Psyllid ID: psy9957

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-
MSETRSSSALFKRAEQLKRWEESETNRQPSEMGNKPKKIKFSSGCVFLAACASSDKEEVLNLLKSGADINTANVDGLTALHQVSKSASTLPLHSLNCGPGCVFLAACASSDKEEVLNLLKSGADINTANVDGLTALHQLKRWEESETNRQPSEMGNKPKKIKFSSGCVFLAACASSDKEEVLNLLKSGADINTANVDGLTALHQAGADLNFQDYDGWTPLHAAAHWAQREACQILVENFCDMDVKNYVVST
ccccccHHHHHHHHHHHHHHHcHHHHHHccccccccccccccccHHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHHccHHHHccccccccHHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHcccccccccccccHHHHHHccccccccccccHHHHHHHHHccHHHHHHHHHcccccccccccccc
ccHHHHHHHHHHHHHHHHHHHHcHHHHcHHHccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHccccHHHHHHcccccccHHHHHHHcccHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHccccccHcccccccHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHcccccccccccccHHHHHHHcccHHHHHHHHHcccccccccccccc
msetrsssALFKRAEQLKRWEesetnrqpsemgnkpkkikfssgCVFLAACASSDKEEVLNLLKsgadintanVDGLTALHQVSksastlplhslncgpgcVFLAACASSDKEEVLNLLKsgadintanVDGLTALHQLKRweesetnrqpsemgnkpkkikfssgCVFLAACASSDKEEVLNLLKsgadintanVDGLTALHQagadlnfqdydgwtplHAAAHWAQREACQILVENFcdmdvknyvvst
msetrsssalfkraeqlkrweesetnrqpsemgnkpkKIKFSSGCVFLAACASSDKEEVLNLLKSGADINTANVDGLTALHQVSKSASTLPLHSLNCGPGCVFLAACASSDKEEVLNLLKsgadintanVDGLTALHQLKrweesetnrqpsemgnkpKKIKFSSGCVFLAACASSDKEEVLNLLKSGADINTANVDGLTALHQAGADLNFQDYDGWTPLHAAAHWAQREACQILVENFCDMDVKNYVVST
MSETRSSSALFKRAEQLKRWEESETNRQPSEMGNKPKKIKFSSGCVFLAACASSDKEEVLNLLKSGADINTANVDGLTALHQVSKSASTLPLHSLNCGPGCVFLAACASSDKEEVLNLLKSGADINTANVDGLTALHQLKRWEESETNRQPSEMGNKPKKIKFSSGCVFLAACASSDKEEVLNLLKSGADINTANVDGLTALHQAGADLNFQDYDGWTPLHAAAHWAQREACQILVENFCDMDVKNYVVST
***************************************KFSSGCVFLAACASSDKEEVLNLLKSGADINTANVDGLTALHQVSKSASTLPLHSLNCGPGCVFLAACASSDKEEVLNLLKSGADINTANVDGLTALHQLK*********************KFSSGCVFLAACASSDKEEVLNLLKSGADINTANVDGLTALHQAGADLNFQDYDGWTPLHAAAHWAQREACQILVENFCDMDVKNYVV**
*****SSSALFKRAEQLKRWEESETNRQPSEMGNKPKKIKFSSGCVFLAACASSDKEEVLNLLKSGADINTANVDGLTALHQVSKSASTLPLHSLNCGPGCVFLAACASSDKEEVLNLLKSGADINTANVDGLTALHQLKRWEESETNRQPSEMGNKPKKIKFSSGCVFLAACASSDKEEVLNLLKSGADINTANVDGLTALHQAGADLNFQDYDGWTPLHAAAHWAQREACQILVENFCDMDVKNYV***
**********************************KPKKIKFSSGCVFLAACASSDKEEVLNLLKSGADINTANVDGLTALHQVSKSASTLPLHSLNCGPGCVFLAACASSDKEEVLNLLKSGADINTANVDGLTALHQLKRWE*************KPKKIKFSSGCVFLAACASSDKEEVLNLLKSGADINTANVDGLTALHQAGADLNFQDYDGWTPLHAAAHWAQREACQILVENFCDMDVKNYVVST
*S**RSSSALFKRAEQLKRWEESETNRQ*******PKKIKFSSGCVFLAACASSDKEEVLNLLKSGADINTANVDGLTALHQVSKSASTLPLHSLNCGPGCVFLAACASSDKEEVLNLLKSGADINTANVDGLTALHQLKRWEESETNRQPSEMGNKPKKIKFSSGCVFLAACASSDKEEVLNLLKSGADINTANVDGLTALHQAGADLNFQDYDGWTPLHAAAHWAQREACQILVENFCDM*********
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSETRSSSALFKRAEQLKRWEESETNRQPSEMGNKPKKIKFSSGCVFLAACASSDKEEVLNLLKSGADINTANVDGLTALHQVSKSASTLPLHSLNCGPGCVFLAACASSDKEEVLNLLKSGADINTANVDGLTALHQLKRWEESETNRQPSEMGNKPKKIKFSSGCVFLAACASSDKEEVLNLLKSGADINTANVDGLTALHQAGADLNFQDYDGWTPLHAAAHWAQREACQILVENFCDMDVKNYVVST
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query251 2.2.26 [Sep-21-2011]
Q10728 1032 Protein phosphatase 1 reg yes N/A 0.900 0.218 0.391 2e-38
Q9DBR7 1029 Protein phosphatase 1 reg yes N/A 0.900 0.219 0.388 3e-38
O14974 1030 Protein phosphatase 1 reg yes N/A 0.900 0.219 0.388 3e-38
Q6DRG7 1049 Protein phosphatase 1 reg yes N/A 0.944 0.225 0.408 5e-37
O60237 982 Protein phosphatase 1 reg no N/A 0.880 0.225 0.348 2e-36
Q90623 1004 Protein phosphatase 1 reg yes N/A 0.900 0.225 0.395 4e-36
Q8BG95 976 Protein phosphatase 1 reg no N/A 0.836 0.215 0.331 2e-31
Q96I34 528 Protein phosphatase 1 reg no N/A 0.904 0.429 0.272 2e-15
Q923M0 524 Protein phosphatase 1 reg no N/A 0.940 0.450 0.293 1e-14
Q95N27 568 Protein phosphatase 1 reg no N/A 0.860 0.380 0.270 5e-14
>sp|Q10728|MYPT1_RAT Protein phosphatase 1 regulatory subunit 12A OS=Rattus norvegicus GN=Ppp1r12a PE=1 SV=2 Back     alignment and function desciption
 Score =  159 bits (402), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 107/273 (39%), Positives = 141/273 (51%), Gaps = 47/273 (17%)

Query: 12  KRAEQLKRWEESETNRQPSEMGNKPKKIKFSSGCVFLAACASSDKEEVLNLLKSGADINT 71
           KR EQLKRW  SET+ +P  +  +  K+KF  G VFLAAC+S D +EVL LL  GADIN 
Sbjct: 9   KRNEQLKRWIGSETDLEPPVVKRQKTKVKFDDGAVFLAACSSGDTDEVLKLLHRGADINY 68

Query: 72  ANVDGLTALHQ-------------VSKSAST--------LPLHSLNCGPGCVFLAACASS 110
           ANVDGLTALHQ             V   A+         +PLH+          A+C   
Sbjct: 69  ANVDGLTALHQACIDDNVDMVKFLVENGANINQPDNEGWIPLHA---------AASCGYL 119

Query: 111 DKEEVLNLLKSGADINTANVDGLTALH-----QLKRWEESETNRQPSEM---GNKPKKIK 162
           D  E   L+  GA +   N +G T L       ++   ++E NRQ  ++     + ++I 
Sbjct: 120 DIAEF--LIGQGAHVGAVNSEGDTPLDIAEEEAMEELLQNEVNRQGVDIEAARKEEERIM 177

Query: 163 FSSGCVFLAACASSDKEEVLNLLKSGADINTANVDGLTA----LHQAGADLNFQDYDGWT 218
                 +L +   SD   V +    G  ++ A   G T     L QAG D+N +DYDGWT
Sbjct: 178 LRDARQWLNSGHISD---VRHAKSGGTALHVAAAKGYTEVLKLLIQAGYDVNIKDYDGWT 234

Query: 219 PLHAAAHWAQREACQILVENFCDMDVKNYVVST 251
           PLHAAAHW + EAC+ILV+N CDM+  N V  T
Sbjct: 235 PLHAAAHWGKEEACRILVDNLCDMETVNKVGQT 267
Key regulator of protein phosphatase 1C (PPP1C). Mediates binding to myosin. As part of the PPP1C complex, involved in dephosphorylation of PLK1. Capable of inhibiting HIF1AN-dependent suppression of HIF1A activity.
Rattus norvegicus (taxid: 10116)
>sp|Q9DBR7|MYPT1_MOUSE Protein phosphatase 1 regulatory subunit 12A OS=Mus musculus GN=Ppp1r12a PE=1 SV=2 Back     alignment and function description
>sp|O14974|MYPT1_HUMAN Protein phosphatase 1 regulatory subunit 12A OS=Homo sapiens GN=PPP1R12A PE=1 SV=1 Back     alignment and function description
>sp|Q6DRG7|MYPT1_DANRE Protein phosphatase 1 regulatory subunit 12A OS=Danio rerio GN=ppp1r12a PE=2 SV=2 Back     alignment and function description
>sp|O60237|MYPT2_HUMAN Protein phosphatase 1 regulatory subunit 12B OS=Homo sapiens GN=PPP1R12B PE=1 SV=2 Back     alignment and function description
>sp|Q90623|MYPT1_CHICK Protein phosphatase 1 regulatory subunit 12A OS=Gallus gallus GN=PPP1R12A PE=1 SV=1 Back     alignment and function description
>sp|Q8BG95|MYPT2_MOUSE Protein phosphatase 1 regulatory subunit 12B OS=Mus musculus GN=Ppp1r12b PE=1 SV=2 Back     alignment and function description
>sp|Q96I34|PP16A_HUMAN Protein phosphatase 1 regulatory subunit 16A OS=Homo sapiens GN=PPP1R16A PE=1 SV=1 Back     alignment and function description
>sp|Q923M0|PP16A_MOUSE Protein phosphatase 1 regulatory subunit 16A OS=Mus musculus GN=Ppp1r16a PE=1 SV=1 Back     alignment and function description
>sp|Q95N27|PP16B_BOVIN Protein phosphatase 1 regulatory inhibitor subunit 16B OS=Bos taurus GN=PPP1R16B PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query251
328788764 1076 PREDICTED: hypothetical protein LOC72654 0.768 0.179 0.438 6e-51
383860353 1085 PREDICTED: uncharacterized protein LOC10 0.768 0.177 0.430 1e-50
340716517 1084 PREDICTED: hypothetical protein LOC10064 0.860 0.199 0.481 2e-50
340716515 1179 PREDICTED: hypothetical protein LOC10064 0.896 0.190 0.424 5e-49
380027701 1207 PREDICTED: uncharacterized protein LOC10 0.896 0.186 0.424 7e-49
345484761 1193 PREDICTED: hypothetical protein LOC10011 0.896 0.188 0.424 3e-48
307211463 1189 Protein phosphatase 1 regulatory subunit 0.896 0.189 0.428 3e-48
345484763 1042 PREDICTED: hypothetical protein LOC10011 0.896 0.215 0.424 3e-48
345484759 995 PREDICTED: hypothetical protein LOC10011 0.896 0.226 0.424 3e-48
383860351 1180 PREDICTED: uncharacterized protein LOC10 0.948 0.201 0.444 5e-47
>gi|328788764|ref|XP_001122270.2| PREDICTED: hypothetical protein LOC726541 [Apis mellifera] Back     alignment and taxonomy information
 Score =  206 bits (525), Expect = 6e-51,   Method: Compositional matrix adjust.
 Identities = 117/267 (43%), Positives = 147/267 (55%), Gaps = 74/267 (27%)

Query: 3   ETRSSSALFKRAEQLKRWEESETNRQPSEMGNKPKKIKFSSGCVFLAACASSDKEEVLNL 62
           E+RSSSALFKRAEQLKRWE+SETNR+P++     +KIKFS+ CVFLAACA+ DKEEV+ L
Sbjct: 4   ESRSSSALFKRAEQLKRWEQSETNREPTQPRQIARKIKFSADCVFLAACAAGDKEEVVRL 63

Query: 63  LKSGADINTANVDGLTALHQVSKSASTLPLHSLNCGPGCVFLAACASSDKEEVLNLLKSG 122
           L+ GADINT NVDGLTALHQ                       AC + D + V  L++ G
Sbjct: 64  LQKGADINTGNVDGLTALHQ-----------------------ACINDDLDMVEFLVEKG 100

Query: 123 ADINTANVDGLTALHQLKRWEESETNRQPSEMGNKPKKIKFSSGCVFLAACASSDKEEVL 182
           ADIN  + +G T LH                          ++ C F++           
Sbjct: 101 ADINCGDNEGWTPLHA-------------------------TASCGFISIAKY------- 128

Query: 183 NLLKSGADINTANVDGLTALH------------------QAGADLNFQDYDGWTPLHAAA 224
            L++ G ++   N DG  AL                   QA  D+N QD+DGWTPLHAAA
Sbjct: 129 -LIEKGCNLAAVNYDGQLALDIAESVEMEDMLQQHIILLQARCDVNAQDFDGWTPLHAAA 187

Query: 225 HWAQREACQILVENFCDMDVKNYVVST 251
           HW Q EAC++LVENFC+MD+KNY   T
Sbjct: 188 HWGQLEACELLVENFCNMDIKNYADQT 214

Source: Apis mellifera

Species: Apis mellifera

Genus: Apis

Family: Apidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|383860353|ref|XP_003705655.1| PREDICTED: uncharacterized protein LOC100879751 isoform 2 [Megachile rotundata] Back     alignment and taxonomy information
>gi|340716517|ref|XP_003396744.1| PREDICTED: hypothetical protein LOC100646538 isoform 2 [Bombus terrestris] Back     alignment and taxonomy information
>gi|340716515|ref|XP_003396743.1| PREDICTED: hypothetical protein LOC100646538 isoform 1 [Bombus terrestris] Back     alignment and taxonomy information
>gi|380027701|ref|XP_003697558.1| PREDICTED: uncharacterized protein LOC100872908 [Apis florea] Back     alignment and taxonomy information
>gi|345484761|ref|XP_003425117.1| PREDICTED: hypothetical protein LOC100114433 isoform 2 [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|307211463|gb|EFN87569.1| Protein phosphatase 1 regulatory subunit 12A [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|345484763|ref|XP_003425118.1| PREDICTED: hypothetical protein LOC100114433 isoform 3 [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|345484759|ref|XP_001599458.2| PREDICTED: hypothetical protein LOC100114433 isoform 1 [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|383860351|ref|XP_003705654.1| PREDICTED: uncharacterized protein LOC100879751 isoform 1 [Megachile rotundata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query251
UNIPROTKB|E2RHS3 983 PPP1R12B "Uncharacterized prot 0.434 0.110 0.413 1.3e-17
UNIPROTKB|F8W8M3 982 PPP1R12B "Protein phosphatase 0.434 0.110 0.413 2.2e-17
UNIPROTKB|O60237 982 PPP1R12B "Protein phosphatase 0.434 0.110 0.413 2.2e-17
RGD|1309287 989 Ppp1r12b "protein phosphatase 0.434 0.110 0.406 1.2e-16
MGI|MGI:1916417 976 Ppp1r12b "protein phosphatase 0.434 0.111 0.406 1.5e-16
FB|FBgn0005536 1144 Mbs "Myosin binding subunit" [ 0.434 0.095 0.56 2.9e-26
UNIPROTKB|F1S5B0 820 PPP1R12B "Uncharacterized prot 0.434 0.132 0.398 3.4e-17
UNIPROTKB|Q5ZIZ1172 PPP1R12A "Protein phosphatase 0.394 0.575 0.508 5.5e-22
UNIPROTKB|Q90623 1004 PPP1R12A "Protein phosphatase 0.872 0.218 0.328 6.1e-20
UNIPROTKB|F1NA71 1029 PPP1R12A "Protein phosphatase 0.872 0.212 0.328 6.3e-20
UNIPROTKB|E2RHS3 PPP1R12B "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
 Score = 227 (85.0 bits), Expect = 1.3e-17, P = 1.3e-17
 Identities = 55/133 (41%), Positives = 74/133 (55%)

Query:   138 QLKRWEESETNRQPSEM---GNKPK------KIKFSSGCVFLAACASSDKEEVLNLLKSG 188
             QL+RW  S T ++P+E    G +P+      +++F  G VFLAAC+S D +EV  LL  G
Sbjct:    22 QLRRWRGSLTEQEPAERRGAGRQPQPRRGSPRVRFEDGAVFLAACSSGDTDEVKKLLARG 81

Query:   189 ADINTANVDGLTALHQA---------------GADLNFQDYDGWTPLHAAAHWAQREACQ 233
             ADINT NVDGLTALHQA                A++N QD +GWTPLHAAA        +
Sbjct:    82 ADINTVNVDGLTALHQACIDENLDMVKFLVENKANVNQQDNEGWTPLHAAASCGYLNIAE 141

Query:   234 ILVENFCDMDVKN 246
               + +   + + N
Sbjct:   142 YFINHGASVGIVN 154
GO:0015629 "actin cytoskeleton" evidence=IEA
GO:0005886 "plasma membrane" evidence=IEA
UNIPROTKB|F8W8M3 PPP1R12B "Protein phosphatase 1 regulatory subunit 12B" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|O60237 PPP1R12B "Protein phosphatase 1 regulatory subunit 12B" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
RGD|1309287 Ppp1r12b "protein phosphatase 1, regulatory subunit 12B" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:1916417 Ppp1r12b "protein phosphatase 1, regulatory (inhibitor) subunit 12B" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
FB|FBgn0005536 Mbs "Myosin binding subunit" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|F1S5B0 PPP1R12B "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q5ZIZ1 PPP1R12A "Protein phosphatase 1 regulatory subunit 12A" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q90623 PPP1R12A "Protein phosphatase 1 regulatory subunit 12A" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1NA71 PPP1R12A "Protein phosphatase 1 regulatory subunit 12A" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query251
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 3e-17
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 3e-16
PHA03095 471 PHA03095, PHA03095, ankyrin-like protein; Provisio 2e-12
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 3e-11
PHA03095 471 PHA03095, PHA03095, ankyrin-like protein; Provisio 4e-11
PHA03095 471 PHA03095, PHA03095, ankyrin-like protein; Provisio 3e-10
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 5e-09
PHA03100 422 PHA03100, PHA03100, ankyrin repeat protein; Provis 2e-08
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 2e-07
PHA02876 682 PHA02876, PHA02876, ankyrin repeat protein; Provis 3e-07
PHA02874 434 PHA02874, PHA02874, ankyrin repeat protein; Provis 3e-07
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 2e-06
PHA02874 434 PHA02874, PHA02874, ankyrin repeat protein; Provis 4e-06
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 9e-06
PHA02874 434 PHA02874, PHA02874, ankyrin repeat protein; Provis 1e-05
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 2e-05
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 2e-05
PHA02876 682 PHA02876, PHA02876, ankyrin repeat protein; Provis 3e-05
PHA02876 682 PHA02876, PHA02876, ankyrin repeat protein; Provis 4e-05
PHA02878 477 PHA02878, PHA02878, ankyrin repeat protein; Provis 6e-05
PHA03100 422 PHA03100, PHA03100, ankyrin repeat protein; Provis 1e-04
pfam0002333 pfam00023, Ank, Ankyrin repeat 1e-04
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 3e-04
PTZ00322 664 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fruct 3e-04
PHA02876 682 PHA02876, PHA02876, ankyrin repeat protein; Provis 4e-04
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 6e-04
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 7e-04
PHA02874 434 PHA02874, PHA02874, ankyrin repeat protein; Provis 0.001
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 0.002
PHA03100 422 PHA03100, PHA03100, ankyrin repeat protein; Provis 0.002
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 0.002
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 0.002
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 0.003
pfam1360630 pfam13606, Ank_3, Ankyrin repeat 0.003
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information 
 Score = 74.7 bits (184), Expect = 3e-17
 Identities = 50/182 (27%), Positives = 66/182 (36%), Gaps = 71/182 (39%)

Query: 70  NTANVDGLTALHQVSKSASTLPLHSLNCGPGCVFLAACASSDKEEVLNLLKSGADINTAN 129
           N  + DG T LH                        A ++   E V  LL++GAD+N  +
Sbjct: 1   NARDEDGRTPLH-----------------------LAASNGHLEVVKLLLENGADVNAKD 37

Query: 130 VDGLTALHQLKRWEESETNRQPSEMGNKPKKIKFSSGCVFLAACASSDKEEVLNLLKSGA 189
            DG T LH                                  A  +   E V  LL+ GA
Sbjct: 38  NDGRTPLH---------------------------------LAAKNGHLEIVKLLLEKGA 64

Query: 190 DINTANVDGLTALHQA---------------GADLNFQDYDGWTPLHAAAHWAQREACQI 234
           D+N  + DG T LH A               GAD+N +D DG TPLH AA     E  ++
Sbjct: 65  DVNARDKDGNTPLHLAARNGNLDVVKLLLKHGADVNARDKDGRTPLHLAAKNGHLEVVKL 124

Query: 235 LV 236
           L+
Sbjct: 125 LL 126

The number of ANK repeats in a protein can range from 2 to over 20 (ankyrins, for example). ANK repeats may occur in combinations with other types of domains. The structural repeat unit contains two antiparallel helices and a beta-hairpin, repeats are stacked in a superhelical arrangement; this alignment contains 4 consecutive repeats. Length = 126
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|165207 PHA02876, PHA02876, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|165207 PHA02876, PHA02876, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165207 PHA02876, PHA02876, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222939 PHA02878, PHA02878, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|140343 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>gnl|CDD|165207 PHA02876, PHA02876, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|205784 pfam13606, Ank_3, Ankyrin repeat Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 251
PHA02874 434 ankyrin repeat protein; Provisional 100.0
PHA03095 471 ankyrin-like protein; Provisional 100.0
PHA02878 477 ankyrin repeat protein; Provisional 100.0
PHA03100 480 ankyrin repeat protein; Provisional 100.0
PHA02876 682 ankyrin repeat protein; Provisional 100.0
PHA03100 480 ankyrin repeat protein; Provisional 100.0
KOG4412|consensus226 100.0
PHA02716 764 CPXV016; CPX019; EVM010; Provisional 100.0
PHA02791284 ankyrin-like protein; Provisional 100.0
PHA02875 413 ankyrin repeat protein; Provisional 100.0
PHA02989 494 ankyrin repeat protein; Provisional 100.0
PHA02946 446 ankyin-like protein; Provisional 100.0
PHA02716 764 CPXV016; CPX019; EVM010; Provisional 100.0
PHA03095 471 ankyrin-like protein; Provisional 100.0
PHA02874 434 ankyrin repeat protein; Provisional 100.0
PHA02876 682 ankyrin repeat protein; Provisional 100.0
KOG0510|consensus 929 100.0
PHA02878 477 ankyrin repeat protein; Provisional 100.0
PHA02798 489 ankyrin-like protein; Provisional 100.0
PHA02875 413 ankyrin repeat protein; Provisional 100.0
PHA02946 446 ankyin-like protein; Provisional 100.0
KOG0509|consensus 600 100.0
PHA02730 672 ankyrin-like protein; Provisional 99.98
PHA02917 661 ankyrin-like protein; Provisional 99.98
PHA02989 494 ankyrin repeat protein; Provisional 99.98
KOG4412|consensus226 99.97
PHA02791284 ankyrin-like protein; Provisional 99.97
KOG0510|consensus 929 99.97
PHA02917 661 ankyrin-like protein; Provisional 99.97
KOG0508|consensus 615 99.97
PHA02792 631 ankyrin-like protein; Provisional 99.97
KOG4177|consensus 1143 99.97
PHA02859209 ankyrin repeat protein; Provisional 99.97
PHA02798 489 ankyrin-like protein; Provisional 99.96
KOG4177|consensus 1143 99.96
PHA02730 672 ankyrin-like protein; Provisional 99.96
PHA02795 437 ankyrin-like protein; Provisional 99.96
PLN03192 823 Voltage-dependent potassium channel; Provisional 99.96
PHA02859209 ankyrin repeat protein; Provisional 99.95
KOG0508|consensus 615 99.94
KOG0505|consensus 527 99.94
KOG0509|consensus 600 99.94
KOG0507|consensus 854 99.94
TIGR00870 743 trp transient-receptor-potential calcium channel p 99.93
PHA02792 631 ankyrin-like protein; Provisional 99.92
PHA02743166 Viral ankyrin protein; Provisional 99.92
PHA02795 437 ankyrin-like protein; Provisional 99.92
KOG0502|consensus296 99.92
PLN03192823 Voltage-dependent potassium channel; Provisional 99.9
PHA02741169 hypothetical protein; Provisional 99.89
KOG0514|consensus452 99.89
PHA02736154 Viral ankyrin protein; Provisional 99.89
KOG0502|consensus296 99.88
PHA02884 300 ankyrin repeat protein; Provisional 99.87
TIGR00870 743 trp transient-receptor-potential calcium channel p 99.87
KOG0507|consensus 854 99.87
KOG0512|consensus228 99.87
KOG0514|consensus452 99.84
KOG4369|consensus 2131 99.84
KOG0505|consensus 527 99.83
PHA02884 300 ankyrin repeat protein; Provisional 99.8
KOG4369|consensus 2131 99.8
PHA02743166 Viral ankyrin protein; Provisional 99.79
KOG3676|consensus 782 99.79
KOG0512|consensus228 99.79
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 99.79
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 99.78
KOG0195|consensus 448 99.75
PHA02741169 hypothetical protein; Provisional 99.73
KOG0195|consensus 448 99.72
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 99.72
PHA02736154 Viral ankyrin protein; Provisional 99.71
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 99.68
KOG4214|consensus117 99.65
KOG3676|consensus 782 99.61
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 99.59
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 99.54
PTZ00322 664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 99.52
KOG4214|consensus117 99.51
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 99.5
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 99.5
KOG1710|consensus 396 99.5
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 99.47
KOG0515|consensus752 99.44
KOG0515|consensus752 99.42
KOG1710|consensus 396 99.4
PTZ00322 664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 99.4
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 99.39
PF1360630 Ank_3: Ankyrin repeat 99.2
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 99.16
KOG0782|consensus1004 99.0
KOG0506|consensus622 98.93
PF1360630 Ank_3: Ankyrin repeat 98.88
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 98.85
KOG0783|consensus 1267 98.85
KOG0818|consensus 669 98.82
KOG0705|consensus749 98.76
KOG0783|consensus 1267 98.72
KOG0506|consensus622 98.71
KOG0522|consensus 560 98.66
KOG0782|consensus1004 98.58
KOG3609|consensus 822 98.51
KOG0818|consensus 669 98.47
KOG2384|consensus223 98.43
KOG0521|consensus785 98.41
KOG0511|consensus 516 98.39
KOG0705|consensus749 98.37
KOG0522|consensus 560 98.29
KOG0520|consensus 975 98.22
KOG3609|consensus 822 98.15
KOG0511|consensus 516 98.11
KOG0521|consensus785 97.97
KOG2384|consensus223 97.94
smart0024830 ANK ankyrin repeats. Ankyrin repeats are about 33 97.74
KOG0520|consensus 975 97.43
KOG2505|consensus591 97.2
KOG2505|consensus 591 97.2
smart0024830 ANK ankyrin repeats. Ankyrin repeats are about 33 97.1
PF06128284 Shigella_OspC: Shigella flexneri OspC protein; Int 94.1
PF03158192 DUF249: Multigene family 530 protein; InterPro: IP 93.43
PF03158192 DUF249: Multigene family 530 protein; InterPro: IP 92.38
PF06128284 Shigella_OspC: Shigella flexneri OspC protein; Int 90.9
PF1192976 DUF3447: Domain of unknown function (DUF3447); Int 88.03
PF1192976 DUF3447: Domain of unknown function (DUF3447); Int 83.87
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information 
Probab=100.00  E-value=3.9e-41  Score=287.13  Aligned_cols=243  Identities=23%  Similarity=0.211  Sum_probs=222.6

Q ss_pred             CCcccchhHHHHHHHHHHHHHhhccCCCccccCCCCCccccCCChHHHHHHhcCCHHHHHHHHHcCCCCcccCCCCccHH
Q psy9957           1 MSETRSSSALFKRAEQLKRWEESETNRQPSEMGNKPKKIKFSSGCVFLAACASSDKEEVLNLLKSGADINTANVDGLTAL   80 (251)
Q Consensus         1 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~t~L~~A~~~~~~~~v~~Ll~~g~~~~~~~~~g~tpL   80 (251)
                      |++....++..++.+.++..+...        +...+..+..|.||||.|+..|+.++|++|+++|++++..+..|.|||
T Consensus         1 ~~~~l~~ai~~gd~~~v~~ll~~~--------~~~~n~~~~~~~tpL~~A~~~g~~~iv~~Ll~~Ga~~n~~~~~~~t~L   72 (434)
T PHA02874          1 ASQDLRMCIYSGDIEAIEKIIKNK--------GNCINISVDETTTPLIDAIRSGDAKIVELFIKHGADINHINTKIPHPL   72 (434)
T ss_pred             CcHHHHHHHhcCCHHHHHHHHHcC--------CCCCCCcCCCCCCHHHHHHHcCCHHHHHHHHHCCCCCCCCCCCCCCHH
Confidence            455666788889999988887543        223445667889999999999999999999999999999999999999


Q ss_pred             HHHHhhCCCcccccc---------------------------------ccCCCchhhHHHhcCCHHHHHHHHHcCCCCcc
Q psy9957          81 HQVSKSASTLPLHSL---------------------------------NCGPGCVFLAACASSDKEEVLNLLKSGADINT  127 (251)
Q Consensus        81 h~a~~~~~~~~~~~~---------------------------------~~~~~t~l~~a~~~~~~~~v~~Ll~~g~~~~~  127 (251)
                      |+|+..|+.++++.+                                 +..|.||||+|+..|+.+++++|++.|++++.
T Consensus        73 ~~A~~~~~~~iv~~Ll~~g~~~~~~~~~~~~~~~i~~ll~~g~d~n~~~~~g~T~Lh~A~~~~~~~~v~~Ll~~gad~n~  152 (434)
T PHA02874         73 LTAIKIGAHDIIKLLIDNGVDTSILPIPCIEKDMIKTILDCGIDVNIKDAELKTFLHYAIKKGDLESIKMLFEYGADVNI  152 (434)
T ss_pred             HHHHHcCCHHHHHHHHHCCCCCCcchhccCCHHHHHHHHHCcCCCCCCCCCCccHHHHHHHCCCHHHHHHHHhCCCCCCC
Confidence            999999998877665                                 34688999999999999999999999999999


Q ss_pred             CCCCCCcHHHHHHHhCCcchhhhhhhcCCCCcccccCCCchHHHHHhcCCHHHHHHHHHcCCCCcccCCCCCchhhhc--
Q psy9957         128 ANVDGLTALHQLKRWEESETNRQPSEMGNKPKKIKFSSGCVFLAACASSDKEEVLNLLKSGADINTANVDGLTALHQA--  205 (251)
Q Consensus       128 ~~~~g~t~l~~A~~~~~~~~~~~l~~~~~~~~~~~~~~~~~l~~a~~~~~~~~~~~Ll~~~~~~~~~~~~g~t~l~~a--  205 (251)
                      +|..|.||||+|+..++.+++++|++.|+++...+..+.+++|.|+..++.+++++|+++|++++.++..|.||||.|  
T Consensus       153 ~d~~g~tpLh~A~~~~~~~iv~~Ll~~g~~~n~~~~~g~tpL~~A~~~g~~~iv~~Ll~~g~~i~~~~~~g~TpL~~A~~  232 (434)
T PHA02874        153 EDDNGCYPIHIAIKHNFFDIIKLLLEKGAYANVKDNNGESPLHNAAEYGDYACIKLLIDHGNHIMNKCKNGFTPLHNAII  232 (434)
T ss_pred             cCCCCCCHHHHHHHCCcHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHcCCHHHHHHHHhCCCCCcCCCCCCCCHHHHHHH
Confidence            999999999999999999999999999999998899999999999999999999999999999999999999999988  


Q ss_pred             -----------CCCCCCCCCCCCcHHHHHHHhC-cHHHHHHHHhCCCCCCcccccCCC
Q psy9957         206 -----------GADLNFQDYDGWTPLHAAAHWA-QREACQILVENFCDMDVKNYVVST  251 (251)
Q Consensus       206 -----------~~~~~~~~~~g~t~l~~A~~~~-~~~i~~~Ll~~ga~~~~~d~~g~t  251 (251)
                                 +.+++.+|..|.||||+|+..+ +.+++++|+++|+|++.+|..|.|
T Consensus       233 ~~~~~i~~Ll~~~~in~~d~~G~TpLh~A~~~~~~~~iv~~Ll~~gad~n~~d~~g~T  290 (434)
T PHA02874        233 HNRSAIELLINNASINDQDIDGSTPLHHAINPPCDIDIIDILLYHKADISIKDNKGEN  290 (434)
T ss_pred             CChHHHHHHHcCCCCCCcCCCCCCHHHHHHhcCCcHHHHHHHHHCcCCCCCCCCCCCC
Confidence                       7889999999999999999875 799999999999999999999987

>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG4412|consensus Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0510|consensus Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>KOG0509|consensus Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG4412|consensus Back     alignment and domain information
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0510|consensus Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0508|consensus Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG4177|consensus Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG4177|consensus Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0508|consensus Back     alignment and domain information
>KOG0505|consensus Back     alignment and domain information
>KOG0509|consensus Back     alignment and domain information
>KOG0507|consensus Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0502|consensus Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>KOG0514|consensus Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>KOG0502|consensus Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>KOG0507|consensus Back     alignment and domain information
>KOG0512|consensus Back     alignment and domain information
>KOG0514|consensus Back     alignment and domain information
>KOG4369|consensus Back     alignment and domain information
>KOG0505|consensus Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG4369|consensus Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>KOG3676|consensus Back     alignment and domain information
>KOG0512|consensus Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>KOG0195|consensus Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>KOG0195|consensus Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>KOG4214|consensus Back     alignment and domain information
>KOG3676|consensus Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>KOG4214|consensus Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>KOG1710|consensus Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>KOG0515|consensus Back     alignment and domain information
>KOG0515|consensus Back     alignment and domain information
>KOG1710|consensus Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>KOG0782|consensus Back     alignment and domain information
>KOG0506|consensus Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>KOG0783|consensus Back     alignment and domain information
>KOG0818|consensus Back     alignment and domain information
>KOG0705|consensus Back     alignment and domain information
>KOG0783|consensus Back     alignment and domain information
>KOG0506|consensus Back     alignment and domain information
>KOG0522|consensus Back     alignment and domain information
>KOG0782|consensus Back     alignment and domain information
>KOG3609|consensus Back     alignment and domain information
>KOG0818|consensus Back     alignment and domain information
>KOG2384|consensus Back     alignment and domain information
>KOG0521|consensus Back     alignment and domain information
>KOG0511|consensus Back     alignment and domain information
>KOG0705|consensus Back     alignment and domain information
>KOG0522|consensus Back     alignment and domain information
>KOG0520|consensus Back     alignment and domain information
>KOG3609|consensus Back     alignment and domain information
>KOG0511|consensus Back     alignment and domain information
>KOG0521|consensus Back     alignment and domain information
>KOG2384|consensus Back     alignment and domain information
>smart00248 ANK ankyrin repeats Back     alignment and domain information
>KOG0520|consensus Back     alignment and domain information
>KOG2505|consensus Back     alignment and domain information
>KOG2505|consensus Back     alignment and domain information
>smart00248 ANK ankyrin repeats Back     alignment and domain information
>PF06128 Shigella_OspC: Shigella flexneri OspC protein; InterPro: IPR010366 This family consists of the Shigella flexneri specific protein OspC Back     alignment and domain information
>PF03158 DUF249: Multigene family 530 protein; InterPro: IPR004858 This entry represents multigene family 530 proteins from African swine fever virus (ASFV) viruses Back     alignment and domain information
>PF03158 DUF249: Multigene family 530 protein; InterPro: IPR004858 This entry represents multigene family 530 proteins from African swine fever virus (ASFV) viruses Back     alignment and domain information
>PF06128 Shigella_OspC: Shigella flexneri OspC protein; InterPro: IPR010366 This family consists of the Shigella flexneri specific protein OspC Back     alignment and domain information
>PF11929 DUF3447: Domain of unknown function (DUF3447); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>PF11929 DUF3447: Domain of unknown function (DUF3447); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query251
1s70_B299 Complex Between Protein Ser/thr Phosphatase-1 (delt 7e-37
4gpm_A169 Crystal Structure Of Engineered Protein. Northeast 9e-12
4gpm_A169 Crystal Structure Of Engineered Protein. Northeast 2e-10
4hqd_A169 Crystal Structure Of Engineered Protein. Northeast 3e-11
4hqd_A169 Crystal Structure Of Engineered Protein. Northeast 3e-10
2xeh_A157 Structural Determinants For Improved Thermal Stabil 1e-10
2qyj_A166 Crystal Structure Of A Designed Full Consensus Anky 1e-10
2xee_A157 Structural Determinants For Improved Thermal Stabil 1e-10
3q9u_C158 In Silico And In Vitro Co-Evolution Of A High Affin 2e-10
4gmr_A169 Crystal Structure Of Engineered Protein. Northeast 2e-10
4gmr_A169 Crystal Structure Of Engineered Protein. Northeast 4e-09
1mj0_A166 Sank E3_5: An Artificial Ankyrin Repeat Protein Len 5e-10
4hb5_A169 Crystal Structure Of Engineered Protein. Northeast 7e-10
4hb5_A169 Crystal Structure Of Engineered Protein. Northeast 9e-09
1svx_A169 Crystal Structure Of A Designed Selected Ankyrin Re 1e-09
2j8s_D169 Drug Export Pathway Of Multidrug Exporter Acrb Reve 1e-08
2v5q_C167 Crystal Structure Of Wild-type Plk-1 Kinase Domain 9e-08
2v5q_C167 Crystal Structure Of Wild-type Plk-1 Kinase Domain 7e-06
4atz_D154 Ad5 Knob In Complex With A Designed Ankyrin Repeat 1e-07
3zu7_B169 Crystal Structure Of A Designed Selected Ankyrin Re 1e-07
3noc_D169 Designed Ankyrin Repeat Protein (Darpin) Binders To 3e-07
3noc_D169 Designed Ankyrin Repeat Protein (Darpin) Binders To 5e-07
2y1l_E169 Caspase-8 In Complex With Darpin-8.4 Length = 169 5e-07
2y1l_E169 Caspase-8 In Complex With Darpin-8.4 Length = 169 4e-04
3zuv_B136 Crystal Structure Of A Designed Selected Ankyrin Re 5e-07
2p2c_P169 Inhibition Of Caspase-2 By A Designed Ankyrin Repea 6e-07
2p2c_P169 Inhibition Of Caspase-2 By A Designed Ankyrin Repea 2e-05
3nog_D169 Designed Ankyrin Repeat Protein (Darpin) Binders To 6e-07
3nog_D169 Designed Ankyrin Repeat Protein (Darpin) Binders To 1e-05
1n0r_A126 4ank: A Designed Ankyrin Repeat Protein With Four I 8e-07
2bkk_B169 Crystal Structure Of Aminoglycoside Phosphotransfer 1e-06
4dui_A169 Darpin D1 Binding To Tubulin Beta Chain (not In Com 1e-06
4drx_E169 Gtp-Tubulin In Complex With A Darpin Length = 169 2e-06
2v4h_C136 Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 13 3e-06
2bkg_A166 Crystal Structure Of E3_19 An Designed Ankyrin Repe 3e-06
4f6r_D169 Tubulin:stathmin-Like Domain Complex Length = 169 8e-06
3hg0_D136 Crystal Structure Of A Darpin In Complex With Orf49 8e-06
2y0b_G136 Caspase-3 In Complex With An Inhibitory Darpin-3.4_ 1e-05
1n0q_A93 3ank: A Designed Ankyrin Repeat Protein With Three 1e-05
2jab_A136 A Designed Ankyrin Repeat Protein Evolved To Picomo 1e-05
4a63_B 239 Crystal Structure Of The P73-Aspp2 Complex At 2.6a 1e-05
2xzd_G136 Caspase-3 In Complex With An Inhibitory Darpin-3.4 2e-05
2xzt_G136 Caspase-3 In Complex With Darpin-3.4_i78s Length = 2e-05
2l6b_A115 Nrc Consensus Ankyrin Repeat Protein Solution Struc 2e-04
4b93_B269 Complex Of Vamp7 Cytoplasmic Domain With 2nd Ankyri 2e-04
1n11_A437 D34 Region Of Human Ankyrin-R And Linker Length = 4 3e-04
2vge_A 229 Crystal Structure Of The C-Terminal Region Of Human 3e-04
1uoh_A226 Human Gankyrin Length = 226 3e-04
1qym_A227 X-Ray Structure Of Human Gankyrin Length = 227 3e-04
1ycs_B 239 P53-53bp2 Complex Length = 239 4e-04
2dvw_A231 Structure Of The Oncoprotein Gankyrin In Complex Wi 8e-04
>pdb|1S70|B Chain B, Complex Between Protein Ser/thr Phosphatase-1 (delta) And The Myosin Phosphatase Targeting Subunit 1 (mypt1) Length = 299 Back     alignment and structure 
Iteration: 1

 Score =  150 bits (379), Expect = 7e-37,   Method: Compositional matrix adjust.
 Identities = 109/280 (38%), Positives = 144/280 (51%), Gaps = 47/280 (16%)
Query: 5   RSSSALFKRAEQLKRWEESETNRQPSEMGNKPKKIKFSSGCVFLAACASSDKEEVLNLLK 64
           + + A  KR EQLKRW  SET+ +P  +  K  K+KF  G VFLAAC+S D EEVL LL+
Sbjct: 2   KMADAKQKRNEQLKRWIGSETDLEPPVVKRKKTKVKFDDGAVFLAACSSGDTEEVLRLLE 61
Query: 65  SGADINTANVDGLTALHQ-------------VSKSAST--------LPLHSLNCGPGCVF 103
            GADIN ANVDGLTALHQ             V   A+         +PLH+         
Sbjct: 62  RGADINYANVDGLTALHQACIDDNVDMVKFLVENGANINQPDNEGWIPLHA--------- 112
Query: 104 LAACASSDKEEVLNLLKSGADINTANVDGLTALH-----QLKRWEESETNRQPSEM---G 155
            A+C   D  E   L+  GA +   N +G T L       ++   ++E NRQ  ++    
Sbjct: 113 AASCGYLDIAEY--LISQGAHVGAVNSEGDTPLDIAEEEAMEELLQNEVNRQGVDIEAAR 170
Query: 156 NKPKKIKFSSGCVFLAACASSDKEEVLNLLKSGADINTANVDGLTA----LHQAGADLNF 211
            + ++I       +L +   +D   V +    G  ++ A   G T     L QA  D+N 
Sbjct: 171 KEEERIMLRDARQWLNSGHIND---VRHAKSGGTALHVAAAKGYTEVLKLLIQARYDVNI 227
Query: 212 QDYDGWTPLHAAAHWAQREACQILVENFCDMDVKNYVVST 251
           +DYDGWTPLHAAAHW + EAC+ILVEN CDM+  N V  T
Sbjct: 228 KDYDGWTPLHAAAHWGKEEACRILVENLCDMEAVNKVGQT 267
>pdb|4GPM|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or264. Length = 169 Back     alignment and structure
>pdb|4GPM|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or264. Length = 169 Back     alignment and structure
>pdb|4HQD|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or265. Length = 169 Back     alignment and structure
>pdb|4HQD|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or265. Length = 169 Back     alignment and structure
>pdb|2XEH|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|2QYJ|A Chain A, Crystal Structure Of A Designed Full Consensus Ankyrin Length = 166 Back     alignment and structure
>pdb|2XEE|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|3Q9U|C Chain C, In Silico And In Vitro Co-Evolution Of A High Affinity Complementary Protein-Protein Interface Length = 158 Back     alignment and structure
>pdb|4GMR|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or266. Length = 169 Back     alignment and structure
>pdb|4GMR|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or266. Length = 169 Back     alignment and structure
>pdb|1MJ0|A Chain A, Sank E3_5: An Artificial Ankyrin Repeat Protein Length = 166 Back     alignment and structure
>pdb|4HB5|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or267. Length = 169 Back     alignment and structure
>pdb|4HB5|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or267. Length = 169 Back     alignment and structure
>pdb|1SVX|A Chain A, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Maltose Binding Protein Length = 169 Back     alignment and structure
>pdb|2J8S|D Chain D, Drug Export Pathway Of Multidrug Exporter Acrb Revealed By Darpin Inhibitors Length = 169 Back     alignment and structure
>pdb|2V5Q|C Chain C, Crystal Structure Of Wild-type Plk-1 Kinase Domain In Complex With A Selective Darpin Length = 167 Back     alignment and structure
>pdb|2V5Q|C Chain C, Crystal Structure Of Wild-type Plk-1 Kinase Domain In Complex With A Selective Darpin Length = 167 Back     alignment and structure
>pdb|4ATZ|D Chain D, Ad5 Knob In Complex With A Designed Ankyrin Repeat Protein Length = 154 Back     alignment and structure
>pdb|3ZU7|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Map Kinase Erk2 Length = 169 Back     alignment and structure
>pdb|3NOC|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 Back     alignment and structure
>pdb|3NOC|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 Back     alignment and structure
>pdb|2Y1L|E Chain E, Caspase-8 In Complex With Darpin-8.4 Length = 169 Back     alignment and structure
>pdb|2Y1L|E Chain E, Caspase-8 In Complex With Darpin-8.4 Length = 169 Back     alignment and structure
>pdb|3ZUV|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Phosphorylated Map Kinase Erk2 Length = 136 Back     alignment and structure
>pdb|2P2C|P Chain P, Inhibition Of Caspase-2 By A Designed Ankyrin Repeat Protein (Darpin) Length = 169 Back     alignment and structure
>pdb|2P2C|P Chain P, Inhibition Of Caspase-2 By A Designed Ankyrin Repeat Protein (Darpin) Length = 169 Back     alignment and structure
>pdb|3NOG|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 Back     alignment and structure
>pdb|3NOG|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 Back     alignment and structure
>pdb|1N0R|A Chain A, 4ank: A Designed Ankyrin Repeat Protein With Four Identical Consensus Repeats Length = 126 Back     alignment and structure
>pdb|2BKK|B Chain B, Crystal Structure Of Aminoglycoside Phosphotransferase Aph (3')-Iiia In Complex With The Inhibitor Ar_3a Length = 169 Back     alignment and structure
>pdb|4DUI|A Chain A, Darpin D1 Binding To Tubulin Beta Chain (not In Complex) Length = 169 Back     alignment and structure
>pdb|4DRX|E Chain E, Gtp-Tubulin In Complex With A Darpin Length = 169 Back     alignment and structure
>pdb|2V4H|C Chain C, Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 136 Back     alignment and structure
>pdb|2BKG|A Chain A, Crystal Structure Of E3_19 An Designed Ankyrin Repeat Protein Length = 166 Back     alignment and structure
>pdb|4F6R|D Chain D, Tubulin:stathmin-Like Domain Complex Length = 169 Back     alignment and structure
>pdb|3HG0|D Chain D, Crystal Structure Of A Darpin In Complex With Orf49 From Lactococcal Phage Tp901-1 Length = 136 Back     alignment and structure
>pdb|2Y0B|G Chain G, Caspase-3 In Complex With An Inhibitory Darpin-3.4_s76r Length = 136 Back     alignment and structure
>pdb|1N0Q|A Chain A, 3ank: A Designed Ankyrin Repeat Protein With Three Identical Consensus Repeats Length = 93 Back     alignment and structure
>pdb|2JAB|A Chain A, A Designed Ankyrin Repeat Protein Evolved To Picomolar Affinity To Her2 Length = 136 Back     alignment and structure
>pdb|4A63|B Chain B, Crystal Structure Of The P73-Aspp2 Complex At 2.6a Resolution Length = 239 Back     alignment and structure
>pdb|2XZD|G Chain G, Caspase-3 In Complex With An Inhibitory Darpin-3.4 Length = 136 Back     alignment and structure
>pdb|2XZT|G Chain G, Caspase-3 In Complex With Darpin-3.4_i78s Length = 136 Back     alignment and structure
>pdb|2L6B|A Chain A, Nrc Consensus Ankyrin Repeat Protein Solution Structure Length = 115 Back     alignment and structure
>pdb|4B93|B Chain B, Complex Of Vamp7 Cytoplasmic Domain With 2nd Ankyrin Repeat Domain Of Varp Length = 269 Back     alignment and structure
>pdb|1N11|A Chain A, D34 Region Of Human Ankyrin-R And Linker Length = 437 Back     alignment and structure
>pdb|2VGE|A Chain A, Crystal Structure Of The C-Terminal Region Of Human Iaspp Length = 229 Back     alignment and structure
>pdb|1UOH|A Chain A, Human Gankyrin Length = 226 Back     alignment and structure
>pdb|1QYM|A Chain A, X-Ray Structure Of Human Gankyrin Length = 227 Back     alignment and structure
>pdb|1YCS|B Chain B, P53-53bp2 Complex Length = 239 Back     alignment and structure
>pdb|2DVW|A Chain A, Structure Of The Oncoprotein Gankyrin In Complex With S6 Atpase Of The 26s Proteasome Length = 231 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query251
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 1e-36
1s70_B 299 130 kDa myosin-binding subunit of smooth muscle my 9e-30
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 2e-10
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 8e-29
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 2e-24
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 5e-19
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 4e-12
3v31_A167 Ankyrin repeat family A protein 2; structural geno 3e-28
3v31_A167 Ankyrin repeat family A protein 2; structural geno 1e-07
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 4e-27
3utm_A 351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 2e-26
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 1e-25
3utm_A 351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 4e-25
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 6e-23
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 6e-19
3utm_A 351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 4e-13
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 5e-11
3v30_A172 DNA-binding protein rfxank; structural genomics co 9e-27
3v30_A172 DNA-binding protein rfxank; structural genomics co 4e-19
3v30_A172 DNA-binding protein rfxank; structural genomics co 2e-05
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 1e-26
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 7e-20
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 9e-16
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 2e-26
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 6e-26
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 7e-26
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 1e-25
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 1e-25
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 1e-25
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 4e-25
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 8e-25
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 2e-22
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 2e-16
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 1e-10
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 2e-26
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 1e-24
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 2e-24
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 1e-21
2xai_A 261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 1e-19
2xai_A 261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 1e-14
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 3e-09
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 1e-25
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 1e-23
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 2e-23
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 3e-20
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 1e-13
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 9e-09
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 2e-25
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 3e-22
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 1e-16
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 2e-24
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 8e-24
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 5e-21
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 1e-20
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 3e-24
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 2e-21
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 8e-09
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 3e-24
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 2e-18
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 1e-08
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 2e-07
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 3e-24
2vge_A 229 RELA-associated inhibitor; iaspp, nucleus, apoptos 2e-22
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 2e-21
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 6e-20
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 3e-05
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 5e-24
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 2e-21
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 3e-21
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 4e-07
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 6e-24
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 2e-21
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 3e-21
1oy3_D 282 Transcription factor inhibitor I-kappa-B-beta; pro 8e-12
1oy3_D 282 Transcription factor inhibitor I-kappa-B-beta; pro 2e-11
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 6e-24
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 1e-19
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 2e-12
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 9e-09
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 7e-04
3kea_A 285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 1e-23
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 2e-21
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 4e-19
3kea_A 285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 6e-19
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 8e-13
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 3e-12
3kea_A 285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 9e-07
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 1e-23
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 6e-22
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 1e-21
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 6e-19
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 5e-07
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 2e-23
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 2e-20
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 6e-20
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 3e-07
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 2e-23
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 3e-21
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 1e-20
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 3e-18
1k1a_A 241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 8e-12
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 2e-23
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 3e-21
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 5e-20
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 1e-18
2dzn_A 228 Probable 26S proteasome regulatory subunit P28; an 6e-06
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 6e-23
3deo_A183 Signal recognition particle 43 kDa protein; chloro 6e-23
3deo_A183 Signal recognition particle 43 kDa protein; chloro 6e-18
3deo_A183 Signal recognition particle 43 kDa protein; chloro 4e-15
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 1e-22
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 2e-19
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 3e-15
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 1e-06
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 2e-22
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 6e-17
3aji_A 231 26S proteasome non-ATPase regulatory subunit 10; g 4e-07
1ycs_B 239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 2e-22
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 1e-21
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 2e-19
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 5e-11
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 3e-22
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 6e-21
1wdy_A 285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 2e-19
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 2e-19
1wdy_A 285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 6e-19
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 3e-07
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 4e-22
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 6e-16
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 1e-14
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 1e-07
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 6e-22
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 4e-20
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 7e-22
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 9e-22
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 1e-16
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 9e-14
1ikn_D 236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 9e-12
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 2e-09
1awc_B153 Protein (GA binding protein beta 1); complex (tran 7e-22
1awc_B153 Protein (GA binding protein beta 1); complex (tran 3e-18
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 7e-22
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 9e-20
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 2e-21
2fo1_E 373 LIN-12 protein; beta-barrel, protein-DNA complex, 4e-20
2fo1_E 373 LIN-12 protein; beta-barrel, protein-DNA complex, 6e-20
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 7e-19
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 1e-17
2fo1_E 373 LIN-12 protein; beta-barrel, protein-DNA complex, 1e-16
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 5e-21
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 4e-16
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 1e-09
3hra_A201 Ankyrin repeat family protein; structural protein; 9e-21
3hra_A201 Ankyrin repeat family protein; structural protein; 4e-19
3hra_A 201 Ankyrin repeat family protein; structural protein; 4e-07
3hra_A201 Ankyrin repeat family protein; structural protein; 5e-07
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 2e-20
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 4e-20
3ljn_A 364 Hypothetical protein; ankyrin, structural genomics 7e-20
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 1e-18
3ljn_A 364 Hypothetical protein; ankyrin, structural genomics 9e-15
3ljn_A 364 Hypothetical protein; ankyrin, structural genomics 1e-14
3ljn_A 364 Hypothetical protein; ankyrin, structural genomics 1e-10
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 4e-08
2rfa_A232 Transient receptor potential cation channel subfa 5e-20
2rfa_A232 Transient receptor potential cation channel subfa 4e-17
2rfa_A232 Transient receptor potential cation channel subfa 3e-14
2rfa_A232 Transient receptor potential cation channel subfa 6e-06
2rfa_A 232 Transient receptor potential cation channel subfa 9e-06
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 2e-19
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 4e-15
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 1e-08
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 5e-08
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 4e-19
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 2e-14
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 3e-08
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 2e-18
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 8e-17
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 1e-13
1sw6_A327 Regulatory protein SWI6; transcription regulation, 1e-17
1sw6_A327 Regulatory protein SWI6; transcription regulation, 6e-10
1sw6_A327 Regulatory protein SWI6; transcription regulation, 3e-08
1sw6_A 327 Regulatory protein SWI6; transcription regulation, 2e-07
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 1e-17
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 3e-16
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 8e-14
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 1e-08
2etb_A256 Transient receptor potential cation channel subfam 6e-16
2etb_A256 Transient receptor potential cation channel subfam 3e-15
2etb_A256 Transient receptor potential cation channel subfam 3e-13
2pnn_A273 Transient receptor potential cation channel subfa 4e-15
2pnn_A 273 Transient receptor potential cation channel subfa 9e-07
2pnn_A 273 Transient receptor potential cation channel subfa 5e-04
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 8e-15
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 4e-09
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 9e-09
3jxi_A260 Vanilloid receptor-related osmotically activated p 8e-13
3jxi_A260 Vanilloid receptor-related osmotically activated p 3e-10
3jxi_A 260 Vanilloid receptor-related osmotically activated p 2e-05
3jxi_A260 Vanilloid receptor-related osmotically activated p 1e-04
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 2e-12
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 5e-12
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 1e-05
2aja_A 376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 4e-10
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 2e-08
2aja_A 376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 8e-08
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 4e-07
3lvq_E 497 ARF-GAP with SH3 domain, ANK repeat and PH domain 6e-09
3lvq_E 497 ARF-GAP with SH3 domain, ANK repeat and PH domain 6e-05
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 1e-08
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 1e-06
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 3e-04
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 9e-08
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 3e-05
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 1e-06
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 2e-05
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 2e-04
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 2e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 9e-04
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
 Score =  129 bits (328), Expect = 1e-36
 Identities = 88/289 (30%), Positives = 116/289 (40%), Gaps = 87/289 (30%)

Query: 12  KRAEQLKRWEESETNRQPSEMGNKPKKIKFSSGCVFLAACASSDKEEVLNLLKS------ 65
           KR EQLKRW  SET+ +P  +  K  K+KF  G VFLAAC+S D EEVL LL+       
Sbjct: 9   KRNEQLKRWIGSETDLEPPVVKRKKTKVKFDDGAVFLAACSSGDTEEVLRLLERGADINY 68

Query: 66  ---------------------------GADINTANVDGLTALHQVSKSASTLPLHSLNCG 98
                                      GA+IN  + +G   LH                 
Sbjct: 69  ANVDGLTALHQACIDDNVDMVKFLVENGANINQPDNEGWIPLH----------------- 111

Query: 99  PGCVFLAACASSDKEEVLNLLKSGADINTANVDGLTALH---QLKRWE--ESETNRQPSE 153
                 AA +    +    L+  GA +   N +G T L    +    E  ++E NRQ  +
Sbjct: 112 ------AAASCGYLDIAEYLISQGAHVGAVNSEGDTPLDIAEEEAMEELLQNEVNRQGVD 165

Query: 154 MGNKPKKIKFSSGCVFLAACASSDKEEVLNLLKSGADINTANVDGLTALHQA-------- 205
                +K +               ++    L     +       G TALH A        
Sbjct: 166 -IEAARKEEERIML----------RDARQWLNSGHINDVRHAKSGGTALHVAAAKGYTEV 214

