Diaphorina citri psyllid: psy9907


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110------
MLLIPSVLYISGDARANENTHLTSMHLLLARQHNTLHLSFFSVVFIRYKRGDARANENTHLTSMHLLLARQHNTLARQLVTLNPDWDDETVYQESRRILGAQMQHVTSLENYLCDK
cCECcccccccccHHHHccccccccccccccccccccccccccccccEEcccccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHEEEccccccc
MLLIPSVLYISGDARANENTHLTSMHLLLARQHNTLHLSFFSVVFIRYKRGDARANENTHLTSMHLLLARQHNTLARQLVTLNPDWDDETVYQESRRILGAQMQHVTSLENYLCD*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLLIPSVLYISGDARANENTHLTSMHLLLARQHNTLHLSFFSVVFIRYKRGDARANENTHLTSMHLLLARQHNTLARQLVTLNPDWDDETVYQESRRILGAQMQHVTSLENYLCDK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Peroxidasin homolog Displays low peroxidase activity and is likely to participate in H(2)O(2) metabolism and peroxidative reactions in the cardiovascular system. Plays a role in extracellular matrix formation.confidentQ92626
Peroxidasin homolog Displays low peroxidase activity and is likely to participate in H(2)O(2) metabolism and peroxidative reactions in the cardiovascular system (By similarity). Plays a role in extracellular matrix formation.confidentQ3UQ28
Peroxidasin confidentA4IGL7

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0004601 [MF]peroxidase activityprobableGO:0003824, GO:0016209, GO:0016684, GO:0003674, GO:0016491
GO:0005783 [CC]endoplasmic reticulumprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0071944 [CC]cell peripheryprobableGO:0005575, GO:0044464, GO:0005623
GO:0005615 [CC]extracellular spaceprobableGO:0005575, GO:0005576, GO:0044421
GO:0005764 [CC]lysosomeprobableGO:0005737, GO:0000323, GO:0043231, GO:0005773, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0020037 [MF]heme bindingprobableGO:0005488, GO:0097159, GO:0003674, GO:1901363, GO:0046906
GO:0030141 [CC]secretory granuleprobableGO:0005737, GO:0031982, GO:0016023, GO:0031410, GO:0044464, GO:0044444, GO:0005623, GO:0031988, GO:0005575, GO:0043229, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0043231
GO:0050794 [BP]regulation of cellular processprobableGO:0008150, GO:0065007, GO:0050789
GO:0048519 [BP]negative regulation of biological processprobableGO:0008150, GO:0065007, GO:0050789
GO:0055114 [BP]oxidation-reduction processprobableGO:0044710, GO:0008150, GO:0008152
GO:0002376 [BP]immune system processprobableGO:0008150
GO:0034374 [BP]low-density lipoprotein particle remodelingprobableGO:0071825, GO:0071827, GO:0044707, GO:0034367, GO:0034368, GO:0034369, GO:0016043, GO:0008150, GO:0043933, GO:0032501, GO:0097006, GO:0071840, GO:0065007, GO:0050789, GO:0044699
GO:0006952 [BP]defense responseprobableGO:0006950, GO:0008150, GO:0050896
GO:0044711 [BP]single-organism biosynthetic processprobableGO:0009058, GO:0008150, GO:0044710, GO:0008152
GO:0031012 [CC]extracellular matrixprobableGO:0005575
GO:0005739 [CC]mitochondrionprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0005201 [MF]extracellular matrix structural constituentprobableGO:0003674, GO:0005198
GO:0009617 [BP]response to bacteriumprobableGO:0008150, GO:0009607, GO:0050896, GO:0051707, GO:0051704
GO:0030198 [BP]extracellular matrix organizationprobableGO:0009987, GO:0016043, GO:0044763, GO:0044699, GO:0043062, GO:0008150, GO:0071840
GO:0042744 [BP]hydrogen peroxide catabolic processprobableGO:0000302, GO:0044248, GO:0042743, GO:0070887, GO:0044699, GO:0051716, GO:0070301, GO:0009987, GO:0034614, GO:0072593, GO:0006950, GO:0008150, GO:0008152, GO:0042221, GO:0034599, GO:0010035, GO:0009056, GO:0006979, GO:1901700, GO:1901701, GO:0042542, GO:0050896, GO:0044237, GO:0033554, GO:0044763
GO:0008201 [MF]heparin bindingprobableGO:0043168, GO:1901681, GO:0097367, GO:0043167, GO:0005539, GO:0003674, GO:0005488
GO:0007306 [BP]eggshell chorion assemblyprobableGO:0048610, GO:0030154, GO:0048468, GO:0019953, GO:0010927, GO:0007292, GO:0007304, GO:0007276, GO:0009653, GO:0044699, GO:0000003, GO:0030703, GO:0030707, GO:0016043, GO:0032989, GO:0071840, GO:0048477, GO:0048646, GO:0032502, GO:0032501, GO:0048609, GO:0032504, GO:0009987, GO:0044767, GO:0022414, GO:0008150, GO:0022412, GO:0044702, GO:0003006, GO:0048856, GO:0048869, GO:0044763

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1D2V, chain C
Confidence level:very confident
Coverage over the Query: 2-114
View the alignment between query and template
View the model in PyMOL