Diaphorina citri psyllid: psy9995

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-----
MGKKGGQNSLGKALIKNRFGHKPKRVSNDGLLHTSELEDGYDWNKINLKSVTEESSFQEFLSTAQLAGTEFTAEKLNITFVNPKSGVGLLSKEEKELALQAHKEKRELLKIPRRPKWDKNTTAEQLQAMERDEFLQWRRELNLLQEEDGLVITPYEKNLDFWRQLWRVIERSDVIVQIVDARNPLLFRCEDLERYVKEVSPHKRNMILLNKADLLTRKQRCYWTKYFNSVNVAVAFFSATNIYDDIPEGDEELEDEVVSEESESDESEWEDISEEEEEDDGQKVLENDLKIKSSPKLLNREELISLFKSFHDVNIPRMNPDVMTIGLVGYPNVGKSSTINALLNAKKVSVSATPGKTKHFQTLFVDDELLLCDCPGLVMPSFVFSKADMILNGILPIDQMRDHVPAVNMLCTLVPRHVLENIYGIMITQPDEGEDPNRPPFSEELCNAYGYNRGFMTSNGQPDNPRSARYILKDFVNGHLLYCQAPPGVPQEKYHIFKLKERKPLPKQTPRAMRALEPNVVRATDIDSKFFKKATGTALVKGRASVVPQGLGKGSMNASTMSLNTISSEDPKPWKQHKEKRNKREKLRKKPVSYY
cccccccccHHHHHHHHHccccccccccccccccccccccccccccccccccccccHHHHHHHHHHcccccccccccccccccccccccccHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHcccEEEEEEEcccccccccHHHHHHHHHHcccccEEEEEcccccccHHHHHHHHHHHHHccccEEEEEccccccccccccccHHHHHcccccccccHHHHHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHcccccccccccccEEEEEEccccccccHHHHHHHccccEEEccccccccCEEEEEEcccEEEECccccccccccccHHHHHHccccccccccccHHHHHHHHHcccHHHHHHHHccccccccccccccccccHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHcccEEEECccccccccccHHcccccccccccccHHHHHHccccccccccccHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
*******************************LHTSELEDGYDWNKINLKSVTEESSFQEFLSTAQLAGTEFTAEKLNITFVNPKSGVGL******************************************DEFLQWRRELNLLQEEDGLVITPYEKNLDFWRQLWRVIERSDVIVQIVDARNPLLFRCEDLERYVKEVSPHKRNMILLNKADLLTRKQRCYWTKYFNSVNVAVAFFSATNIYDDI**********************************************S*PKLLNREELISLFKSFHDVNIPRMNPDVMTIGLVGYPNVGKSSTINALLNAKKVSVSATPGKTKHFQTLFVDDELLLCDCPGLVMPSFVFSKADMILNGILPIDQMRDHVPAVNMLCTLVPRHVLENIYGIMITQPDEGEDPNRPPFSEELCNAYGYNRGFMTSNGQPDNPRSARYILKDFVNGHLLYCQAPPGVPQEK******************************************************************************************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGKKGGQNSLGKALIKNRFGHKPKRVSNDGLLHTSELEDGYDWNKINLKSVTEESSFQEFLSTAQLAGTEFTAEKLNITFVNPKSGVGLLSKEEKELALQAHKEKRELLKIPRRPKWDKNTTAEQLQAMERDEFLQWRRELNLLQEEDGLVITPYEKNLDFWRQLWRVIERSDVIVQIVDARNPLLFRCEDLERYVKEVSPHKRNMILLNKADLLTRKQRCYWTKYFNSVNVAVAFFSATNIYDDIPEGDEELEDEVVSEESESDESEWEDISEEEEEDDGQKVLENDLKIKSSPKLLNREELISLFKSFHDVNIPRMNPDVMTIGLVGYPNVGKSSTINALLNAKKVSVSATPGKTKHFQTLFVDDELLLCDCPGLVMPSFVFSKADMILNGILPIDQMRDHVPAVNMLCTLVPRHVLENIYGIMITQPDEGEDPNRPPFSEELCNAYGYNRGFMTSNGQPDNPRSARYILKDFVNGHLLYCQAPPGVPQEKYHIFKLKERKPLPKQTPRAMRALEPNVVRATDIDSKFFKKATGTALVKGRASVVPQGLGKGSMNASTMSLNTISSEDPKPWKQHKEKRNKREKLRKKPVSYY

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Large subunit GTPase 1 homolog GTPase required for the nuclear export of the 60S ribosomal subunit. Probably acts by mediating the release of NMD3 from the 60S ribosomal subunit after export into the cytoplasm (By similarity). Regulator of body size; acts in serotonergic neurons to regulate insulin signaling and thus exert global growth control.very confidentQ9W590
Large subunit GTPase 1 homolog GTPase required for the XPO1/CRM1-mediated nuclear export of the 60S ribosomal subunit. Probably acts by mediating the release of NMD3 from the 60S ribosomal subunit after export into the cytoplasm.confidentQ2YDM7
Large subunit GTPase 1 homolog GTPase required for the XPO1/CRM1-mediated nuclear export of the 60S ribosomal subunit. Probably acts by mediating the release of NMD3 from the 60S ribosomal subunit after export into the cytoplasm.confidentQ3UM18

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0043332 [CC]mating projection tipprobableGO:0044464, GO:0044463, GO:0030427, GO:0005623, GO:0005575, GO:0005937, GO:0042995
GO:0000747 [BP]conjugation with cellular fusionprobableGO:0000746, GO:0000003, GO:0009987, GO:0019953, GO:0044764, GO:0008150, GO:0051704
GO:0030437 [BP]ascospore formationprobableGO:0048610, GO:0030154, GO:0048468, GO:0019953, GO:0043935, GO:0043934, GO:0022402, GO:0009653, GO:0044699, GO:0000003, GO:0003006, GO:0048869, GO:0034293, GO:0007049, GO:0048646, GO:0032502, GO:0032505, GO:0009987, GO:0044767, GO:0022414, GO:0044763, GO:0022413, GO:0030435, GO:0048856, GO:0008150
GO:0003674 [MF]molecular_functionprobable
GO:0000027 [BP]ribosomal large subunit assemblyprobableGO:0042273, GO:0006996, GO:0071826, GO:0022607, GO:0043933, GO:0009987, GO:0042255, GO:0042254, GO:0016043, GO:0065003, GO:0022618, GO:0044763, GO:0044699, GO:0034622, GO:0022613, GO:0008150, GO:0070925, GO:0071840, GO:0044085
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3CNL, chain A
Confidence level:very confident
Coverage over the Query: 161-244,300-310,322-347,358-486
View the alignment between query and template
View the model in PyMOL
Template: 1PUJ, chain A
Confidence level:very confident
Coverage over the Query: 159-248,300-348,361-429,440-485
View the alignment between query and template
View the model in PyMOL
Template: 1MKY, chain A
Confidence level:very confident
Coverage over the Query: 108-247,300-377
View the alignment between query and template
View the model in PyMOL