Diaphorina citri psyllid: psy9980

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120----
MTKWLPDDSESRIPNYAHTMIGAGAVVLNDKNQVLVVKEFYRKRPQWKLPGGYVEMSEDIGEAAVREVFEETNIRTEFHSVVAFRHTHKAAFGCSDIYFIVRLKPLTQEITKDDREITESKWMD
cccccccccccccccccccEEEEEEEEEcccccEEEEEEcccccccEECcCECccccccHHHHHHHHHHHHccCEEEEcEEEEEEEcccccccCEEEEEEEEEECcccccccccccccEEECcc
MTKWLP*DSESRIPNYAHTMIGAGAVVLNDKNQVLVVKEFYRKRPQWKLPGGYVEMSEDIGEAAVREVFEETNIRTEFHSVVAFRHTHKAAFGCSDIYFIVRLKPLTQEITKDDREITESKWMD
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTKWLPDDSESRIPNYAHTMIGAGAVVLNDKNQVLVVKEFYRKRPQWKLPGGYVEMSEDIGEAAVREVFEETNIRTEFHSVVAFRHTHKAAFGCSDIYFIVRLKPLTQEITKDDREITESKWMD

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
RNA pyrophosphohydrolase Accelerates the degradation of transcripts by removing pyrophosphate from the 5'-end of triphosphorylated RNA, leading to a more labile monophosphorylated state that can stimulate subsequent ribonuclease cleavage.confidentQ4FP40

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005488 [MF]bindingprobableGO:0003674
GO:0044444 [CC]cytoplasmic partprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0016462 [MF]pyrophosphatase activityprobableGO:0016787, GO:0016818, GO:0003674, GO:0016817, GO:0003824

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3H95, chain A
Confidence level:very confident
Coverage over the Query: 20-124
View the alignment between query and template
View the model in PyMOL