Diaphorina citri psyllid: psy9901

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390

MMVRTRTPLEYRAVHCDLIRLNNTDHIVHTSDISISDKNIVGTQIFGYENPCKTCHPSSKLKNSKEVQGYVVKKNNNLNRKDEWLLLGKRDPLTPQMFYPVEVNVTIHKGDVMAARCVMKNYRNHETYVGSTGQDEMCNFYLMYWVENSSPLETKYCFSEGPPNYYWGMGDNLNNIPHPGPIIYAWARDAPSLILPEGVGFKVGGDTAIQYLVLQVHYAHVEGFRDGHTDSSGVFLQYTRRPLTKEAGVLLLGTGGKIPALSVENMETSCIMMEDKEIHPFAYRTHTHALGKEVQGYVVKKNNNLNRKDEWLLLGKRDPLTPQMFYPVEVNVTIHKGQDEMCNFYLMYWVENSSPLETKYCFSEGPPNYYWGMGDNLNNIPHPGPVSNLI

cccccccccEEEEEEccccccccccEEEECcccccccccCEEEEEEEECccccCEEEccccccCEEEEEEEEECcccccccccEEEEEEcccccccccccccccEEEccccEEEEEEEEEccccEEEEECcccccccEEEEEEEEEcccccccccccccccccccccccccccccccccccEEEEEccccccccccccccEEEccccccEEEEEEEEEccccccccccccccEEEEEEECccccEEEEEEEEccccccccccccccccEEEccccccEEEEEEEcHHccccEEEEEEEEEccccccccccEEEEccccccccCEEECcccEEEEEEccccccccEEEEEEcccccccccccccccccccccccccccccccccccccccc

*****RTPLEYRAVHCDLIRLNNTDHIVHTSDISISDKNIVGTQIFGYENPCKTCHPSSKLKNSKEVQGYVVKKNNNLNRKDEWLLLGKRDPLTPQMFYPVEVNVTIHKGDVMAARCVMKNYRNHETYVGSTGQDEMCNFYLMYWVENSSPLETKYCFSEGPPNYYWGMGDNLNNIPHPGPIIYAWARDAPSLILPEGVGFKVGGDTAIQYLVLQVHYAHVEGFRDGHTDSSGVFLQYTRRPLTKEAGVLLLGTGGKIPALSVENMETSCIMMEDKEIHPFAYRTHTHALGKEVQGYVVKKNNNLNRKDEWLLLGKRDPLTPQMFYPVEVNVTIHKGQDEMCNFYLMYWVENSSPLETKYCFSEGPPNYYWGMGDNLNNIPHP*******

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Peptidylglycine alpha-hydroxylating monooxygenase	Monooxygenase that catalyzes an essential reaction in C-terminal alpha-amidation of peptides. Produces an unstable peptidyl(2-hydroxyglycine) intermediate. C-terminal amidation of peptides is required for normal developmental transitions and for biosynthesis of secretory peptides throughout the life.	confident	O01404

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0005615 [CC]	extracellular space	probable	GO:0005575, GO:0005576, GO:0044421

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1YI9, chain A
Confidence level:very confident
Coverage over the Query: 98-150,162-329,340-378
View the alignment between query and template
View the model in PyMOL

Template: 1YI9, chain A
Confidence level:very confident
Coverage over the Query: 14-122,136-173
View the alignment between query and template
View the model in PyMOL