Psyllid ID: psy9968
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 118 | ||||||
| 383860977 | 1584 | PREDICTED: DE-cadherin-like [Megachile r | 0.813 | 0.060 | 0.5 | 2e-26 | |
| 328783387 | 1576 | PREDICTED: DE-cadherin-like [Apis mellif | 0.813 | 0.060 | 0.491 | 5e-26 | |
| 380016155 | 1489 | PREDICTED: LOW QUALITY PROTEIN: DE-cadhe | 0.813 | 0.064 | 0.491 | 5e-26 | |
| 350404065 | 1575 | PREDICTED: DE-cadherin-like [Bombus impa | 0.813 | 0.060 | 0.474 | 1e-24 | |
| 340725620 | 1575 | PREDICTED: DE-cadherin-like [Bombus terr | 0.813 | 0.060 | 0.474 | 1e-24 | |
| 332024902 | 1525 | DE-cadherin [Acromyrmex echinatior] | 0.813 | 0.062 | 0.474 | 9e-24 | |
| 345493189 | 1504 | PREDICTED: DE-cadherin-like [Nasonia vit | 0.813 | 0.063 | 0.483 | 2e-23 | |
| 242019060 | 1478 | Cadherin-23 precursor, putative [Pedicul | 0.813 | 0.064 | 0.449 | 8e-23 | |
| 332024905 | 1591 | DE-cadherin [Acromyrmex echinatior] | 0.813 | 0.060 | 0.440 | 1e-21 | |
| 61162121 | 1481 | Gb1-cadherin [Gryllus bimaculatus] | 0.813 | 0.064 | 0.457 | 9e-21 |
| >gi|383860977|ref|XP_003705963.1| PREDICTED: DE-cadherin-like [Megachile rotundata] | Back alignment and taxonomy information |
|---|
Score = 123 bits (308), Expect = 2e-26, Method: Compositional matrix adjust.
Identities = 59/118 (50%), Positives = 74/118 (62%), Gaps = 22/118 (18%)
Query: 1 MQVHATDVDPPSNGGTIQYRIIKAPGERAKFSIDKETGIVKTLYALDRDDPEREKEIYIT 60
+QVHA D D P +GGTI Y + APGE+ KF ID TG+++T
Sbjct: 98 IQVHAEDRDHPDDGGTITYSFVTAPGEKLKFEIDNRTGLIRT------------------ 139
Query: 61 TDIRVQALDRDDPEREKEIYITVIAEDNGTPQLSDACTMKITVEDINDNEPMFDRVQY 118
Q LDRD+P REKE Y+TV+A DNG PQL D CT K+T+ED+NDNEP+FD+V Y
Sbjct: 140 ----TQGLDRDEPAREKEAYLTVLATDNGRPQLDDVCTFKVTIEDVNDNEPVFDKVAY 193
|
Source: Megachile rotundata Species: Megachile rotundata Genus: Megachile Family: Megachilidae Order: Hymenoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|328783387|ref|XP_394063.4| PREDICTED: DE-cadherin-like [Apis mellifera] | Back alignment and taxonomy information |
|---|
| >gi|380016155|ref|XP_003692054.1| PREDICTED: LOW QUALITY PROTEIN: DE-cadherin-like [Apis florea] | Back alignment and taxonomy information |
|---|
| >gi|350404065|ref|XP_003486995.1| PREDICTED: DE-cadherin-like [Bombus impatiens] | Back alignment and taxonomy information |
|---|
| >gi|340725620|ref|XP_003401166.1| PREDICTED: DE-cadherin-like [Bombus terrestris] | Back alignment and taxonomy information |
|---|
| >gi|332024902|gb|EGI65090.1| DE-cadherin [Acromyrmex echinatior] | Back alignment and taxonomy information |
|---|
| >gi|345493189|ref|XP_001603649.2| PREDICTED: DE-cadherin-like [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
| >gi|242019060|ref|XP_002429984.1| Cadherin-23 precursor, putative [Pediculus humanus corporis] gi|212515039|gb|EEB17246.1| Cadherin-23 precursor, putative [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
| >gi|332024905|gb|EGI65093.1| DE-cadherin [Acromyrmex echinatior] | Back alignment and taxonomy information |
|---|
| >gi|61162121|dbj|BAD91050.1| Gb1-cadherin [Gryllus bimaculatus] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 118 | ||||||
| UNIPROTKB|F1NWW5 | 4592 | FAT1 "Uncharacterized protein" | 0.5 | 0.012 | 0.474 | 3.6e-12 | |
| UNIPROTKB|E2R353 | 4591 | FAT1 "Uncharacterized protein" | 0.398 | 0.010 | 0.531 | 3.9e-09 | |
| UNIPROTKB|F6XXM1 | 5056 | FAT1 "Uncharacterized protein" | 0.398 | 0.009 | 0.531 | 5.2e-09 | |
| ZFIN|ZDB-GENE-050608-3 | 939 | pcdh1g3 "protocadherin 1 gamma | 0.449 | 0.056 | 0.410 | 1.2e-10 | |
| FB|FBgn0003391 | 1507 | shg "shotgun" [Drosophila mela | 0.423 | 0.033 | 0.54 | 2.5e-10 | |
| UNIPROTKB|A8MWK3 | 875 | CDH2 "Cadherin-2" [Homo sapien | 0.423 | 0.057 | 0.444 | 2.8e-10 | |
| UNIPROTKB|P19022 | 906 | CDH2 "Cadherin-2" [Homo sapien | 0.423 | 0.055 | 0.444 | 3.1e-10 | |
| UNIPROTKB|F1PEC4 | 906 | CDH2 "Uncharacterized protein" | 0.423 | 0.055 | 0.444 | 3.9e-10 | |
| MGI|MGI:88355 | 906 | Cdh2 "cadherin 2" [Mus musculu | 0.423 | 0.055 | 0.444 | 3.9e-10 | |
| RGD|69280 | 906 | Cdh2 "cadherin 2" [Rattus norv | 0.423 | 0.055 | 0.444 | 3.9e-10 |
| UNIPROTKB|F1NWW5 FAT1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
Score = 127 (49.8 bits), Expect = 3.6e-12, Sum P(2) = 3.6e-12
Identities = 28/59 (47%), Positives = 34/59 (57%)
Query: 60 TTDIRVQALDRDDPEREKEIYITVIAEDNGTPQLSDACTMKITVEDINDNEPMFDRVQY 118
TT + +D D E E Y+TV A D GTP LSD T+ I V DINDN P+F + Y
Sbjct: 3285 TTVGAIFIIDSLDYESSHEYYLTVEATDGGTPSLSDVVTVNINVTDINDNTPVFSQDTY 3343
|
|
| UNIPROTKB|E2R353 FAT1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F6XXM1 FAT1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-050608-3 pcdh1g3 "protocadherin 1 gamma 3" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0003391 shg "shotgun" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|A8MWK3 CDH2 "Cadherin-2" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P19022 CDH2 "Cadherin-2" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1PEC4 CDH2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:88355 Cdh2 "cadherin 2" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| RGD|69280 Cdh2 "cadherin 2" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 118 | |||
| cd11304 | 98 | cd11304, Cadherin_repeat, Cadherin tandem repeat d | 6e-17 | |
| smart00112 | 81 | smart00112, CA, Cadherin repeats | 1e-15 | |
| pfam00028 | 92 | pfam00028, Cadherin, Cadherin domain | 2e-08 |
| >gnl|CDD|206637 cd11304, Cadherin_repeat, Cadherin tandem repeat domain | Back alignment and domain information |
|---|
Score = 69.6 bits (171), Expect = 6e-17
Identities = 37/109 (33%), Positives = 46/109 (42%), Gaps = 27/109 (24%)
Query: 1 MQVHATDVDPPSNGGTIQYRIIKAPGERAKFSIDKETGIVKTLYALDRDDPEREKEIYIT 60
+ V ATD D NG + Y I+ + E FSID TG + T LDR
Sbjct: 17 LTVSATDPDSGENG-EVTYSIV-SGNEDGLFSIDPSTGEITTAKPLDR------------ 62
Query: 61 TDIRVQALDRDDPEREKEIYITVIAEDNGTPQLSDACTMKITVEDINDN 109
E + +TV A D G P LS T+ ITV D+NDN
Sbjct: 63 -------------EEQSSYTLTVTATDGGGPPLSSTATVTITVLDVNDN 98
|
Cadherins are glycoproteins involved in Ca2+-mediated cell-cell adhesion. The cadherin repeat domains occur as tandem repeats in the extracellular regions, which are thought to mediate cell-cell contact when bound to calcium. They play numerous roles in cell fate, signalling, proliferation, differentiation, and migration; members include E-, N-, P-, T-, VE-, CNR-, proto-, and FAT-family cadherin, desmocollin, and desmoglein, a large variety of domain architectures with varying repeat copy numbers. Cadherin-repeat containing proteins exist as monomers, homodimers, or heterodimers. Length = 98 |
| >gnl|CDD|214520 smart00112, CA, Cadherin repeats | Back alignment and domain information |
|---|
| >gnl|CDD|215665 pfam00028, Cadherin, Cadherin domain | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 118 | |||
| smart00112 | 79 | CA Cadherin repeats. Cadherins are glycoproteins i | 99.84 | |
| cd00031 | 199 | CA Cadherin repeat domain; Cadherins are glycoprot | 99.76 | |
| KOG4289|consensus | 2531 | 99.74 | ||
| KOG4289|consensus | 2531 | 99.72 | ||
| PF00028 | 93 | Cadherin: Cadherin domain; InterPro: IPR002126 Cad | 99.7 | |
| KOG1219|consensus | 4289 | 99.64 | ||
| KOG1219|consensus | 4289 | 99.63 | ||
| cd00031 | 199 | CA Cadherin repeat domain; Cadherins are glycoprot | 99.3 | |
| KOG1834|consensus | 952 | 98.75 | ||
| KOG1834|consensus | 952 | 97.91 | ||
| smart00736 | 97 | CADG Dystroglycan-type cadherin-like domains. Cadh | 97.21 | |
| PF08266 | 84 | Cadherin_2: Cadherin-like; InterPro: IPR013164 Cad | 96.06 | |
| TIGR01965 | 99 | VCBS_repeat VCBS repeat. This domain of about 100 | 94.7 | |
| PF05345 | 49 | He_PIG: Putative Ig domain; InterPro: IPR008009 Th | 83.36 |
| >smart00112 CA Cadherin repeats | Back alignment and domain information |
|---|
Probab=99.84 E-value=6.3e-20 Score=111.91 Aligned_cols=79 Identities=43% Similarity=0.663 Sum_probs=70.4
Q ss_pred EeCCCCCCCCcEEEEEEeCCCCCccEEEeCCCCEEEEeeeecCCCCcccceeeeeeeeecccCCCCCCCCcceEEEEEEE
Q psy9968 6 TDVDPPSNGGTIQYRIIKAPGERAKFSIDKETGIVKTLYALDRDDPEREKEIYITTDIRVQALDRDDPEREKEIYITVIA 85 (118)
Q Consensus 6 ~D~D~~~~n~~i~y~i~~~~~~~~~F~id~~tG~i~~~~~ld~e~~~~~~~~~~~~~~~~~~lDre~~~~~~~~~l~v~a 85 (118)
+|+|.| .|+.++|+|..+... .+|.|++.+|.|++.+. |||| ....|.|.|.|
T Consensus 1 ~D~D~g-~n~~i~Y~i~~~~~~-~~F~i~~~tg~i~~~~~----------------------LD~e---~~~~y~l~v~a 53 (79)
T smart00112 1 TDADSG-ENGKVTYSILSGNED-GLFSIDPETGEITTTKP----------------------LDRE---EQPEYTLTVEA 53 (79)
T ss_pred CCCCCC-cCcEEEEEEecCCCC-CEEEEeCCccEEEeCCc----------------------cCee---CCCeEEEEEEE
Confidence 488998 689999999965442 69999999999988888 6887 55799999999
Q ss_pred EECCCCCCeeEEEEEEEEEeCCCCCC
Q psy9968 86 EDNGTPQLSDACTMKITVEDINDNEP 111 (118)
Q Consensus 86 ~D~g~p~~s~~~~v~I~v~DvNDn~P 111 (118)
.|.|.|+++++++|.|+|.|+|||+|
T Consensus 54 ~D~~~~~~~~~~~v~I~V~D~Nd~~P 79 (79)
T smart00112 54 TDGGGPPLSSTATVTVTVLDVNDNAP 79 (79)
T ss_pred EECCCCCcccEEEEEEEEEECCCCCC
Confidence 99999999999999999999999998
|
Cadherins are glycoproteins involved in Ca2+-mediated cell-cell adhesion. Cadherin domains occur as repeats in the extracellular regions which are thought to mediate cell-cell contact when bound to calcium. |
| >cd00031 CA Cadherin repeat domain; Cadherins are glycoproteins involved in Ca2+-mediated cell-cell adhesion; these domains occur as repeats in the extracellular regions which are thought to mediate cell-cell contact when bound to calcium; plays a role in cell fate, signalling, proliferation, differentiation, and migration; members include E-, N-, P-, T-, VE-,CNR-,proto-,and FAT-family cadherin, desmocollin, and desmoglein, exists as monomers or dimers (hetero- and homo-); two copies of the repeat are present here | Back alignment and domain information |
|---|
| >KOG4289|consensus | Back alignment and domain information |
|---|
| >KOG4289|consensus | Back alignment and domain information |
|---|
| >PF00028 Cadherin: Cadherin domain; InterPro: IPR002126 Cadherins are a family of adhesion molecules that mediate Ca2+-dependent cell-cell adhesion in all solid tissues of the organism which modulate a wide variety of processes including cell polarisation and migration [, ,] | Back alignment and domain information |
|---|
| >KOG1219|consensus | Back alignment and domain information |
|---|
| >KOG1219|consensus | Back alignment and domain information |
|---|
| >cd00031 CA Cadherin repeat domain; Cadherins are glycoproteins involved in Ca2+-mediated cell-cell adhesion; these domains occur as repeats in the extracellular regions which are thought to mediate cell-cell contact when bound to calcium; plays a role in cell fate, signalling, proliferation, differentiation, and migration; members include E-, N-, P-, T-, VE-,CNR-,proto-,and FAT-family cadherin, desmocollin, and desmoglein, exists as monomers or dimers (hetero- and homo-); two copies of the repeat are present here | Back alignment and domain information |
|---|
| >KOG1834|consensus | Back alignment and domain information |
|---|
| >KOG1834|consensus | Back alignment and domain information |
|---|
| >smart00736 CADG Dystroglycan-type cadherin-like domains | Back alignment and domain information |
|---|
| >PF08266 Cadherin_2: Cadherin-like; InterPro: IPR013164 Cadherins are a family of adhesion molecules that mediate Ca2+-dependent cell-cell adhesion in all solid tissues of the organism which modulate a wide variety of processes including cell polarisation and migration [, ,] | Back alignment and domain information |
|---|
| >TIGR01965 VCBS_repeat VCBS repeat | Back alignment and domain information |
|---|
| >PF05345 He_PIG: Putative Ig domain; InterPro: IPR008009 This alignment represents the conserved core region of a ~90 residue repeat found in several haemagglutinins and other cell surface proteins | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 118 | ||||
| 3q2w_A | 559 | Crystal Structure Of Mouse N-Cadherin Ectodomain Le | 3e-05 | ||
| 3q2v_A | 550 | Crystal Structure Of Mouse E-Cadherin Ectodomain Le | 6e-04 |
| >pdb|3Q2W|A Chain A, Crystal Structure Of Mouse N-Cadherin Ectodomain Length = 559 | Back alignment and structure |
|
| >pdb|3Q2V|A Chain A, Crystal Structure Of Mouse E-Cadherin Ectodomain Length = 550 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 118 | |||
| 1q55_A | 880 | EP-cadherin, C-cadherin; trans interaction, desmos | 2e-18 | |
| 1q55_A | 880 | EP-cadherin, C-cadherin; trans interaction, desmos | 3e-16 | |
| 1q55_A | 880 | EP-cadherin, C-cadherin; trans interaction, desmos | 5e-12 | |
| 1q55_A | 880 | EP-cadherin, C-cadherin; trans interaction, desmos | 7e-09 | |
| 1q55_A | 880 | EP-cadherin, C-cadherin; trans interaction, desmos | 2e-08 | |
| 1q55_A | 880 | EP-cadherin, C-cadherin; trans interaction, desmos | 3e-05 | |
| 1q55_A | 880 | EP-cadherin, C-cadherin; trans interaction, desmos | 3e-04 | |
| 1l3w_A | 546 | EP-cadherin, C-cadherin; cell adhesion, calcium bi | 1e-17 | |
| 1l3w_A | 546 | EP-cadherin, C-cadherin; cell adhesion, calcium bi | 9e-16 | |
| 1l3w_A | 546 | EP-cadherin, C-cadherin; cell adhesion, calcium bi | 3e-12 | |
| 1l3w_A | 546 | EP-cadherin, C-cadherin; cell adhesion, calcium bi | 5e-10 | |
| 1l3w_A | 546 | EP-cadherin, C-cadherin; cell adhesion, calcium bi | 6e-09 | |
| 3q2v_A | 550 | Cadherin-1; cell adhesion, calcium binding; HET: M | 1e-17 | |
| 3q2v_A | 550 | Cadherin-1; cell adhesion, calcium binding; HET: M | 3e-15 | |
| 3q2v_A | 550 | Cadherin-1; cell adhesion, calcium binding; HET: M | 4e-13 | |
| 3q2v_A | 550 | Cadherin-1; cell adhesion, calcium binding; HET: M | 2e-12 | |
| 3q2v_A | 550 | Cadherin-1; cell adhesion, calcium binding; HET: M | 8e-09 | |
| 1ncg_A | 110 | N-cadherin; cell adhesion protein; 2.10A {Mus musc | 2e-17 | |
| 2x2u_A | 246 | Proto-oncogene tyrosine-protein kinase receptor RE | 4e-17 | |
| 2x2u_A | 246 | Proto-oncogene tyrosine-protein kinase receptor RE | 1e-13 | |
| 3q2w_A | 559 | Cadherin-2; cell adhesion, calcium binding; HET: M | 1e-16 | |
| 3q2w_A | 559 | Cadherin-2; cell adhesion, calcium binding; HET: M | 2e-15 | |
| 3q2w_A | 559 | Cadherin-2; cell adhesion, calcium binding; HET: M | 9e-14 | |
| 3q2w_A | 559 | Cadherin-2; cell adhesion, calcium binding; HET: M | 5e-13 | |
| 3q2w_A | 559 | Cadherin-2; cell adhesion, calcium binding; HET: M | 1e-09 | |
| 2qvi_A | 215 | Cadherin-2; beta barrel, strand SWAP, domain SWAP, | 2e-16 | |
| 2qvi_A | 215 | Cadherin-2; beta barrel, strand SWAP, domain SWAP, | 1e-09 | |
| 2yst_A | 119 | Protocadherin-7; BH-PCDH, beta-sandwich, structura | 2e-16 | |
| 2a62_A | 322 | Cadherin-8; extracellular domain, homodimer, calci | 3e-16 | |
| 2a62_A | 322 | Cadherin-8; extracellular domain, homodimer, calci | 5e-15 | |
| 2a62_A | 322 | Cadherin-8; extracellular domain, homodimer, calci | 2e-06 | |
| 3k5r_A | 218 | Cadherin 13; mouse, structural protein; 2.00A {Mus | 4e-16 | |
| 3k5r_A | 218 | Cadherin 13; mouse, structural protein; 2.00A {Mus | 7e-10 | |
| 2yqg_A | 123 | Desmoglein-2, HDGC; cadherin, structural genomics, | 2e-15 | |
| 2a4e_A | 215 | Cadherin-11; dimer, calcium binding, cell adhesion | 2e-15 | |
| 2a4e_A | 215 | Cadherin-11; dimer, calcium binding, cell adhesion | 2e-15 | |
| 3qrb_A | 213 | Cadherin-1; cell adhesion; HET: PGE; 1.80A {Mus mu | 4e-15 | |
| 3qrb_A | 213 | Cadherin-1; cell adhesion; HET: PGE; 1.80A {Mus mu | 2e-12 | |
| 3lnd_A | 207 | CDH6 protein, cadherin 6; cell adhesion, cell memb | 4e-15 | |
| 3lnd_A | 207 | CDH6 protein, cadherin 6; cell adhesion, cell memb | 1e-10 | |
| 3ppe_A | 203 | Vascular endothelial cadherin; extracellular cadhe | 1e-14 | |
| 3ppe_A | 203 | Vascular endothelial cadherin; extracellular cadhe | 3e-11 | |
| 3ubf_A | 316 | Neural-cadherin; cell adhesion; 2.50A {Drosophila | 2e-14 | |
| 3ubf_A | 316 | Neural-cadherin; cell adhesion; 2.50A {Drosophila | 5e-14 | |
| 3ubf_A | 316 | Neural-cadherin; cell adhesion; 2.50A {Drosophila | 1e-13 | |
| 3ubh_A | 419 | Neural-cadherin; cell adhesion; 2.70A {Drosophila | 2e-14 | |
| 3ubh_A | 419 | Neural-cadherin; cell adhesion; 2.70A {Drosophila | 2e-13 | |
| 3ubh_A | 419 | Neural-cadherin; cell adhesion; 2.70A {Drosophila | 7e-12 | |
| 3ubh_A | 419 | Neural-cadherin; cell adhesion; 2.70A {Drosophila | 3e-09 | |
| 3mvs_A | 210 | Cadherin-23, otocadherin; adhesion, extracellular | 6e-14 | |
| 3mvs_A | 210 | Cadherin-23, otocadherin; adhesion, extracellular | 3e-13 | |
| 3k6d_A | 99 | T-cadherin; cell adhesion; 1.80A {Xenopus laevis} | 4e-11 | |
| 3k6f_A | 100 | T-cadherin; cell adhesion, calcium, cell membrane, | 4e-11 | |
| 1zvn_A | 99 | Mn-cadherin; strand dimer, ----; 2.16A {Gallus gal | 1e-09 | |
| 3k6i_A | 99 | T-cadherin; cell adhesion, alternative splicing, c | 4e-09 | |
| 1zxk_A | 98 | Cadherin-8; strand dimer, cell adhesion; 2.00A {Mu | 4e-09 | |
| 2omz_B | 105 | Epithelial-cadherin; leucine-rich-repeat, nvasion | 3e-08 | |
| 2ee0_A | 114 | Protocadherin-9; Ca domain, structural genomics, N | 4e-08 |
| >1q55_A EP-cadherin, C-cadherin; trans interaction, desmosome, junction, adhesion, structural protein; HET: NAG NDG; 30.00A {Mus musculus} SCOP: i.20.1.1 PDB: 1q5a_A* 1q5b_A* 1q5c_A* Length = 880 | Back alignment and structure |
|---|
Score = 78.4 bits (193), Expect = 2e-18
Identities = 35/123 (28%), Positives = 48/123 (39%), Gaps = 29/123 (23%)
