A:) Major cold shock protein {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1c9oa_ b.40.4.5 (A:) Major cold shock protein {Bacillus caldolyticus [TaxId: 1394]} Back     information, alignment and structure
>d1wfqa_ b.40.4.5 (A:) Cold shock domain protein E1 (UNR) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfqa_ b.40.4.5 (A:) Cold shock domain protein E1 (UNR) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ix0a2 b.40.4.5 (A:4-82) Exoribonuclease 2, RNB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ix0a2 b.40.4.5 (A:4-82) Exoribonuclease 2, RNB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a62a2 b.40.4.5 (A:48-125) Rho termination factor, RNA-binding domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a62a2 b.40.4.5 (A:48-125) Rho termination factor, RNA-binding domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ix0a1 b.40.4.5 (A:83-172) Exoribonuclease 2, RNB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sroa_ b.40.4.5 (A:) S1 RNA-binding domain of polyribonucleotide phosphorylase, PNPase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kl9a2 b.40.4.5 (A:3-88) Eukaryotic initiation factor 2alpha, eIF2alpha, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1smxa_ b.40.4.5 (A:) S1-domain of Ribonuclease E {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kl9a2 b.40.4.5 (A:3-88) Eukaryotic initiation factor 2alpha, eIF2alpha, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sroa_ b.40.4.5 (A:) S1 RNA-binding domain of polyribonucleotide phosphorylase, PNPase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ix0a1 b.40.4.5 (A:83-172) Exoribonuclease 2, RNB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ba0a1 b.40.4.5 (A:53-135) S1-domain of exosome complex RNA-binding protein 1, ECR1 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d3bzka4 b.40.4.5 (A:637-730) Tex S1-domain {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2ahob2 b.40.4.5 (B:1-84) Eukaryotic initiation factor 2alpha, eIF2alpha, N-terminal domain {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1wi5a_ b.40.4.5 (A:) S1-domain of RRP5 protein homolog (PDCD11, KIAA0185) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3bzka4 b.40.4.5 (A:637-730) Tex S1-domain {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1go3e1 b.40.4.5 (E:79-184) C-terminal domain of RNA polymerase II subunit RBP7 (RpoE) {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1smxa_ b.40.4.5 (A:) S1-domain of Ribonuclease E {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ba0a1 b.40.4.5 (A:53-135) S1-domain of exosome complex RNA-binding protein 1, ECR1 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2je6i1 b.40.4.5 (I:66-152) S1-domain of exosome complex RNA-binding protein 1, ECR1 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1u0la1 b.40.4.5 (A:3-68) Probable GTPase EngC (YjeQ), N-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2ahob2 b.40.4.5 (B:1-84) Eukaryotic initiation factor 2alpha, eIF2alpha, N-terminal domain {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1go3e1 b.40.4.5 (E:79-184) C-terminal domain of RNA polymerase II subunit RBP7 (RpoE) {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure