Diaphorina citri psyllid: psy9936

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-----

MTKQFDLDLQFGIYRMNYTKNGRHLLLGGKRGHVAAFDWVRKTLACEMNVMEEVYDIKWLHLETMFAVAQKDWVYIYDNQGIELHCLKVLNKVTRMEFLPYHFLLATASEEGYLSWLDTSIGKIVSDFSAKKGKLSVMTQNPYNACICLGHRNGTVTMWSPTVQKPLASLLCHKAGIQSVAVNHTGTYMATSAGDSQLRIWDVRNLEGPLNTFRTRTPINNLAFSQRGLLATSRGNIVEFLKPPEINFEPRRKANKAGGSVQRAKVKKIVRETAKKDFIQSTKALGVKEIVKSLTGAPDKNPDVEKPKSVLDRFR

cccEEEEcccccEEEEEEcccccEEEEEcccccEEEEEcccccEEEEEcccccEEEEEEcccccEEEEEEccEEEEEEccccEEEEEcccccCEEEECcccccEEEEEcccccEEEEEcccccEEEEECcccccCEEEECcccccEEEEECccccEEEEcccccccEEEEEcccccEEEEEEcccccEEEEECccccEEEEEcccccccEEEccccccCEEEEEcccccEEEEcccEEEEEccccccccccccccccccccCEEEEEEcccEEEEcEEEEEEEEccEEEEEEECccccccccccccccccccccc

*TKQFDLDLQFGIYRMNYTKNGRHLLLGGKRGHVAAFDWVRKTLACEMNVMEEVYDIKWLHLETMFAVAQKDWVYIYDNQGIELHCLKVLNKVTRMEFLPYHFLLATASEEGYLSWLDTSIGKIVSDFSAKKGKLSVMTQNPYNACICLGHRNGTVTMWSPTVQKPLASLLCHKAGIQSVAVNHTGTYMATSAGDSQLRIWDVRNLEGPLNTFRTRTPINNLAFSQRGLLATSRGNIVEFLKPPEINFEPRRKANKAGGSVQRAKVKKIVRETAKKDFIQSTKALGVKEIVKSLTGAPDKNPDVEKPKSV*****

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
WD repeat-containing protein 46		confident	Q9Z0H1
WD repeat-containing protein 46		confident	O15213
WD repeat-containing protein 46		confident	Q5TJE7

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0043232 [CC]	intracellular non-membrane-bounded organelle	probable	GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0043228, GO:0044424, GO:0043226
GO:0044446 [CC]	intracellular organelle part	probable	GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043226, GO:0044422
GO:0005737 [CC]	cytoplasm	probable	GO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2XZM, chain R
Confidence level:very confident
Coverage over the Query: 4-268
View the alignment between query and template
View the model in PyMOL