Query: 1 MQVHATDVDPPSNG--GTIQYRIIK---APGERAKFSIDKETGIVKTLYALDRDDPEREK 55
M V ATD D + G + Y I+K F+I++ETG++ +
Sbjct: 283 MAVSATDEDDNIDSLNGVLSYSILKQDPEEPIPNLFTINRETGVISLI------------ 330
Query: 56 EIYITTDIRVQALDRDDPEREKEIYITVIAEDNGTPQLSDACTMKITVEDINDNEPMFDR 115
LDR E+ E +TV A D LS I + D NDN P+FD
Sbjct: 331 ---------GTGLDR---EKFPEYTLTVQATDLEGAGLSVEGKAIIQITDANDNAPIFDP 378
Query: 116 VQY 118
Y
Sbjct: 379 KTY 381
|
| >1q55_A EP-cadherin, C-cadherin; trans interaction, desmosome, junction, adhesion, structural protein; HET: NAG NDG; 30.00A {Mus musculus} SCOP: i.20.1.1 PDB: 1q5a_A* 1q5b_A* 1q5c_A* Length = 880 | Back alignment and structure |
|---|
| >1q55_A EP-cadherin, C-cadherin; trans interaction, desmosome, junction, adhesion, structural protein; HET: NAG NDG; 30.00A {Mus musculus} SCOP: i.20.1.1 PDB: 1q5a_A* 1q5b_A* 1q5c_A* Length = 880 | Back alignment and structure |
|---|
| >1q55_A EP-cadherin, C-cadherin; trans interaction, desmosome, junction, adhesion, structural protein; HET: NAG NDG; 30.00A {Mus musculus} SCOP: i.20.1.1 PDB: 1q5a_A* 1q5b_A* 1q5c_A* Length = 880 | Back alignment and structure |
|---|
| >1q55_A EP-cadherin, C-cadherin; trans interaction, desmosome, junction, adhesion, structural protein; HET: NAG NDG; 30.00A {Mus musculus} SCOP: i.20.1.1 PDB: 1q5a_A* 1q5b_A* 1q5c_A* Length = 880 | Back alignment and structure |
|---|
| >1q55_A EP-cadherin, C-cadherin; trans interaction, desmosome, junction, adhesion, structural protein; HET: NAG NDG; 30.00A {Mus musculus} SCOP: i.20.1.1 PDB: 1q5a_A* 1q5b_A* 1q5c_A* Length = 880 | Back alignment and structure |
|---|
| >1q55_A EP-cadherin, C-cadherin; trans interaction, desmosome, junction, adhesion, structural protein; HET: NAG NDG; 30.00A {Mus musculus} SCOP: i.20.1.1 PDB: 1q5a_A* 1q5b_A* 1q5c_A* Length = 880 | Back alignment and structure |
|---|
| >1l3w_A EP-cadherin, C-cadherin; cell adhesion, calcium binding, extracellular, ECT metal binding protein; HET: NAG NDG; 3.08A {Xenopus laevis} SCOP: b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 Length = 546 | Back alignment and structure |
|---|
| >1l3w_A EP-cadherin, C-cadherin; cell adhesion, calcium binding, extracellular, ECT metal binding protein; HET: NAG NDG; 3.08A {Xenopus laevis} SCOP: b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 Length = 546 | Back alignment and structure |
|---|
| >1l3w_A EP-cadherin, C-cadherin; cell adhesion, calcium binding, extracellular, ECT metal binding protein; HET: NAG NDG; 3.08A {Xenopus laevis} SCOP: b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 Length = 546 | Back alignment and structure |
|---|
| >1l3w_A EP-cadherin, C-cadherin; cell adhesion, calcium binding, extracellular, ECT metal binding protein; HET: NAG NDG; 3.08A {Xenopus laevis} SCOP: b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 Length = 546 | Back alignment and structure |
|---|
| >1l3w_A EP-cadherin, C-cadherin; cell adhesion, calcium binding, extracellular, ECT metal binding protein; HET: NAG NDG; 3.08A {Xenopus laevis} SCOP: b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 Length = 546 | Back alignment and structure |
|---|
| >3q2v_A Cadherin-1; cell adhesion, calcium binding; HET: MAN; 3.40A {Mus musculus} Length = 550 | Back alignment and structure |
|---|
| >3q2v_A Cadherin-1; cell adhesion, calcium binding; HET: MAN; 3.40A {Mus musculus} Length = 550 | Back alignment and structure |
|---|
| >3q2v_A Cadherin-1; cell adhesion, calcium binding; HET: MAN; 3.40A {Mus musculus} Length = 550 | Back alignment and structure |
|---|
| >3q2v_A Cadherin-1; cell adhesion, calcium binding; HET: MAN; 3.40A {Mus musculus} Length = 550 | Back alignment and structure |
|---|
| >3q2v_A Cadherin-1; cell adhesion, calcium binding; HET: MAN; 3.40A {Mus musculus} Length = 550 | Back alignment and structure |
|---|
| >1ncg_A N-cadherin; cell adhesion protein; 2.10A {Mus musculus} SCOP: b.1.6.1 PDB: 1nch_A 1nci_A Length = 110 | Back alignment and structure |
|---|
| >2x2u_A Proto-oncogene tyrosine-protein kinase receptor RET; hirschsprung disease, extracellular domain, disease mutation, transferase, glycoprotein; HET: NAG SO4; 2.00A {Homo sapiens} Length = 246 | Back alignment and structure |
|---|
| >2x2u_A Proto-oncogene tyrosine-protein kinase receptor RET; hirschsprung disease, extracellular domain, disease mutation, transferase, glycoprotein; HET: NAG SO4; 2.00A {Homo sapiens} Length = 246 | Back alignment and structure |
|---|
| >3q2w_A Cadherin-2; cell adhesion, calcium binding; HET: MAN NAG; 3.20A {Mus musculus} Length = 559 | Back alignment and structure |
|---|
| >3q2w_A Cadherin-2; cell adhesion, calcium binding; HET: MAN NAG; 3.20A {Mus musculus} Length = 559 | Back alignment and structure |
|---|
| >3q2w_A Cadherin-2; cell adhesion, calcium binding; HET: MAN NAG; 3.20A {Mus musculus} Length = 559 | Back alignment and structure |
|---|
| >3q2w_A Cadherin-2; cell adhesion, calcium binding; HET: MAN NAG; 3.20A {Mus musculus} Length = 559 | Back alignment and structure |
|---|
| >3q2w_A Cadherin-2; cell adhesion, calcium binding; HET: MAN NAG; 3.20A {Mus musculus} Length = 559 | Back alignment and structure |
|---|
| >2qvi_A Cadherin-2; beta barrel, strand SWAP, domain SWAP, calcium, cell adhesion, cleavage on PAIR of basic residues, glycoprotein, membrane; 3.01A {Mus musculus} SCOP: b.1.6.1 b.1.6.1 PDB: 1ncj_A Length = 215 | Back alignment and structure |
|---|
| >2qvi_A Cadherin-2; beta barrel, strand SWAP, domain SWAP, calcium, cell adhesion, cleavage on PAIR of basic residues, glycoprotein, membrane; 3.01A {Mus musculus} SCOP: b.1.6.1 b.1.6.1 PDB: 1ncj_A Length = 215 | Back alignment and structure |
|---|
| >2yst_A Protocadherin-7; BH-PCDH, beta-sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 119 | Back alignment and structure |
|---|
| >2a62_A Cadherin-8; extracellular domain, homodimer, calcium binding, adhesion; 4.50A {Mus musculus} Length = 322 | Back alignment and structure |
|---|
| >2a62_A Cadherin-8; extracellular domain, homodimer, calcium binding, adhesion; 4.50A {Mus musculus} Length = 322 | Back alignment and structure |
|---|
| >2a62_A Cadherin-8; extracellular domain, homodimer, calcium binding, adhesion; 4.50A {Mus musculus} Length = 322 | Back alignment and structure |
|---|
| >3k5r_A Cadherin 13; mouse, structural protein; 2.00A {Mus musculus} PDB: 3k5s_A Length = 218 | Back alignment and structure |
|---|
| >3k5r_A Cadherin 13; mouse, structural protein; 2.00A {Mus musculus} PDB: 3k5s_A Length = 218 | Back alignment and structure |
|---|
| >2yqg_A Desmoglein-2, HDGC; cadherin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 123 | Back alignment and structure |
|---|
| >2a4e_A Cadherin-11; dimer, calcium binding, cell adhesion; 3.20A {Mus musculus} Length = 215 | Back alignment and structure |
|---|
| >2a4e_A Cadherin-11; dimer, calcium binding, cell adhesion; 3.20A {Mus musculus} Length = 215 | Back alignment and structure |
|---|
| >3qrb_A Cadherin-1; cell adhesion; HET: PGE; 1.80A {Mus musculus} PDB: 1ff5_A 3lng_A 2qvf_B 1edh_A 3lne_A 1q1p_A 3lni_A 3q2l_A* 3q2n_A* 3lnh_A 3lnf_A 2o72_A 1suh_A Length = 213 | Back alignment and structure |
|---|
| >3qrb_A Cadherin-1; cell adhesion; HET: PGE; 1.80A {Mus musculus} PDB: 1ff5_A 3lng_A 2qvf_B 1edh_A 3lne_A 1q1p_A 3lni_A 3q2l_A* 3q2n_A* 3lnh_A 3lnf_A 2o72_A 1suh_A Length = 213 | Back alignment and structure |
|---|
| >3lnd_A CDH6 protein, cadherin 6; cell adhesion, cell membrane, membrane, transmembr; 2.82A {Mus musculus} Length = 207 | Back alignment and structure |
|---|
| >3lnd_A CDH6 protein, cadherin 6; cell adhesion, cell membrane, membrane, transmembr; 2.82A {Mus musculus} Length = 207 | Back alignment and structure |
|---|
| >3ppe_A Vascular endothelial cadherin; extracellular cadherin (EC) domain, beta barrel, IG-domain L domain swapped dimer interface; 2.10A {Gallus gallus} Length = 203 | Back alignment and structure |
|---|
| >3ppe_A Vascular endothelial cadherin; extracellular cadherin (EC) domain, beta barrel, IG-domain L domain swapped dimer interface; 2.10A {Gallus gallus} Length = 203 | Back alignment and structure |
|---|
| >3ubf_A Neural-cadherin; cell adhesion; 2.50A {Drosophila melanogaster} PDB: 3ubg_A Length = 316 | Back alignment and structure |
|---|
| >3ubf_A Neural-cadherin; cell adhesion; 2.50A {Drosophila melanogaster} PDB: 3ubg_A Length = 316 | Back alignment and structure |
|---|
| >3ubf_A Neural-cadherin; cell adhesion; 2.50A {Drosophila melanogaster} PDB: 3ubg_A Length = 316 | Back alignment and structure |
|---|
| >3ubh_A Neural-cadherin; cell adhesion; 2.70A {Drosophila melanogaster} Length = 419 | Back alignment and structure |
|---|
| >3ubh_A Neural-cadherin; cell adhesion; 2.70A {Drosophila melanogaster} Length = 419 | Back alignment and structure |
|---|
| >3ubh_A Neural-cadherin; cell adhesion; 2.70A {Drosophila melanogaster} Length = 419 | Back alignment and structure |
|---|
| >3ubh_A Neural-cadherin; cell adhesion; 2.70A {Drosophila melanogaster} Length = 419 | Back alignment and structure |
|---|
| >3mvs_A Cadherin-23, otocadherin; adhesion, extracellular domain, cell adhesion; 1.10A {Mus musculus} PDB: 2wcp_A 2whv_A 2wd0_A 2wbx_A Length = 210 | Back alignment and structure |
|---|
| >3mvs_A Cadherin-23, otocadherin; adhesion, extracellular domain, cell adhesion; 1.10A {Mus musculus} PDB: 2wcp_A 2whv_A 2wd0_A 2wbx_A Length = 210 | Back alignment and structure |
|---|
| >3k6d_A T-cadherin; cell adhesion; 1.80A {Xenopus laevis} PDB: 2v37_A Length = 99 | Back alignment and structure |
|---|
| >3k6f_A T-cadherin; cell adhesion, calcium, cell membrane, cleavage on PAIR of basic residues, glycoprotein, GPI-anchor, lipoprotein, membrane; 1.81A {Mus musculus} Length = 100 | Back alignment and structure |
|---|
| >1zvn_A Mn-cadherin; strand dimer, ----; 2.16A {Gallus gallus} Length = 99 | Back alignment and structure |
|---|
| >3k6i_A T-cadherin; cell adhesion, alternative splicing, calcium, cell membrane, cleavage on PAIR of basic residues, glycoprotein, GPI-anchor, lipoprotein; 1.13A {Gallus gallus} Length = 99 | Back alignment and structure |
|---|
| >1zxk_A Cadherin-8; strand dimer, cell adhesion; 2.00A {Mus musculus} PDB: 2a4c_A Length = 98 | Back alignment and structure |
|---|
| >2omz_B Epithelial-cadherin; leucine-rich-repeat, nvasion protein, IG-like domain, adhesi protein, cell invasion-cell adhesion complex; 1.60A {Homo sapiens} SCOP: b.1.6.1 PDB: 2omt_B 2omu_B 2omv_B 1o6s_B 2omy_B 2omx_B 3ff8_A 3ff7_A 2omw_B Length = 105 | Back alignment and structure |
|---|
| >2ee0_A Protocadherin-9; Ca domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 114 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 118 | |||
| 2yqg_A | 123 | Desmoglein-2, HDGC; cadherin, structural genomics, | 99.89 | |
| 2yst_A | 119 | Protocadherin-7; BH-PCDH, beta-sandwich, structura | 99.88 | |
| 1ncg_A | 110 | N-cadherin; cell adhesion protein; 2.10A {Mus musc | 99.88 | |
| 2qvi_A | 215 | Cadherin-2; beta barrel, strand SWAP, domain SWAP, | 99.86 | |
| 2x2u_A | 246 | Proto-oncogene tyrosine-protein kinase receptor RE | 99.84 | |
| 2a4e_A | 215 | Cadherin-11; dimer, calcium binding, cell adhesion | 99.83 | |
| 3q2w_A | 559 | Cadherin-2; cell adhesion, calcium binding; HET: M | 99.81 | |
| 2a4e_A | 215 | Cadherin-11; dimer, calcium binding, cell adhesion | 99.81 | |
| 3qrb_A | 213 | Cadherin-1; cell adhesion; HET: PGE; 1.80A {Mus mu | 99.81 | |
| 2a62_A | 322 | Cadherin-8; extracellular domain, homodimer, calci | 99.8 | |
| 3lnd_A | 207 | CDH6 protein, cadherin 6; cell adhesion, cell memb | 99.8 | |
| 3k5r_A | 218 | Cadherin 13; mouse, structural protein; 2.00A {Mus | 99.8 | |
| 3q2v_A | 550 | Cadherin-1; cell adhesion, calcium binding; HET: M | 99.8 | |
| 3ppe_A | 203 | Vascular endothelial cadherin; extracellular cadhe | 99.8 | |
| 1wyj_A | 125 | Protocadherin beta 14; SS bond, structural genomic | 99.78 | |
| 3ubh_A | 419 | Neural-cadherin; cell adhesion; 2.70A {Drosophila | 99.77 | |
| 1l3w_A | 546 | EP-cadherin, C-cadherin; cell adhesion, calcium bi | 99.77 | |
| 2ee0_A | 114 | Protocadherin-9; Ca domain, structural genomics, N | 99.77 | |
| 3mvs_A | 210 | Cadherin-23, otocadherin; adhesion, extracellular | 99.77 | |
| 3q2v_A | 550 | Cadherin-1; cell adhesion, calcium binding; HET: M | 99.76 | |
| 3ubf_A | 316 | Neural-cadherin; cell adhesion; 2.50A {Drosophila | 99.76 | |
| 1zvn_A | 99 | Mn-cadherin; strand dimer, ----; 2.16A {Gallus gal | 99.76 | |
| 1zxk_A | 98 | Cadherin-8; strand dimer, cell adhesion; 2.00A {Mu | 99.75 | |
| 1l3w_A | 546 | EP-cadherin, C-cadherin; cell adhesion, calcium bi | 99.75 | |
| 3q2w_A | 559 | Cadherin-2; cell adhesion, calcium binding; HET: M | 99.75 | |
| 2x2u_A | 246 | Proto-oncogene tyrosine-protein kinase receptor RE | 99.75 | |
| 1q55_A | 880 | EP-cadherin, C-cadherin; trans interaction, desmos | 99.75 | |
| 3mvs_A | 210 | Cadherin-23, otocadherin; adhesion, extracellular | 99.74 | |
| 2omz_B | 105 | Epithelial-cadherin; leucine-rich-repeat, nvasion | 99.73 | |
| 3ubf_A | 316 | Neural-cadherin; cell adhesion; 2.50A {Drosophila | 99.73 | |
| 2a62_A | 322 | Cadherin-8; extracellular domain, homodimer, calci | 99.73 | |
| 3ubh_A | 419 | Neural-cadherin; cell adhesion; 2.70A {Drosophila | 99.72 | |
| 1q55_A | 880 | EP-cadherin, C-cadherin; trans interaction, desmos | 99.72 | |
| 3k6i_A | 99 | T-cadherin; cell adhesion, alternative splicing, c | 99.72 | |
| 3k6f_A | 100 | T-cadherin; cell adhesion, calcium, cell membrane, | 99.72 | |
| 3k6d_A | 99 | T-cadherin; cell adhesion; 1.80A {Xenopus laevis} | 99.7 | |
| 3qrb_A | 213 | Cadherin-1; cell adhesion; HET: PGE; 1.80A {Mus mu | 99.6 | |
| 3lnd_A | 207 | CDH6 protein, cadherin 6; cell adhesion, cell memb | 99.59 | |
| 3ppe_A | 203 | Vascular endothelial cadherin; extracellular cadhe | 99.59 | |
| 3k5r_A | 218 | Cadherin 13; mouse, structural protein; 2.00A {Mus | 99.58 | |
| 2qvi_A | 215 | Cadherin-2; beta barrel, strand SWAP, domain SWAP, | 99.58 | |
| 4apx_B | 242 | Protocadherin-15, otocadherin; cell adhesion, hear | 99.5 | |
| 4apx_B | 242 | Protocadherin-15, otocadherin; cell adhesion, hear | 99.49 | |
| 1wuz_A | 103 | Pcdha4 protein, CNR-EC1; cadherin, heteronuclear p | 99.33 | |
| 2yrl_A | 102 | KIAA1837 protein; PKD domain, NPPSFA, national pro | 85.0 | |
| 2yhg_A | 437 | SDE_182CT, cellulose-binding protein; hydrolase, g | 84.91 |
| >2yqg_A Desmoglein-2, HDGC; cadherin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
Probab=99.89 E-value=6.6e-24 Score=139.41 Aligned_cols=88 Identities=28% Similarity=0.417 Sum_probs=76.9
Q ss_pred EEEEEeCCCCCCCCcEEEEEEeCC---CCCccEEEeCCCCEEEEeeeecCCCCcccceeeeeeeeecccCCCCCCCCcce
Q psy9968 2 QVHATDVDPPSNGGTIQYRIIKAP---GERAKFSIDKETGIVKTLYALDRDDPEREKEIYITTDIRVQALDRDDPEREKE 78 (118)
Q Consensus 2 ~v~A~D~D~~~~n~~i~y~i~~~~---~~~~~F~id~~tG~i~~~~~ld~e~~~~~~~~~~~~~~~~~~lDre~~~~~~~ 78 (118)
+|. +|+|.| .|+.|+|+|...+ +...+|.||+.||.|++.+. |||| .+..
T Consensus 33 ~v~-~D~D~g-~n~~i~Y~i~~~~~~~~~~~~F~Id~~tG~i~~~~~----------------------LDrE---~~~~ 85 (123)
T 2yqg_A 33 KIH-SDLAEE-RGLKITYKYTGKGITEPPFGIFVFNKDTGELNVTSI----------------------LDRE---ETPF 85 (123)
T ss_dssp CCC-CHHHHH-HTCCCEEEEEEBTTTBSSCSSEEEETTTTEEEECSC----------------------CBTT---TBSE
T ss_pred EEE-ECCCCC-CCceEEEEEecCCCCCCcCCCEEEeCCcCEEEECcc----------------------cCcc---cCce
Confidence 345 588988 6899999999753 22468999999999999999 7887 6679
Q ss_pred EEEEEEEEECCCCCCeeEEEEEEEEEeCCCCCCeeCCC
Q psy9968 79 IYITVIAEDNGTPQLSDACTMKITVEDINDNEPMFDRV 116 (118)
Q Consensus 79 ~~l~v~a~D~g~p~~s~~~~v~I~v~DvNDn~P~F~~~ 116 (118)
|.|.|.|+|.|.|++++++.|.|+|.|+|||+|+|.++
T Consensus 86 y~l~V~A~D~g~p~~~~~~~v~I~V~DvNDn~P~F~~~ 123 (123)
T 2yqg_A 86 FLLTGYALDARGNNVEKPLELRIKVLDINDNEPVFTQD 123 (123)
T ss_dssp EEEEEEEECTTCCEEEEEECCEEEEECTTCCCCCCCCC
T ss_pred EEEEEEEEECCCCceEEEEEEEEEEEEcCCCCCEeCCC
Confidence 99999999999999999999999999999999999874
|
| >2yst_A Protocadherin-7; BH-PCDH, beta-sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1ncg_A N-cadherin; cell adhesion protein; 2.10A {Mus musculus} SCOP: b.1.6.1 PDB: 1nch_A 1nci_A | Back alignment and structure |
|---|
| >2qvi_A Cadherin-2; beta barrel, strand SWAP, domain SWAP, calcium, cell adhesion, cleavage on PAIR of basic residues, glycoprotein, membrane; 3.01A {Mus musculus} SCOP: b.1.6.1 b.1.6.1 PDB: 1ncj_A | Back alignment and structure |
|---|
| >2x2u_A Proto-oncogene tyrosine-protein kinase receptor RET; hirschsprung disease, extracellular domain, disease mutation, transferase, glycoprotein; HET: NAG SO4; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2a4e_A Cadherin-11; dimer, calcium binding, cell adhesion; 3.20A {Mus musculus} | Back alignment and structure |
|---|
| >3q2w_A Cadherin-2; cell adhesion, calcium binding; HET: MAN NAG; 3.20A {Mus musculus} | Back alignment and structure |
|---|
| >2a4e_A Cadherin-11; dimer, calcium binding, cell adhesion; 3.20A {Mus musculus} | Back alignment and structure |
|---|
| >3qrb_A Cadherin-1; cell adhesion; HET: PGE; 1.80A {Mus musculus} PDB: 1ff5_A 3lng_A 2qvf_B 1edh_A 3lne_A 1q1p_A 3lni_A 3q2l_A* 3q2n_A* 3lnh_A 3lnf_A 2o72_A 1suh_A | Back alignment and structure |
|---|
| >2a62_A Cadherin-8; extracellular domain, homodimer, calcium binding, adhesion; 4.50A {Mus musculus} | Back alignment and structure |
