Diaphorina citri psyllid: psy9944


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180---
MSEGSMSEGIYRRSGSTTNVSKLLAEFRQDAWQVQLSREQYTEHDVSTVLKRFFRDLPEPLLSTELHVHLCNAAGMECATEDKVHIYRSLLEKLHPIHYVTVRKLMGHLYFIQEKKDRNKMSVENLASIWGPTLMHVENWTTVIVVTYYQVKGPSSPIPAVGIITIILSESVLESHKFETSRI
ccccccccccccccccHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHcccccccHHHHHHHHHHHcccccHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHccccccccccccEEECcccccccccccHHHHHHHHHcccccccccccEEEEEEcccccccccccccccc
***GSMSEGIYRRSGSTTNVSKLLAEFRQDAWQVQLSREQYTEHDVSTVLKRFFRDLPEPLLSTELHVHLCNAAGMECATEDKVHIYRSLLEKLHPIHYVTVRKLMGHLYFIQEKKDRNKMSVENLASIWGPTLMHVENWTTVIVVTYYQVKGPSSPIPAVGIITIILSESVL**********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSEGSMSEGIYRRSGSTTNVSKLLAEFRQDAWQVQLSREQYTEHDVSTVLKRFFRDLPEPLLSTELHVHLCNAAGMECATEDKVHIYRSLLEKLHPIHYVTVRKLMGHLYFIQEKKDRNKMSVENLASIWGPTLMHVENWTTVIVVTYYQVKGPSSPIPAVGIITIILSESVLESHKFETSRI

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0008360 [BP]regulation of cell shapeprobableGO:0022604, GO:0022603, GO:0050793, GO:0051128, GO:0065007, GO:0008150, GO:0065008, GO:0050789, GO:0050794
GO:0005488 [MF]bindingprobableGO:0003674
GO:0035556 [BP]intracellular signal transductionprobableGO:0044700, GO:0051716, GO:0050896, GO:0009987, GO:0050794, GO:0008150, GO:0065007, GO:0044763, GO:0007165, GO:0023052, GO:0007154, GO:0050789, GO:0044699
GO:0031252 [CC]cell leading edgeprobableGO:0005575, GO:0044464, GO:0005623
GO:0030675 [MF]Rac GTPase activator activityprobableGO:0005099, GO:0005083, GO:0005096, GO:0030695, GO:0003674, GO:0008047, GO:0005100, GO:0060589, GO:0030234
GO:0032855 [BP]positive regulation of Rac GTPase activityprobableGO:0009894, GO:0019220, GO:0080090, GO:0019222, GO:0035023, GO:0046578, GO:0023051, GO:0010646, GO:0043087, GO:0050789, GO:0043085, GO:0032319, GO:0032318, GO:0043547, GO:0051345, GO:0009966, GO:0031323, GO:0030811, GO:0065007, GO:0044093, GO:0065009, GO:0051056, GO:0033121, GO:0033124, GO:0019219, GO:0048583, GO:0050790, GO:0050794, GO:0051174, GO:0008150, GO:0051171, GO:0009118, GO:0051336, GO:1900542, GO:0032320, GO:0032321, GO:0031329, GO:0006140
GO:0042995 [CC]cell projectionprobableGO:0005575, GO:0044464, GO:0005623
GO:0043231 [CC]intracellular membrane-bounded organelleprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0043089 [BP]positive regulation of Cdc42 GTPase activityprobableGO:0009894, GO:0019220, GO:0080090, GO:0019222, GO:0035023, GO:0046578, GO:0043088, GO:0023051, GO:0010646, GO:0043087, GO:0050789, GO:0043085, GO:0032319, GO:0032318, GO:0043547, GO:0051345, GO:0009966, GO:0031323, GO:0030811, GO:0065007, GO:0044093, GO:0065009, GO:0051056, GO:0033121, GO:0033124, GO:0019219, GO:0048583, GO:0050790, GO:0050794, GO:0051174, GO:0008150, GO:0051171, GO:0032489, GO:0009118, GO:0051336, GO:1900542, GO:0032320, GO:0032321, GO:0031329, GO:0006140
GO:0005938 [CC]cell cortexprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0071944, GO:0044424
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1F7C, chain A
Confidence level:very confident
Coverage over the Query: 2-157
View the alignment between query and template
View the model in PyMOL