Query: 206 -------GADLNFQDYDGWTPLHAAAHWAQREACQILVENFCDMDVKNY 247
                    D+N +DYDGWTPLHAAAHW + EAC+ILVEN CDM+  N 
Sbjct: 215 LKLLIQARYDVNIKDYDGWTPLHAAAHWGKEEACRILVENLCDMEAVNK 263
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Length = 497 Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Length = 497 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query251
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 100.0
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 100.0
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 100.0
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 100.0
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 100.0
4g8k_A337 2-5A-dependent ribonuclease; ankyrin-repeat domain 100.0
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 100.0
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 100.0
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 100.0
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 100.0
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 100.0
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 100.0
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 100.0
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 100.0
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 100.0
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 100.0
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 100.0
4g8k_A337 2-5A-dependent ribonuclease; ankyrin-repeat domain 100.0
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 100.0
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 100.0
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 100.0
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 100.0
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 100.0
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 100.0
4gpm_A169 Engineered protein OR264; de novo protein, structu 100.0
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 100.0
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 100.0
2rfa_A232 Transient receptor potential cation channel subfa 100.0
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 100.0
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 100.0
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 100.0
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 100.0
2pnn_A273 Transient receptor potential cation channel subfa 100.0
3hra_A201 Ankyrin repeat family protein; structural protein; 100.0
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 100.0
1sw6_A327 Regulatory protein SWI6; transcription regulation, 100.0
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 100.0
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 100.0
2etb_A256 Transient receptor potential cation channel subfam 100.0
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 100.0
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 100.0
3jxi_A260 Vanilloid receptor-related osmotically activated p 100.0
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 100.0
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 100.0
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 100.0
3v30_A172 DNA-binding protein rfxank; structural genomics co 100.0
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 100.0
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 99.98
3v31_A167 Ankyrin repeat family A protein 2; structural geno 99.98
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 99.98
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 99.98
4gpm_A169 Engineered protein OR264; de novo protein, structu 99.98
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 99.97
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 99.97
1sw6_A327 Regulatory protein SWI6; transcription regulation, 99.97
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 99.97
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 99.97
3hra_A201 Ankyrin repeat family protein; structural protein; 99.97
1awc_B153 Protein (GA binding protein beta 1); complex (tran 99.97
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 99.97
2rfa_A232 Transient receptor potential cation channel subfa 99.97
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 99.96
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 99.96
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 99.96
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 99.96
2pnn_A273 Transient receptor potential cation channel subfa 99.96
3v30_A172 DNA-binding protein rfxank; structural genomics co 99.96
2etb_A256 Transient receptor potential cation channel subfam 99.95
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 99.95
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 99.95
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 99.95
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 99.95
3jxi_A260 Vanilloid receptor-related osmotically activated p 99.95
3v31_A167 Ankyrin repeat family A protein 2; structural geno 99.95
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 99.95
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 99.94
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 99.94
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 99.94
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 99.94
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 99.94
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 99.93
1awc_B153 Protein (GA binding protein beta 1); complex (tran 99.93
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 99.93
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 99.93
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 99.93
3deo_A183 Signal recognition particle 43 kDa protein; chloro 99.93
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 99.93
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 99.92
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 99.92
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 99.92
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 99.92
3lvq_E 497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.91
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 99.9
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 99.9
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 99.9
2aja_A 376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 99.9
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 99.9
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 99.89
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 99.89
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 99.88
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 99.88
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 99.87
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 99.87
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 99.86
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 99.85
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 99.85
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 99.84
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 99.83
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 99.83
3deo_A183 Signal recognition particle 43 kDa protein; chloro 99.82
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 99.82
3lvq_E 497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.82
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 99.82
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 99.68
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
Probab=100.00  E-value=2.1e-41  Score=271.51  Aligned_cols=235  Identities=21%  Similarity=0.171  Sum_probs=215.1

Q ss_pred             ccchhHHHHHHHHHHHHHhhccCCCccccCCCCCcc-ccCCChHHHHHHhcCCHHHHHHHHHcCCCCcccCCCCccHHHH
Q psy9957           4 TRSSSALFKRAEQLKRWEESETNRQPSEMGNKPKKI-KFSSGCVFLAACASSDKEEVLNLLKSGADINTANVDGLTALHQ   82 (251)
Q Consensus         4 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~t~L~~A~~~~~~~~v~~Ll~~g~~~~~~~~~g~tpLh~   82 (251)
                      +...++..++.+.++.++..         +.+++.. +..|.||||+|+..|+.+++++|+++|++++..+..|.||||+
T Consensus         8 ~L~~A~~~g~~~~v~~Ll~~---------g~~~~~~~~~~g~t~L~~A~~~g~~~~v~~Ll~~g~~~~~~~~~g~t~L~~   78 (285)
T 1wdy_A            8 LLIKAVQNEDVDLVQQLLEG---------GANVNFQEEEGGWTPLHNAVQMSREDIVELLLRHGADPVLRKKNGATPFLL   78 (285)
T ss_dssp             HHHHHHHTTCHHHHHHHHHT---------TCCTTCCCTTTCCCHHHHHHHTTCHHHHHHHHHTTCCTTCCCTTCCCHHHH
T ss_pred             HHHHHHHcCCHHHHHHHHHc---------CCCcccccCCCCCcHHHHHHHcCCHHHHHHHHHcCCCCcccCCCCCCHHHH
Confidence            34567777888888877754         2334434 6678999999999999999999999999999999999999999


Q ss_pred             HHhhCCCcccccc----------ccCCCchhhHHHhcCCHHHHHHHHHcCCCCccC----------CCCCCcHHHHHHHh
Q psy9957          83 VSKSASTLPLHSL----------NCGPGCVFLAACASSDKEEVLNLLKSGADINTA----------NVDGLTALHQLKRW  142 (251)
Q Consensus        83 a~~~~~~~~~~~~----------~~~~~t~l~~a~~~~~~~~v~~Ll~~g~~~~~~----------~~~g~t~l~~A~~~  142 (251)
                      |+..|+.++++.+          +..|.||||+|+..++.+++++|++.|++++.+          +..|.||||+|+..
T Consensus        79 A~~~~~~~~v~~Ll~~g~~~~~~~~~g~t~L~~A~~~~~~~~~~~Ll~~g~~~~~~~~~~~~~~~~~~~g~t~L~~A~~~  158 (285)
T 1wdy_A           79 AAIAGSVKLLKLFLSKGADVNECDFYGFTAFMEAAVYGKVKALKFLYKRGANVNLRRKTKEDQERLRKGGATALMDAAEK  158 (285)
T ss_dssp             HHHHTCHHHHHHHHHTTCCTTCBCTTCCBHHHHHHHTTCHHHHHHHHHTTCCTTCCCCCCHHHHHTTCCCCCHHHHHHHH
T ss_pred             HHHcCCHHHHHHHHHcCCCCCccCcccCCHHHHHHHhCCHHHHHHHHHhCCCcccccccHHHHHhhccCCCcHHHHHHHc
Confidence            9999999998887          567899999999999999999999999999887          78899999999999


Q ss_pred             CCcchhhhhhhc-CCCCcccccCCCchHHHHHhcCC----HHHHHHHHHcCCCCcccCCCCCchhhhc------------
Q psy9957         143 EESETNRQPSEM-GNKPKKIKFSSGCVFLAACASSD----KEEVLNLLKSGADINTANVDGLTALHQA------------  205 (251)
Q Consensus       143 ~~~~~~~~l~~~-~~~~~~~~~~~~~~l~~a~~~~~----~~~~~~Ll~~~~~~~~~~~~g~t~l~~a------------  205 (251)
                      |+.+++++|++. |.++...+..+.++++.|+..+.    .+++++|+++|++++.++..|.||||+|            
T Consensus       159 ~~~~~v~~Ll~~~~~~~~~~~~~g~t~l~~a~~~~~~~~~~~i~~~Ll~~g~~~~~~~~~g~t~L~~A~~~~~~~~v~~L  238 (285)
T 1wdy_A          159 GHVEVLKILLDEMGADVNACDNMGRNALIHALLSSDDSDVEAITHLLLDHGADVNVRGERGKTPLILAVEKKHLGLVQRL  238 (285)
T ss_dssp             TCHHHHHHHHHTSCCCTTCCCTTSCCHHHHHHHCSCTTTHHHHHHHHHHTTCCSSCCCTTSCCHHHHHHHTTCHHHHHHH
T ss_pred             CCHHHHHHHHHhcCCCCCccCCCCCCHHHHHHHccccchHHHHHHHHHHcCCCCCCcCCCCCcHHHHHHHcCCHHHHHHH
Confidence            999999999987 99999999999999999999999    8999999999999999999999999987            


Q ss_pred             ----CCCCCCCCCCCCcHHHHHHHhCcHHHHHHHHhCCCCCCcccc
Q psy9957         206 ----GADLNFQDYDGWTPLHAAAHWAQREACQILVENFCDMDVKNY  247 (251)
Q Consensus       206 ----~~~~~~~~~~g~t~l~~A~~~~~~~i~~~Ll~~ga~~~~~d~  247 (251)
                          +++++.+|..|.||||+|+..++.+++++|+++|++++.+|.
T Consensus       239 l~~~g~~~~~~~~~g~t~l~~A~~~~~~~i~~~Ll~~Ga~~~~~d~  284 (285)
T 1wdy_A          239 LEQEHIEINDTDSDGKTALLLAVELKLKKIAELLCKRGASTDCGDL  284 (285)
T ss_dssp             HHSSSCCTTCCCTTSCCHHHHHHHTTCHHHHHHHHHHSSCSCCSSC
T ss_pred             HhccCCCccccCCCCCcHHHHHHHcCcHHHHHHHHHcCCCCCcccc
Confidence                889999999999999999999999999999999999999985
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 251
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 1e-31
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 6e-06
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 6e-05
d1n11a_ 408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 1e-19
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 3e-16
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 1e-14
d1n11a_ 408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 1e-13
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 8e-15
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 1e-14
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 2e-13
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 8e-13
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 2e-09
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 2e-12
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 1e-09
d1sw6a_ 301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 3e-05
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 3e-12
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 1e-07
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 1e-06
d1oy3d_ 255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 5e-04
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 8e-11
d2ajaa1 346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 4e-08
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 5e-06
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 9e-11
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 1e-09
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 1e-07
d2fo1e1 277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 3e-05
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 1e-04
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 0.003
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 1e-08
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 1e-04
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 2e-08
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 2e-08
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 3e-06
d1ixva_ 229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 4e-04
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 3e-08
d1k1aa_ 228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 1e-04
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 2e-04
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 1e-07
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 2e-05
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 7e-07
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 0.003
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 0.003
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 3e-06
d1ycsb1130 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) 7e-05
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: beta-hairpin-alpha-hairpin repeat
superfamily: Ankyrin repeat
family: Ankyrin repeat
domain: Myosin phosphatase targeting subunit 1, MYPT1
species: Chicken (Gallus gallus) [TaxId: 9031]

