Diaphorina citri psyllid: psy9957

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-
MSETRSSSALFKRAEQLKRWEESETNRQPSEMGNKPKKIKFSSGCVFLAACASSDKEEVLNLLKSGADINTANVDGLTALHQVSKSASTLPLHSLNCGPGCVFLAACASSDKEEVLNLLKSGADINTANVDGLTALHQLKRWEESETNRQPSEMGNKPKKIKFSSGCVFLAACASSDKEEVLNLLKSGADINTANVDGLTALHQAGADLNFQDYDGWTPLHAAAHWAQREACQILVENFCDMDVKNYVVST
ccccccHHHHHHHHHHHHHHHccHHHHcccccccccccccccccHHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHccccHHHcccccccccHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHcccccccccccccHHHHHHcccccccccccccHHHHHHHHccHHHHHHHHHcccccccccccccc
*****SSSALFKRAEQLKRWEESETNRQ******KPKKIKFSSGCVFLAACASSDKEEVLNLLKSGADINTANVDGLTALHQVSKSASTLPLHSLNCGPGCVFLAACASSDKEEVLNLLKSGADINTANVDGLTALHQLKRWEESETNRQPSEMGNKPKKIKFSSGCVFLAACASSDKEEVLNLLKSGADINTANVDGLTALHQAGADLNFQDYDGWTPLHAAAHWAQREACQILVENFCDMDVKNYV***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSETRSSSALFKRAEQLKRWEESETNRQPSEMGNKPKKIKFSSGCVFLAACASSDKEEVLNLLKSGADINTANVDGLTALHQVSKSASTLPLHSLNCGPGCVFLAACASSDKEEVLNLLKSGADINTANVDGLTALHQLKRWEESETNRQPSEMGNKPKKIKFSSGCVFLAACASSDKEEVLNLLKSGADINTANVDGLTALHQAGADLNFQDYDGWTPLHAAAHWAQREACQILVENFCDMDVKNYVVST

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0045179 [CC]apical cortexprobableGO:0005737, GO:0045177, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0071944, GO:0005938, GO:0044424, GO:0044448
GO:0043296 [CC]apical junction complexprobableGO:0005575, GO:0030054, GO:0005911
GO:0005856 [CC]cytoskeletonprobableGO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0043228, GO:0044424, GO:0043226

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1N11, chain A
Confidence level:very confident
Coverage over the Query: 33-251
View the alignment between query and template
View the model in PyMOL
Template: 3UTM, chain A
Confidence level:very confident
Coverage over the Query: 4-251
View the alignment between query and template
View the model in PyMOL