|---|
| >3lnd_A CDH6 protein, cadherin 6; cell adhesion, cell membrane, membrane, transmembr; 2.82A {Mus musculus} | Back alignment and structure |
|---|
| >3k5r_A Cadherin 13; mouse, structural protein; 2.00A {Mus musculus} PDB: 3k5s_A | Back alignment and structure |
|---|
| >3q2v_A Cadherin-1; cell adhesion, calcium binding; HET: MAN; 3.40A {Mus musculus} | Back alignment and structure |
|---|
| >3ppe_A Vascular endothelial cadherin; extracellular cadherin (EC) domain, beta barrel, IG-domain L domain swapped dimer interface; 2.10A {Gallus gallus} | Back alignment and structure |
|---|
| >1wyj_A Protocadherin beta 14; SS bond, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >3ubh_A Neural-cadherin; cell adhesion; 2.70A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >1l3w_A EP-cadherin, C-cadherin; cell adhesion, calcium binding, extracellular, ECT metal binding protein; HET: NAG NDG; 3.08A {Xenopus laevis} SCOP: b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 | Back alignment and structure |
|---|
| >2ee0_A Protocadherin-9; Ca domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3mvs_A Cadherin-23, otocadherin; adhesion, extracellular domain, cell adhesion; 1.10A {Mus musculus} PDB: 4apx_A* 2whv_A 2wcp_A* 4aq8_A 4axw_A* 4aqe_A* 4aqa_A* 2wd0_A* 2wbx_A | Back alignment and structure |
|---|
| >3q2v_A Cadherin-1; cell adhesion, calcium binding; HET: MAN; 3.40A {Mus musculus} | Back alignment and structure |
|---|
| >3ubf_A Neural-cadherin; cell adhesion; 2.50A {Drosophila melanogaster} PDB: 3ubg_A | Back alignment and structure |
|---|
| >1zvn_A Mn-cadherin; strand dimer, ----; 2.16A {Gallus gallus} | Back alignment and structure |
|---|
| >1zxk_A Cadherin-8; strand dimer, cell adhesion; 2.00A {Mus musculus} PDB: 2a4c_A | Back alignment and structure |
|---|
| >1l3w_A EP-cadherin, C-cadherin; cell adhesion, calcium binding, extracellular, ECT metal binding protein; HET: NAG NDG; 3.08A {Xenopus laevis} SCOP: b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 | Back alignment and structure |
|---|
| >3q2w_A Cadherin-2; cell adhesion, calcium binding; HET: MAN NAG; 3.20A {Mus musculus} | Back alignment and structure |
|---|
| >2x2u_A Proto-oncogene tyrosine-protein kinase receptor RET; hirschsprung disease, extracellular domain, disease mutation, transferase, glycoprotein; HET: NAG SO4; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1q55_A EP-cadherin, C-cadherin; trans interaction, desmosome, junction, adhesion, structural protein; HET: NAG NDG; 30.00A {Mus musculus} SCOP: i.20.1.1 PDB: 1q5a_A* 1q5b_A* 1q5c_A* | Back alignment and structure |
|---|
| >3mvs_A Cadherin-23, otocadherin; adhesion, extracellular domain, cell adhesion; 1.10A {Mus musculus} PDB: 4apx_A* 2whv_A 2wcp_A* 4aq8_A 4axw_A* 4aqe_A* 4aqa_A* 2wd0_A* 2wbx_A | Back alignment and structure |
|---|
| >2omz_B Epithelial-cadherin; leucine-rich-repeat, nvasion protein, IG-like domain, adhesi protein, cell invasion-cell adhesion complex; 1.60A {Homo sapiens} SCOP: b.1.6.1 PDB: 2omt_B 2omu_B 2omv_B 1o6s_B 2omy_B 2omx_B 3ff8_A 3ff7_A 2omw_B | Back alignment and structure |
|---|
| >3ubf_A Neural-cadherin; cell adhesion; 2.50A {Drosophila melanogaster} PDB: 3ubg_A | Back alignment and structure |
|---|
| >2a62_A Cadherin-8; extracellular domain, homodimer, calcium binding, adhesion; 4.50A {Mus musculus} | Back alignment and structure |
|---|
| >3ubh_A Neural-cadherin; cell adhesion; 2.70A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >1q55_A EP-cadherin, C-cadherin; trans interaction, desmosome, junction, adhesion, structural protein; HET: NAG NDG; 30.00A {Mus musculus} SCOP: i.20.1.1 PDB: 1q5a_A* 1q5b_A* 1q5c_A* | Back alignment and structure |
|---|
| >3k6i_A T-cadherin; cell adhesion, alternative splicing, calcium, cell membrane, cleavage on PAIR of basic residues, glycoprotein, GPI-anchor, lipoprotein; 1.13A {Gallus gallus} | Back alignment and structure |
|---|
| >3k6f_A T-cadherin; cell adhesion, calcium, cell membrane, cleavage on PAIR of basic residues, glycoprotein, GPI-anchor, lipoprotein, membrane; 1.81A {Mus musculus} | Back alignment and structure |
|---|
| >3k6d_A T-cadherin; cell adhesion; 1.80A {Xenopus laevis} PDB: 2v37_A | Back alignment and structure |
|---|
| >3qrb_A Cadherin-1; cell adhesion; HET: PGE; 1.80A {Mus musculus} PDB: 1ff5_A 3lng_A 2qvf_B 1edh_A 3lne_A 1q1p_A 3lni_A 3q2l_A* 3q2n_A* 3lnh_A 3lnf_A 2o72_A 1suh_A | Back alignment and structure |
|---|
| >3lnd_A CDH6 protein, cadherin 6; cell adhesion, cell membrane, membrane, transmembr; 2.82A {Mus musculus} | Back alignment and structure |
|---|
| >3ppe_A Vascular endothelial cadherin; extracellular cadherin (EC) domain, beta barrel, IG-domain L domain swapped dimer interface; 2.10A {Gallus gallus} | Back alignment and structure |
|---|
| >3k5r_A Cadherin 13; mouse, structural protein; 2.00A {Mus musculus} PDB: 3k5s_A | Back alignment and structure |
|---|
| >2qvi_A Cadherin-2; beta barrel, strand SWAP, domain SWAP, calcium, cell adhesion, cleavage on PAIR of basic residues, glycoprotein, membrane; 3.01A {Mus musculus} SCOP: b.1.6.1 b.1.6.1 PDB: 1ncj_A | Back alignment and structure |
|---|
| >4apx_B Protocadherin-15, otocadherin; cell adhesion, hearing, deafness, CDH23, PCDH15; HET: MES; 1.65A {Mus musculus} PDB: 4aq8_C 4aqa_B* 4aqe_B* 4axw_B* | Back alignment and structure |
|---|
| >4apx_B Protocadherin-15, otocadherin; cell adhesion, hearing, deafness, CDH23, PCDH15; HET: MES; 1.65A {Mus musculus} PDB: 4aq8_C 4aqa_B* 4aqe_B* 4axw_B* | Back alignment and structure |
|---|
| >1wuz_A Pcdha4 protein, CNR-EC1; cadherin, heteronuclear protocadherin, cell adhesion; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2yrl_A KIAA1837 protein; PKD domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yhg_A SDE_182CT, cellulose-binding protein; hydrolase, glycoside hydrolase; HET: BTB; 1.08A {Saccharophagus degradans} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 118 | ||||
| d1l3wa1 | 100 | b.1.6.1 (A:1-100) C-cadherin ectodomain {African c | 2e-06 | |
| d1l3wa4 | 107 | b.1.6.1 (A:327-433) C-cadherin ectodomain {African | 6e-06 | |
| d2omzb1 | 104 | b.1.6.1 (B:-2-101) E-cadherin (epithelial) {Human | 2e-05 | |
| d1l3wa2 | 113 | b.1.6.1 (A:101-213) C-cadherin ectodomain {African | 8e-05 | |
| d1edha2 | 112 | b.1.6.1 (A:102-213) E-cadherin (epithelial) {Mouse | 1e-04 | |
| d1ncia_ | 102 | b.1.6.1 (A:) N-cadherin (neural) {Mouse (Mus muscu | 3e-04 |
| >d1l3wa1 b.1.6.1 (A:1-100) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 100 | Back information, alignment and structure |
|---|
class: All beta proteins fold: Immunoglobulin-like beta-sandwich superfamily: Cadherin-like family: Cadherin domain: C-cadherin ectodomain species: African clawed frog (Xenopus laevis) [TaxId: 8355]
Score = 40.9 bits (95), Expect = 2e-06
Identities = 13/108 (12%), Positives = 27/108 (25%), Gaps = 29/108 (26%)
Query: 1 MQVHATDVDPPSNGGTIQYRIIKAPGE---RAKFSIDKETGIVKTLYALDRDDPEREKEI 57
++ + + Y I + + F I+ ETG +
Sbjct: 19 KRLVQIKSNKDRFN-KVYYSITGQGADNPPQGVFRIEWETGWMLVTR------------- 64
Query: 58 YITTDIRVQALDRDDPEREKEIYITVIAEDNGTPQLSDACTMKITVED 105
D E + ++ A + + + I V D
Sbjct: 65 ------------PLDREEYDKYVLSSHAVSENGSPVEEPMEITINVID 100
|
| >d1l3wa4 b.1.6.1 (A:327-433) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 107 | Back information, alignment and structure |
|---|
| >d2omzb1 b.1.6.1 (B:-2-101) E-cadherin (epithelial) {Human (Homo sapiens) [TaxId: 9606]} Length = 104 | Back information, alignment and structure |
|---|
| >d1l3wa2 b.1.6.1 (A:101-213) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 113 | Back information, alignment and structure |
|---|
| >d1edha2 b.1.6.1 (A:102-213) E-cadherin (epithelial) {Mouse (Mus musculus) [TaxId: 10090]} Length = 112 | Back information, alignment and structure |
|---|
| >d1ncia_ b.1.6.1 (A:) N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 10090]} Length = 102 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 118 | |||
| d1l3wa4 | 107 | C-cadherin ectodomain {African clawed frog (Xenopu | 99.72 | |
| d1l3wa1 | 100 | C-cadherin ectodomain {African clawed frog (Xenopu | 99.69 | |
| d1edha2 | 112 | E-cadherin (epithelial) {Mouse (Mus musculus) [Tax | 99.67 | |
| d2omzb1 | 104 | E-cadherin (epithelial) {Human (Homo sapiens) [Tax | 99.66 | |
| d1l3wa2 | 113 | C-cadherin ectodomain {African clawed frog (Xenopu | 99.64 | |
| d1ncia_ | 102 | N-cadherin (neural) {Mouse (Mus musculus) [TaxId: | 99.64 | |
| d1l3wa5 | 107 | C-cadherin ectodomain {African clawed frog (Xenopu | 99.57 | |
| d1op4a_ | 136 | N-cadherin (neural) {Mouse (Mus musculus) [TaxId: | 99.53 | |
| d1ncja2 | 114 | N-cadherin (neural) {Mouse (Mus musculus) [TaxId: | 99.52 | |
| d1l3wa3 | 113 | C-cadherin ectodomain {African clawed frog (Xenopu | 99.36 | |
| d1u2ca1 | 103 | Dystroglycan, N-terminal domain {Mouse (Mus muscul | 93.7 |
| >d1l3wa4 b.1.6.1 (A:327-433) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} | Back information, alignment and structure |
|---|
class: All beta proteins fold: Immunoglobulin-like beta-sandwich superfamily: Cadherin-like family: Cadherin domain: C-cadherin ectodomain species: African clawed frog (Xenopus laevis) [TaxId: 8355]
Probab=99.72 E-value=4.5e-18 Score=107.00 Aligned_cols=80 Identities=23% Similarity=0.336 Sum_probs=67.6
Q ss_pred EEEEEeCCCCCCCCcEEEEEEeCCCCCccEEEeCCCCEEEEeeeecCCCCcccceeeeeeeeecccCCCCCCC-CcceEE
Q psy9968 2 QVHATDVDPPSNGGTIQYRIIKAPGERAKFSIDKETGIVKTLYALDRDDPEREKEIYITTDIRVQALDRDDPE-REKEIY 80 (118)
Q Consensus 2 ~v~A~D~D~~~~n~~i~y~i~~~~~~~~~F~id~~tG~i~~~~~ld~e~~~~~~~~~~~~~~~~~~lDre~~~-~~~~~~ 80 (118)
++.|+|+|.+ .|+.++|+|.... ..+|.|++.+|.|++.+.| |||... ....|.
T Consensus 27 ~v~A~D~D~~-~~~~i~y~i~~~~--~~~F~id~~tG~i~~~~~l----------------------D~E~~~~~~~~y~ 81 (107)
T d1l3wa4 27 SLVAQDPDKQ-QIQKLSYFIGNDP--ARWLTVNKDNGIVTGNGNL----------------------DRESEYVKNNTYT 81 (107)
T ss_dssp ECCEECCCTT-CCCCEEEEECCCS--SCCCEEETTTTEEEECSCC----------------------CTTSSSCCSSCCE
T ss_pred EeEEecCCcC-cCCceeEEecCCC--cccceeccccceEEEcccc----------------------ChhhccccCCeEE
Confidence 6789999998 6899999997533 3589999999999999995 554221 346899
Q ss_pred EEEEEEECCCCCCeeEEEEEEEEEeC
Q psy9968 81 ITVIAEDNGTPQLSDACTMKITVEDI 106 (118)
Q Consensus 81 l~v~a~D~g~p~~s~~~~v~I~v~Dv 106 (118)
+.|.|+|.|.|+++++++|.|+|.||
T Consensus 82 l~v~a~D~g~p~~~~t~~v~V~V~DV 107 (107)
T d1l3wa4 82 VIMLVTDDGVSVGTGTGTLILHVLDV 107 (107)
T ss_dssp EEEEEEECSSSCCCCCEEEECCBCCC
T ss_pred EEEEEEECCcCCcEEEEEEEEEEEeC
Confidence 99999999999999999999999986
|
| >d1l3wa1 b.1.6.1 (A:1-100) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} | Back information, alignment and structure |
|---|
| >d1edha2 b.1.6.1 (A:102-213) E-cadherin (epithelial) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1l3wa2 b.1.6.1 (A:101-213) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} | Back information, alignment and structure |
|---|
| >d1ncia_ b.1.6.1 (A:) N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1l3wa5 b.1.6.1 (A:434-540) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} | Back information, alignment and structure |
|---|
| >d1op4a_ b.1.6.1 (A:) N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ncja2 b.1.6.1 (A:102-215) N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1l3wa3 b.1.6.1 (A:214-326) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} | Back information, alignment and structure |
|---|
| >d1u2ca1 b.1.6.2 (A:58-160) Dystroglycan, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|