 Score =  115 bits (288), Expect = 1e-31
 Identities = 95/268 (35%), Positives = 122/268 (45%), Gaps = 31/268 (11%)

Query: 5   RSSSALFKRAEQLKRWEESETNRQPSEMGNKPKKIKFSSGCVFLAACASSDKEEVLNLLK 64
           + + A  KR EQLKRW  SET+ +P  +  K  K+KF  G VFLAAC+S D EEVL LL+
Sbjct: 2   KMADAKQKRNEQLKRWIGSETDLEPPVVKRKKTKVKFDDGAVFLAACSSGDTEEVLRLLE 61

Query: 65  SGADINTANVDGLTALHQVSKSAST----------LPLHSLNCGPGCVFLAACASSDKEE 114
            GADIN ANVDGLTALHQ     +             ++  +        AA +    + 
Sbjct: 62  RGADINYANVDGLTALHQACIDDNVDMVKFLVENGANINQPDNEGWIPLHAAASCGYLDI 121

Query: 115 VLNLLKSGADINTANVDGLTALHQLKRWEESETNRQPSEMGNKPKKIKFSSGCVFLAACA 174
              L+  GA +   N +G T L   +     E  +          +         +   A
Sbjct: 122 AEYLISQGAHVGAVNSEGDTPLDIAEEEAMEELLQNEVNRQGVDIEAARKEEERIMLRDA 181

Query: 175 SSDKEEVLNLLKSGADINTANVDGLTALH---------------QAGADLNFQDYDGWTP 219
                    L     +       G TALH               QA  D+N +DYDGWTP
Sbjct: 182 RQ------WLNSGHINDVRHAKSGGTALHVAAAKGYTEVLKLLIQARYDVNIKDYDGWTP 235

Query: 220 LHAAAHWAQREACQILVENFCDMDVKNY 247
           LHAAAHW + EAC+ILVEN CDM+  N 
Sbjct: 236 LHAAAHWGKEEACRILVENLCDMEAVNK 263
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query251
d1n11a_408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1s70b_291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 100.0
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 100.0
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 100.0
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 100.0
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 100.0
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 100.0
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 99.98
d1n11a_408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 99.98
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 99.97
d2fo1e1277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 99.97
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 99.97
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 99.97
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 99.96
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 99.96
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 99.96
d1s70b_291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 99.95
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 99.95
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 99.95
d2fo1e1277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 99.95
d2ajaa1346 Hypothetical protein LPG2416 {Legionella pneumophi 99.95
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 99.94
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 99.94
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 99.93
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 99.93
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 99.92
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.92
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 99.91
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 99.91
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.91
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 99.91
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.91
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 99.89
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.88
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 99.86
d2ajaa1 346 Hypothetical protein LPG2416 {Legionella pneumophi 99.85
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 99.85
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 99.68
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: beta-hairpin-alpha-hairpin repeat
superfamily: Ankyrin repeat
family: Ankyrin repeat
domain: Ankyrin-R
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=6.5e-39  Score=267.69  Aligned_cols=239  Identities=20%  Similarity=0.193  Sum_probs=204.0

Q ss_pred             ccchhHHHHHHHHHHHHHhhccCCCccccCCCCCccccCCChHHHHHHhcCCHHHHHHHHHcCCCCcccCCCCccHHHHH
Q psy9957           4 TRSSSALFKRAEQLKRWEESETNRQPSEMGNKPKKIKFSSGCVFLAACASSDKEEVLNLLKSGADINTANVDGLTALHQV   83 (251)
Q Consensus         4 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~t~L~~A~~~~~~~~v~~Ll~~g~~~~~~~~~g~tpLh~a   83 (251)
                      |+-.||..++.+-++.++..         |.+++..+..|.||||+||..|+.++|++|+++|++++..+..|+||||+|
T Consensus         3 pL~~Aa~~g~~~~v~~Ll~~---------g~~in~~d~~g~TpL~~A~~~g~~~iv~~Ll~~gadi~~~~~~g~t~L~~A   73 (408)
T d1n11a_           3 PLHVASFMGHLPIVKNLLQR---------GASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQTPLHCA   73 (408)
T ss_dssp             HHHHHHHHTCHHHHHHHHHT---------TCCSCCSSSCCCCHHHHHHHHTCHHHHHHHHHHTCCSSCCCTTSCCHHHHH
T ss_pred             hHHHHHHCcCHHHHHHHHHC---------CCCCCCCCCCCCCHHHHHHHcCCHHHHHHHHHCcCCCCCCCCCCCCHHHHH
Confidence            56678999999999988743         667888899999999999999999999999999999999999999999999


Q ss_pred             HhhCCCcccccc-------------------------------------------ccCCCchhhHHHhcCCHHHHHHHHH
Q psy9957          84 SKSASTLPLHSL-------------------------------------------NCGPGCVFLAACASSDKEEVLNLLK  120 (251)
Q Consensus        84 ~~~~~~~~~~~~-------------------------------------------~~~~~t~l~~a~~~~~~~~v~~Ll~  120 (251)
                      ++.|+.+++..+                                           +..+.++++.|+..++.++++.|++
T Consensus        74 ~~~g~~~~~~~Ll~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~a~~~~~~~~v~~ll~  153 (408)
T d1n11a_          74 ARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKEASQACMTKKGFTPLHVAAKYGKVRVAELLLE  153 (408)
T ss_dssp             HHHTCHHHHHHHHHHTCCTTCCCTTCCCHHHHHHHHTCHHHHHHHHHTTCCSCCCCTTSCCHHHHHHHTTCHHHHHHHHH
T ss_pred             HHcCCHHHHHHHHHhhhccccccccccchhhhhhhhcccccccccccccccccccccccchHHHHHHHcCCHHHHHHHHH
Confidence            999998776543                                           4566678888888888888888888


Q ss_pred             cCCCCccCCCCCCcHHHHHHHhCCcchhhhhhhcCCCCcccccCC-----------------------------------
Q psy9957         121 SGADINTANVDGLTALHQLKRWEESETNRQPSEMGNKPKKIKFSS-----------------------------------  165 (251)
Q Consensus       121 ~g~~~~~~~~~g~t~l~~A~~~~~~~~~~~l~~~~~~~~~~~~~~-----------------------------------  165 (251)
                      .|++++.++..|.+|||.|+..++.+++++|+..|.++......+                                   
T Consensus       154 ~~~~~~~~~~~~~~~L~~A~~~~~~~~~~~Ll~~g~~~~~~~~~~~t~l~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~t  233 (408)
T d1n11a_         154 RDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQVEVARSLLQYGGSANAESVQGVT  233 (408)
T ss_dssp             TTCCTTCCCSSCCCHHHHHHHTTCHHHHHHHGGGTCCSCCCCTTCCCHHHHHHHTTCHHHHHHHHHTTCCTTCCCTTCCC
T ss_pred             cCCCCCcCCCcCchHHHHHHHcCCHHHHHHHHhcCCcccccCCCCCCcchhhhccchhhhhhhhhhccccccccCCCCCC
Confidence            888888888888888888888888888888887776654333222                                   


Q ss_pred             -------------------------------CchHHHHHhcCCHHHHHHHHHcCCCCcccCCCCCchhhhc---------
Q psy9957         166 -------------------------------GCVFLAACASSDKEEVLNLLKSGADINTANVDGLTALHQA---------  205 (251)
Q Consensus       166 -------------------------------~~~l~~a~~~~~~~~~~~Ll~~~~~~~~~~~~g~t~l~~a---------  205 (251)
                                                     .++++.++..++.+++++|+++|++++..+..+.||||.+         
T Consensus       234 ~l~~a~~~~~~~~~~~~~~~~~~~~~~~~~g~~~l~~a~~~~~~~i~~~Ll~~g~~~~~~~~~~~t~L~~~~~~~~~~~~  313 (408)
T d1n11a_         234 PLHLAAQEGHAEMVALLLSKQANGNLGNKSGLTPLHLVAQEGHVPVADVLIKHGVMVDATTRMGYTPLHVASHYGNIKLV  313 (408)
T ss_dssp             HHHHHHHTTCHHHHHHHHTTTCCTTCCCTTCCCHHHHHHHHTCHHHHHHHHHHTCCTTCCCSSCCCHHHHHHHSSCSHHH
T ss_pred             HHHHHHHhCcHhHhhhhhccccccccccCCCCChhhhhhhcCcHHHHHHHHHCCCccccccccccccchhhcccCcceee
Confidence                                           3344446777778888888888888888888888888866         


Q ss_pred             ------CCCCCCCCCCCCcHHHHHHHhCcHHHHHHHHhCCCCCCcccccCCC
Q psy9957         206 ------GADLNFQDYDGWTPLHAAAHWAQREACQILVENFCDMDVKNYVVST  251 (251)
Q Consensus       206 ------~~~~~~~~~~g~t~l~~A~~~~~~~i~~~Ll~~ga~~~~~d~~g~t  251 (251)
                            +++++.+|..|.||||+|++.|+.++|++|+++|||+|++|..|+|
T Consensus       314 ~~ll~~g~~in~~d~~G~T~Lh~A~~~g~~~iv~~Ll~~GAd~n~~d~~G~t  365 (408)
T d1n11a_         314 KFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGASPNEVSSDGTT  365 (408)
T ss_dssp             HHHHHTTCCTTCCCTTSCCHHHHHHHTTCHHHHHHHHHTTCCSCCCCSSSCC
T ss_pred             eeeccccccccccCCCCCCHHHHHHHcCCHHHHHHHHHCCCCCCCCCCCCCC
Confidence                  8999999999999999999999999999999999999999999987
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure