Diaphorina citri psyllid: psy9968


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------12
MQVHATDVDPPSNGGTIQYRIIKAPGERAKFSIDKETGIVKTLYALDRDDPEREKEIYITTDIRVQALDRDDPEREKEIYITVIAEDNGTPQLSDACTMKITVEDINDNEPMFDRVQY
cEEEEEcccccccccEEEEEEEEcccccccEEECccccEEEEccccccccccccHHHEEEHHHHcccccccccccccEEEEEEEEECccccccccEEEEEEEEEEccccccccccccc
MQVHATDVDPPSNGGTIQYRIIKAPGERAKFSIDKETGIVKTLYALDRDDPEREKEIYITTDIRVQALDRDDPEREKEIYITVIAEDNGTPQLSDACTMKITVEDINDNEPMFD****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQVHATDVDPPSNGGTIQYRIIKAPGERAKFSIDKETGIVKTLYALDRDDPEREKEIYITTDIRVQALDRDDPEREKEIYITVIAEDNGTPQLSDACTMKITVEDINDNEPMFDRVQY

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0030175 [CC]filopodiumprobableGO:0005575, GO:0042995, GO:0044464, GO:0005623
GO:0005509 [MF]calcium ion bindingprobableGO:0043169, GO:0046872, GO:0003674, GO:0005488, GO:0043167
GO:0005913 [CC]cell-cell adherens junctionprobableGO:0005575, GO:0030054, GO:0070161, GO:0005912, GO:0005911
GO:0043231 [CC]intracellular membrane-bounded organelleprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0043232 [CC]intracellular non-membrane-bounded organelleprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0043228, GO:0044424, GO:0043226
GO:0043296 [CC]apical junction complexprobableGO:0005575, GO:0030054, GO:0005911
GO:0044446 [CC]intracellular organelle partprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043226, GO:0044422
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0044331 [BP]cell-cell adhesion mediated by cadherinprobableGO:0016337, GO:0009987, GO:0044763, GO:0044699, GO:0007155, GO:0008150, GO:0022610, GO:0033631, GO:0033627
GO:0044459 [CC]plasma membrane partprobableGO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1Q55, chain A
Confidence level:very confident
Coverage over the Query: 1-45,68-118
View the alignment between query and template
View the model in PyMOL