Diaphorina citri psyllid: psy9955


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60
MQRFVQGINPEDARTFEERSMLEDAKFWLSSGCLGDVPNPKTGASALHVAAAKGYIKVMK
ccHHHccccHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHccHHHHHc
***FVQGINPEDARTFEERSMLEDAKFWLSSGCLGDVPNPKTGASALHVAAAKGYIKVMK
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQRFVQGINPEDARTFEERSMLEDAKFWLSSGCLGDVPNPKTGASALHVAAAKGYIKVMK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Protein phosphatase 1 regulatory subunit 12B Regulates myosin phosphatase activity. Augments Ca(2+) sensitivity of the contractile apparatus.confidentO60237
Protein phosphatase 1 regulatory subunit 12B Regulates myosin phosphatase activity. Augments Ca(2+) sensitivity of the contractile apparatus.confidentQ8BG95
Protein phosphatase 1 regulatory subunit 12A Regulates myosin phosphatase activity.confidentQ6DRG7

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0072357 [CC]PTW/PP1 phosphatase complexprobableGO:0043234, GO:0008287, GO:0032991, GO:0044464, GO:0005623, GO:0005575
GO:0019901 [MF]protein kinase bindingprobableGO:0019900, GO:0003674, GO:0005515, GO:0019899, GO:0005488
GO:0035507 [BP]regulation of myosin-light-chain-phosphatase activityprobableGO:0051336, GO:0019220, GO:0043666, GO:0019222, GO:0010921, GO:0050790, GO:0031323, GO:0050789, GO:0051174, GO:0065007, GO:0008150, GO:0035303, GO:0050794, GO:0065009
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623
GO:0004721 [MF]phosphoprotein phosphatase activityprobableGO:0016787, GO:0016791, GO:0016788, GO:0042578, GO:0003824, GO:0003674
GO:0030155 [BP]regulation of cell adhesionprobableGO:0008150, GO:0065007, GO:0050789, GO:0050794
GO:0004857 [MF]enzyme inhibitor activityprobableGO:0030234, GO:0003674
GO:0043086 [BP]negative regulation of catalytic activityprobableGO:0019222, GO:0050790, GO:0065007, GO:0044092, GO:0008150, GO:0065009, GO:0050789
GO:0045179 [CC]apical cortexprobableGO:0005737, GO:0045177, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0071944, GO:0005938, GO:0044424, GO:0044448
GO:0071889 [MF]14-3-3 protein bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0045944 [BP]positive regulation of transcription from RNA polymerase II promoterprobableGO:0009893, GO:0019222, GO:0031328, GO:0031326, GO:0031325, GO:2001141, GO:0031323, GO:0010628, GO:0050789, GO:0080090, GO:0010604, GO:0051171, GO:0009891, GO:2000112, GO:0019219, GO:0010556, GO:0065007, GO:0048518, GO:0010468, GO:0045935, GO:0060255, GO:0009889, GO:0050794, GO:0008150, GO:0045893, GO:0051173, GO:0051252, GO:0051254, GO:0006355, GO:0010557, GO:0006357, GO:0048522
GO:0015629 [CC]actin cytoskeletonprobableGO:0005856, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0043228, GO:0044424, GO:0043226
GO:0005813 [CC]centrosomeprobableGO:0005856, GO:0005575, GO:0015630, GO:0043232, GO:0044464, GO:0005623, GO:0005815, GO:0044446, GO:0043229, GO:0043228, GO:0044430, GO:0044424, GO:0005622, GO:0043226, GO:0044422
GO:0000776 [CC]kinetochoreprobableGO:0043234, GO:0005575, GO:0005622, GO:0032991, GO:0043232, GO:0044464, GO:0005623, GO:0043226, GO:0044446, GO:0043229, GO:0043228, GO:0044424, GO:0044427, GO:0005694, GO:0000775, GO:0044422
GO:0007010 [BP]cytoskeleton organizationprobableGO:0006996, GO:0009987, GO:0016043, GO:0044763, GO:0044699, GO:0008150, GO:0071840
GO:0043292 [CC]contractile fiberprobableGO:0005737, GO:0043232, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0043228, GO:0044424, GO:0043226
GO:0043296 [CC]apical junction complexprobableGO:0005575, GO:0030054, GO:0005911

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1S70, chain B
Confidence level:very confident
Coverage over the Query: 3-60
View the alignment between query and template
View the model in PyMOL