Psyllid ID: psy9995

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-----
MGKKGGQNSLGKALIKNRFGHKPKRVSNDGLLHTSELEDGYDWNKINLKSVTEESSFQEFLSTAQLAGTEFTAEKLNITFVNPKSGVGLLSKEEKELALQAHKEKRELLKIPRRPKWDKNTTAEQLQAMERDEFLQWRRELNLLQEEDGLVITPYEKNLDFWRQLWRVIERSDVIVQIVDARNPLLFRCEDLERYVKEVSPHKRNMILLNKADLLTRKQRCYWTKYFNSVNVAVAFFSATNIYDDIPEGDEELEDEVVSEESESDESEWEDISEEEEEDDGQKVLENDLKIKSSPKLLNREELISLFKSFHDVNIPRMNPDVMTIGLVGYPNVGKSSTINALLNAKKVSVSATPGKTKHFQTLFVDDELLLCDCPGLVMPSFVFSKADMILNGILPIDQMRDHVPAVNMLCTLVPRHVLENIYGIMITQPDEGEDPNRPPFSEELCNAYGYNRGFMTSNGQPDNPRSARYILKDFVNGHLLYCQAPPGVPQEKYHIFKLKERKPLPKQTPRAMRALEPNVVRATDIDSKFFKKATGTALVKGRASVVPQGLGKGSMNASTMSLNTISSEDPKPWKQHKEKRNKREKLRKKPVSYY
cccccccccHHHHHHHHHccccccccccccccccccccccccccccccccccccccHHHHHHHHHHcccccccccccccccccccccccccHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHcccEEEEEEEcccccccccHHHHHHHHHHcccccEEEEEcccccccHHHHHHHHHHHHHccccEEEEEccccccccccccccHHHHHHcccccccHHHHHHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHcccccccccccccEEEEEEccccccccHHHHHHHccccEEEccccccccEEEEEEEcccEEEEEccccccccccccHHHHHHcccccccccccHHHHHHHHHHHccHHHHHHHHccccccccccccccccccHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHcccEEEEEcccccccccHHHHccccccccccccHHHHHHccccccccccccHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
cccccccccHHHHHHHHHHccccccccccccEEEEEcccccccccEcccEEccHcHHHHHHHHHHHcccccEEEEccEEEEccccccccccHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccEEccHHHHHHHHHHHHHHHHHccEEEEEEEcccccccccHHHHHHHHHccccccEEEEEEccccccHHHHHHHHHHHHHcccEEEEEEHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHcHHcHHHHccccccccHHHccccccccHHHHHHHHHHHcccccccccccEEEEEEEccccccccHHHHHHHcccEEEEEccccccccEEEEEEcccEEEEcccccccccccccHHHHHHcccccHHHHHccccHHHHHHHcccHHHHHHHcccccccccccccccccccHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHcccEEEEccccccccccccccccHHHcccccHHHHHHHHHHHcccccccHHHHHHccccccccccccccccccccccccccccccccccccccccccHHHcccccccHHHHcccccccc
mgkkggqnslGKALIKnrfghkpkrvsndgllhtseledgydwnkinlksvteeSSFQEFLSTAQLAGTEFTAEKLnitfvnpksgvgllSKEEKELALQAHKEKRELlkiprrpkwdkntTAEQLQAMERDEFLQWRRELNLLqeedglvitpyeKNLDFWRQLWRVIERSDVIVQIVDarnpllfrcEDLERYVKEVSPHKRNMILLNKADLLTRKQRCYWTKYFNSVNVAVAFFSatniyddipegdeeledevvseesesdesewediseeeeeddgQKVLEndlkiksspkllnREELISLFKSfhdvniprmnpdvmtiglvgypnvgkssTINALLNAKkvsvsatpgktkhfqtlfvddelllcdcpglvmpsfvfsKADMilngilpidqmrdhvpavnmlctlvprHVLENIYGimitqpdegedpnrppfseelcnaygynrgfmtsngqpdnprsARYILKDfvnghllycqappgvpqekyhifklkerkplpkqtpramralepnvvratdidskfFKKATGTALVkgrasvvpqglgkgsmnastmslntissedpkpwkqhkekrnkreklrkkpvsyy
mgkkggqnslGKALIknrfghkpkrvsndgllhtseledgydwNKINLKSVTEESSFQEFLSTAQLAGTEFTAEKLNITFVNPKSGVGLLSKEEKELALQAHKekrellkiprrpkwdknTTAEQLQAMERDEFLQWRRELNLLqeedglvitpYEKNLDFWRQLWRVIERSDVIVQIVdarnpllfrcEDLERYVkevsphkrnmillnkadllTRKQRCYWTKYFNSVNVAVAFFSATNIYDDIPEGDEELEDEvvseesesdesewediseeeeeddgqkvlendlkiksspkllnREELISLFKSFHDVNIPRMNPDVMTIGLVGYPNVGKSSTINALLNAKKVSVSATPGKTKHFQTLFVDDELLLCDCPGLVMPSFVFSKADMILNGILPIDQMRDHVPAVNMLCTLVPRHVLENIYGIMITQPDEGEDPNRPPFSEELCNAYGYNRGFMTSNGQPDNPRSARYILKDFVNGHLLYCQAPPGVPQEKYHIFKLkerkplpkqtpramralepnvvratdidskffkkatgtalvkgrasvvpqglgkgsmnaSTMSlntissedpkpwkqhkekrnkreklrkkpvsyy
MGKKGGQNSLGKALIKNRFGHKPKRVSNDGLLHTSELEDGYDWNKINLKSVTEESSFQEFLSTAQLAGTEFTAEKLNITFVNPKSGVGLLSKEEKELALQAHKEKRELLKIPRRPKWDKNTTAEQLQAMERDEFLQWRRELNLLQEEDGLVITPYEKNLDFWRQLWRVIERSDVIVQIVDARNPLLFRCEDLERYVKEVSPHKRNMILLNKADLLTRKQRCYWTKYFNSVNVAVAFFSATNIYddipegdeeledevvseesesdesewediseeeeeddGQKVLENDLKIKSSPKLLNREELISLFKSFHDVNIPRMNPDVMTIGLVGYPNVGKSSTINALLNAKKVSVSATPGKTKHFQTLFVDDELLLCDCPGLVMPSFVFSKADMILNGILPIDQMRDHVPAVNMLCTLVPRHVLENIYGIMITQPDEGEDPNRPPFSEELCNAYGYNRGFMTSNGQPDNPRSARYILKDFVNGHLLYCQAPPGVPQEKYHIFKLKERKPLPKQTPRAMRALEPNVVRATDIDSKFFKKATGTALVKGRASVVPQGLGKGSMNASTMSLNTISSEDPKPWKQHkekrnkreklrkkPVSYY
*******************************LHTSELEDGYDWNKINLKSVTEESSFQEFLSTAQLAGTEFTAEKLNITFVNPKSGVGL******************************************DEFLQWRRELNLLQEEDGLVITPYEKNLDFWRQLWRVIERSDVIVQIVDARNPLLFRCEDLERYVKEVSPHKRNMILLNKADLLTRKQRCYWTKYFNSVNVAVAFFSATNIYDDI****************************************************NREELISLFKSFHDVNIPRMNPDVMTIGLVGYPNVGKSSTINALLNAKKVSVSATPGKTKHFQTLFVDDELLLCDCPGLVMPSFVFSKADMILNGILPIDQMRDHVPAVNMLCTLVPRHVLENIYGIMIT****************LCNAYGYNRGFM***********ARYILKDFVNGHLLYCQAPPGVPQEKYHIFKL********************VVRATDIDSKFFKKATGTALVK******************************************************
*************************************************SVTEESSFQEFL**************************************************************************************************DFWRQLWRVIERSDVIVQIVDARNPLLFRCEDLERYVKEVSPHKRNMILLNKADLLTRKQRCYWTKYFNSVNVAVAFFSATNIY*************************************************S*PKLLNREELISLF****************TIGLVGYPNVGKSSTINALLNAKKVSVSATPGKTKHFQTLFVDDELLLCDCPGLVMPSFVFSKADMILNGILPIDQMRDHVPAVNMLCTLVPRHVLENIYGIMITQPDEGEDPNRPPFSEELCNAYGYNRGFMTSNGQPDNPRSARYILKDFVNGHLLYCQAPPGVPQEK***********************************************************************************************KK*V***
*********LGKALIKNRFGHKPKRVSNDGLLHTSELEDGYDWNKINLKSVTEESSFQEFLSTAQLAGTEFTAEKLNITFVNPKSGVGLLSKEEKELALQAHKEKRELLKIPRRPKWDKNTTAEQLQAMERDEFLQWRRELNLLQEEDGLVITPYEKNLDFWRQLWRVIERSDVIVQIVDARNPLLFRCEDLERYVKEVSPHKRNMILLNKADLLTRKQRCYWTKYFNSVNVAVAFFSATNIYDDIPEGD********************************KVLENDLKIKSSPKLLNREELISLFKSFHDVNIPRMNPDVMTIGLVGYPNVGKSSTINALLNAKKVSVSATPGKTKHFQTLFVDDELLLCDCPGLVMPSFVFSKADMILNGILPIDQMRDHVPAVNMLCTLVPRHVLENIYGIMITQPDEGEDPNRPPFSEELCNAYGYNRGFMTSNGQPDNPRSARYILKDFVNGHLLYCQAPPGVPQEKYHIFKLKERKPLPKQTPRAMRALEPNVVRATDIDSKFFKKATGTALVKGRASVVPQGLGKGSMNASTMSLNTIS****************************
******************FG*KPKRVSNDGLLHTSELEDGYDWNKINLKSVTEESSFQEFLSTAQLAGTEFTAEKLNITFVNPKSGVGLLSKEEKELALQAHKEKRELLKIPRRPKWDKNTTAEQLQAMERDEFLQWRRELNLLQEEDGLVITPYEKNLDFWRQLWRVIERSDVIVQIVDARNPLLFRCEDLERYVKEVSPHKRNMILLNKADLLTRKQRCYWTKYFNSVNVAVAFFSATNIYDDIPEGDEE******************************************PKLLNREELISLFKSFHDVNIPRMNPDVMTIGLVGYPNVGKSSTINALLNAKKVSVSATPGKTKHFQTLFVDDELLLCDCPGLVMPSFVFSKADMILNGILPIDQMRDHVPAVNMLCTLVPRHVLENIYGIMITQPDE*EDPNRPPFSEELCNAYGYNRGFMTSNGQPDNPRSARYILKDFVNGHLLYCQAPPGVPQE*******************************************************************************************************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGKKGGQNSLGKALIKNRFGHKPKRVSNDGLLHTSELEDGYDWNKINLKSVTEESSFQEFLSTAQLAGTEFTAEKLNITFVNPKSGVGLLSKEEKELALQAHKEKRELLKIPRRPKWDKNTTAEQLQAMERDEFLQWRRELNLLQEEDGLVITPYEKNLDFWRQLWRVIERSDVIVQIVDARNPLLFRCEDLERYVKEVSPHKRNMILLNKADLLTRKQRCYWTKYFNSVNVAVAFFSATNIYDDIPEGDEELEDEVVSEESESDESEWEDISEEEEEDDGQKVLENDLKIKSSPKLLNREELISLFKSFHDVNIPRMNPDVMTIGLVGYPNVGKSSTINALLNAKKVSVSATPGKTKHFQTLFVDDELLLCDCPGLVMPSFVFSKADMILNGILPIDQMRDHVPAVNMLCTLVPRHVLENIYGIMITQPDEGEDPNRPPFSEELCNAYGYNRGFMTSNGQPDNPRSARYILKDFVNGHLLYCQAPPGVPQEKYHIFKLKERKPLPKQTPRAMRALEPNVVRATDIDSKFFKKATGTALVKGRASVVPQGLGKGSMNASTMSLNTISSEDPKPWKQHKEKRNKREKLRKKPVSYY
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query595 2.2.26 [Sep-21-2011]
Q9W590606 Large subunit GTPase 1 ho yes N/A 0.959 0.942 0.569 0.0
Q6NY89640 Large subunit GTPase 1 ho yes N/A 0.961 0.893 0.498 1e-167
Q2YDM7652 Large subunit GTPase 1 ho yes N/A 0.966 0.881 0.481 1e-161
Q9H089658 Large subunit GTPase 1 ho yes N/A 0.966 0.873 0.481 1e-161
Q3UM18644 Large subunit GTPase 1 ho yes N/A 0.973 0.899 0.483 1e-160
Q4R8L2653 Large subunit GTPase 1 ho N/A N/A 0.964 0.879 0.478 1e-159
Q10190616 Large subunit GTPase 1 OS yes N/A 0.779 0.753 0.463 1e-113
P53145640 Large subunit GTPase 1 OS yes N/A 0.724 0.673 0.448 1e-106
Q5ZJD3653 Large subunit GTPase 1 ho yes N/A 0.499 0.454 0.501 1e-80
Q5BJT6655 Large subunit GTPase 1 ho yes N/A 0.536 0.487 0.468 5e-79
>sp|Q9W590|LSG1_DROME Large subunit GTPase 1 homolog OS=Drosophila melanogaster GN=ns3 PE=1 SV=1 Back     alignment and function desciption
 Score =  663 bits (1710), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 352/618 (56%), Positives = 435/618 (70%), Gaps = 47/618 (7%)

Query: 1   MGKK--GGQNSLGKALIKNRFGHKPKR-VSNDGLLHTSELEDGYDWNKINLKSVTEESSF 57
           MGKK  GG  +LG+ LIK+RFGH  +R V ND +LHT+EL+DGYDW ++NL SVTEESSF
Sbjct: 1   MGKKNKGGAPNLGRQLIKDRFGHTQRRKVDNDTMLHTTELQDGYDWGRLNLSSVTEESSF 60

Query: 58  QEFLSTAQLAGTEFTAEKLNITFVNPKSGVGLLSKEEKELALQAHKEKRELLKIPRRPKW 117
           Q FL TA+LAGTEF AEKLNITFVNPK  VGLLSK +++   Q H E R+ LKIPRRPKW
Sbjct: 61  QAFLRTAELAGTEFQAEKLNITFVNPKQRVGLLSKTQEQRMHQKHDEHRDQLKIPRRPKW 120

Query: 118 DKNTTAEQLQAMERDEFLQWRRELNLLQEEDGLVITPYEKNLDFWRQLWRVIERSDVIVQ 177
            K T+AE+L   E + FL WRR+L LLQE++ +++TPYEKNL+FWRQLWRV+ERSDV+VQ
Sbjct: 121 TKETSAEELVRAENEAFLDWRRDLALLQEDEEILMTPYEKNLEFWRQLWRVVERSDVVVQ 180

Query: 178 IVDARNPLLFRCEDLERYVKEVSPHKRNMILLNKADLLTRKQRCYWTKYFNSVNVAVAFF 237
           IVDARNPLLFR  DLERYVKEV P K NMIL+NK+DLLT +QR +W +YF+S  +  AF+
Sbjct: 181 IVDARNPLLFRSADLERYVKEVEPSKMNMILVNKSDLLTEEQRRHWAEYFDSEGIRTAFY 240

Query: 238 SATNI-----------YDDIPE------GDEELEDEVVSEESESDESEWEDISEEEEEDD 280
           SAT +            D  PE        EE++  + S E   +  E +  +  E ++D
Sbjct: 241 SATLVEEELKREAEECLDSFPEVQQLRRAVEEIKQSLDSVEDALNVIEQKYKTIPETQND 300

Query: 281 GQKVLENDLKIKSSPKLLNREELISLFKSFHDVNIPRMNPDVMTIGLVGYPNVGKSSTIN 340
               L  D   K+SP+LL+R ELI   ++ +    PR     +T+G+VGYPNVGKSSTIN
Sbjct: 301 ELPRLPGD---KNSPRLLSRLELIEFLRNIY--TGPRHTEQHVTVGMVGYPNVGKSSTIN 355

Query: 341 ALLNAKKVSVSATPGKTKHFQTLFVDDELLLCDCPGLVMPSFVFSKADMILNGILPIDQM 400
           +L+  KKVSVSATPGKTK FQTLF+D ++LLCDCPGLVMPSFV +KADM+LNGILPIDQM
Sbjct: 356 SLMTVKKVSVSATPGKTKRFQTLFLDKDILLCDCPGLVMPSFVLTKADMLLNGILPIDQM 415

Query: 401 RDHVPAVNMLCTLVPRHVLENIYGIMITQPDEGEDPNRPPFSEELCNAYGYNRGFMTSNG 460
           RDHVPAVN+LC  +PRHVLE+ YGI+I +P EGED  RPP SEEL  AYGYNRGFMTSNG
Sbjct: 416 RDHVPAVNLLCERIPRHVLEDKYGIVIAKPLEGEDMERPPHSEELLLAYGYNRGFMTSNG 475

Query: 461 QPDNPRSARYILKDFVNGHLLYCQAPPGVPQEKYHIFKLKERK-----PLPKQTPRAMRA 515
           QPD  RSARY+LKD+VNG LLY  +PP VPQ +YH F  ++R+      LP Q  RAMR 
Sbjct: 476 QPDQARSARYVLKDYVNGRLLYAMSPPSVPQTEYHTFPERQRRVIEESQLPGQQQRAMRI 535

Query: 516 LEPNVVRATDIDSKFFKKATGTALVKGRASVVPQGLGK-GSMNASTMSLNTISSEDP--K 572
              N   + ++D++FF      A VKGR +     L   GS+         ++  DP  K
Sbjct: 536 ---NKSTSKELDNQFFSDKPTHAHVKGRTNFPNVRLANDGSL---------VAGNDPAAK 583

Query: 573 PWKQHKEKRNKREKLRKK 590
           PW+  K++R  REKLRKK
Sbjct: 584 PWRHVKKER--REKLRKK 599
GTPase required for the nuclear export of the 60S ribosomal subunit. Probably acts by mediating the release of NMD3 from the 60S ribosomal subunit after export into the cytoplasm (By similarity). Regulator of body size; acts in serotonergic neurons to regulate insulin signaling and thus exert global growth control.
Drosophila melanogaster (taxid: 7227)
EC: 3EC: .EC: 6EC: .EC: 1EC: .EC: -
>sp|Q6NY89|LSG1_DANRE Large subunit GTPase 1 homolog OS=Danio rerio GN=lsg1 PE=2 SV=1 Back     alignment and function description
>sp|Q2YDM7|LSG1_BOVIN Large subunit GTPase 1 homolog OS=Bos taurus GN=LSG1 PE=2 SV=1 Back     alignment and function description
>sp|Q9H089|LSG1_HUMAN Large subunit GTPase 1 homolog OS=Homo sapiens GN=LSG1 PE=1 SV=2 Back     alignment and function description
>sp|Q3UM18|LSG1_MOUSE Large subunit GTPase 1 homolog OS=Mus musculus GN=Lsg1 PE=2 SV=2 Back     alignment and function description
>sp|Q4R8L2|LSG1_MACFA Large subunit GTPase 1 homolog OS=Macaca fascicularis GN=LSG1 PE=2 SV=1 Back     alignment and function description
>sp|Q10190|LSG1_SCHPO Large subunit GTPase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lsg1 PE=3 SV=1 Back     alignment and function description
>sp|P53145|LSG1_YEAST Large subunit GTPase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LSG1 PE=1 SV=1 Back     alignment and function description
>sp|Q5ZJD3|LSG1_CHICK Large subunit GTPase 1 homolog OS=Gallus gallus GN=LSG1 PE=2 SV=1 Back     alignment and function description
>sp|Q5BJT6|LSG1_RAT Large subunit GTPase 1 homolog OS=Rattus norvegicus GN=Lsg1 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query595
158297636616 AGAP011471-PA [Anopheles gambiae str. PE 0.956 0.923 0.560 0.0
157111998615 hypothetical protein AaeL_AAEL006031 [Ae 0.974 0.943 0.564 0.0
194763607605 GF21278 [Drosophila ananassae] gi|190618 0.956 0.940 0.571 0.0
312380310621 hypothetical protein AND_07675 [Anophele 0.983 0.942 0.558 0.0
195448461610 GK10107 [Drosophila willistoni] gi|19416 0.963 0.939 0.570 0.0
194912459607 GG12698 [Drosophila erecta] gi|190648186 0.959 0.940 0.567 0.0
195131071613 GI15663 [Drosophila mojavensis] gi|19390 0.959 0.931 0.558 0.0
195347630607 GM18974 [Drosophila sechellia] gi|194121 0.959 0.940 0.568 0.0
18543229606 nucleostemin 3 [Drosophila melanogaster] 0.959 0.942 0.569 0.0
195392942611 GJ19196 [Drosophila virilis] gi|19414962 0.963 0.937 0.558 0.0
>gi|158297636|ref|XP_317835.4| AGAP011471-PA [Anopheles gambiae str. PEST] gi|157014671|gb|EAA13064.4| AGAP011471-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
 Score =  677 bits (1748), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 353/630 (56%), Positives = 442/630 (70%), Gaps = 61/630 (9%)

Query: 1   MGKKGGQNSLGKALIKNRFGHKPKRVSNDGLLHTSELEDGYDWNKINLKSVTEESSFQEF 60
           MGKK   N LG++LIK+RFG       N   LHT+E++DGYDW ++NL+SVTEESSFQEF
Sbjct: 1   MGKKKA-NQLGRSLIKDRFGQ-----GNRKTLHTTEVQDGYDWGRLNLQSVTEESSFQEF 54

Query: 61  LSTAQLAGTEFTAEKLNITFVNPKSGVGLLSKEEKELALQAHKEKRELLKIPRRPKWDKN 120
           L TA+LAGTEF AEKLNIT+VNPKS VGLL+  E+   ++   + ++LLKIPRRPKW K+
Sbjct: 55  LRTAELAGTEFQAEKLNITYVNPKSKVGLLTTNERVEIIKKQVDMKDLLKIPRRPKWTKD 114

Query: 121 TTAEQLQAMERDEFLQWRRELNLLQEEDGLVITPYEKNLDFWRQLWRVIERSDVIVQIVD 180
           TTAE+L   E   FL+WRR L  LQE+DG+++TPYEKNLDFWRQLWRV+ERSD++VQIVD
Sbjct: 115 TTAEELLLAENASFLEWRRGLVALQEQDGMLMTPYEKNLDFWRQLWRVVERSDIVVQIVD 174

Query: 181 ARNPLLFRCEDLERYVKEVSPHKRNMILLNKADLLTRKQRCYWTKYFNSVNVAVAFFSAT 240
           ARNPLLFR EDLERYV+EV P+K NMILLNK+D LT +QR +W KYF+   V VAF+SA 
Sbjct: 175 ARNPLLFRTEDLERYVQEVDPNKMNMILLNKSDFLTAEQRVHWAKYFDGQGVRVAFYSAV 234

Query: 241 NIYDDIPE----------------------------------GDEELEDEVVSEESESDE 266
              ++  +                                  G+ +L  +   +  E  E
Sbjct: 235 LAAEEAKKEQEAEEAAQQAAQNGEQADDEEEEKEQEEVKERLGNLKLSVDRAEKTLEKIE 294

Query: 267 SEWEDISEEEEEDDGQKVLENDLKIKSSPKLLNREELISLFKSFHDVNIPRMNPDVMTIG 326
            + ED++ EE+ + G         I++S KLL   ELI+LFKS H     R+  DV+T+G
Sbjct: 295 EKIEDLAREEDAEPGA--------IRNSSKLLTNAELIALFKSLHRAE--RVTKDVVTVG 344

Query: 327 LVGYPNVGKSSTINALLNAKKVSVSATPGKTKHFQTLFVDDELLLCDCPGLVMPSFVFSK 386
           LVGYPNVGKSSTINA+   KKVSVSATPGKTKHFQTL+VD EL+ CDCPGLVMPSF  +K
Sbjct: 345 LVGYPNVGKSSTINAVFLEKKVSVSATPGKTKHFQTLYVDSELMFCDCPGLVMPSFCITK 404

Query: 387 ADMILNGILPIDQMRDHVPAVNMLCTLVPRHVLENIYGIMITQPDEGEDPNRPPFSEELC 446
           ADMILNGILPIDQMRDHVP VN+LCTL+PRH+LE+ YGIMI++P EGEDPNRPP+SEEL 
Sbjct: 405 ADMILNGILPIDQMRDHVPPVNLLCTLIPRHILEDTYGIMISKPLEGEDPNRPPYSEELL 464

Query: 447 NAYGYNRGFMTSNGQPDNPRSARYILKDFVNGHLLYCQAPPGVPQEKYHIF--KLKERKP 504
            A+ YNRGFMT+NGQPD  R +RY+LKD+VNG LLYC APPGV Q+++H F  + KE   
Sbjct: 465 LAFAYNRGFMTANGQPDQSRGSRYVLKDYVNGKLLYCYAPPGVVQDEFHRFPARKKEEAD 524

Query: 505 LPKQTPRAMRALEPNVVR-ATDIDSKFFKKATGTALVKGRA---SVVPQGLGKGSMNAST 560
           +    PR  RA++ N+ + +TD+D +FFK+     LVKGR+   +V P G    S +A+T
Sbjct: 525 IKLLPPRQQRAMKMNLKKSSTDVDEQFFKERASHGLVKGRSDFPNVRPIG---PSGSAAT 581

Query: 561 MSLNTISSEDPKPWKQHKEKRNKREKLRKK 590
           +S         KPWK   +KR KREKLR+K
Sbjct: 582 LSTTDGVIVAGKPWKH--QKREKREKLRRK 609

Source: Anopheles gambiae str. PEST

Species: Anopheles gambiae

Genus: Anopheles

Family: Culicidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|157111998|ref|XP_001657366.1| hypothetical protein AaeL_AAEL006031 [Aedes aegypti] gi|108878197|gb|EAT42422.1| AAEL006031-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|194763607|ref|XP_001963924.1| GF21278 [Drosophila ananassae] gi|190618849|gb|EDV34373.1| GF21278 [Drosophila ananassae] Back     alignment and taxonomy information
>gi|312380310|gb|EFR26342.1| hypothetical protein AND_07675 [Anopheles darlingi] Back     alignment and taxonomy information
>gi|195448461|ref|XP_002071668.1| GK10107 [Drosophila willistoni] gi|194167753|gb|EDW82654.1| GK10107 [Drosophila willistoni] Back     alignment and taxonomy information
>gi|194912459|ref|XP_001982510.1| GG12698 [Drosophila erecta] gi|190648186|gb|EDV45479.1| GG12698 [Drosophila erecta] Back     alignment and taxonomy information
>gi|195131071|ref|XP_002009974.1| GI15663 [Drosophila mojavensis] gi|193908424|gb|EDW07291.1| GI15663 [Drosophila mojavensis] Back     alignment and taxonomy information
>gi|195347630|ref|XP_002040355.1| GM18974 [Drosophila sechellia] gi|194121783|gb|EDW43826.1| GM18974 [Drosophila sechellia] Back     alignment and taxonomy information
>gi|18543229|ref|NP_569915.1| nucleostemin 3 [Drosophila melanogaster] gi|74949081|sp|Q9W590.1|LSG1_DROME RecName: Full=Large subunit GTPase 1 homolog; AltName: Full=Nucleostemin-3 gi|4481810|emb|CAB38462.1| EG:BACN32G11.5 [Drosophila melanogaster] gi|7290165|gb|AAF45628.1| nucleostemin 3 [Drosophila melanogaster] gi|15010480|gb|AAK77288.1| GH06695p [Drosophila melanogaster] gi|220945078|gb|ACL85082.1| l(1)G0431-PA [synthetic construct] gi|220954820|gb|ACL89953.1| l(1)G0431-PA [synthetic construct] Back     alignment and taxonomy information
>gi|195392942|ref|XP_002055113.1| GJ19196 [Drosophila virilis] gi|194149623|gb|EDW65314.1| GJ19196 [Drosophila virilis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query595
FB|FBgn0028274606 ns3 "nucleostemin 3" [Drosophi 0.403 0.396 0.666 1e-169
ZFIN|ZDB-GENE-030131-2184640 lsg1 "large subunit GTPase 1 h 0.401 0.373 0.619 6.5e-151
UNIPROTKB|F1P8H7626 LSG1 "Uncharacterized protein" 0.349 0.332 0.649 2.2e-148
UNIPROTKB|F1MZT8652 LSG1 "Large subunit GTPase 1 h 0.393 0.358 0.588 3.6e-148
UNIPROTKB|Q2YDM7652 LSG1 "Large subunit GTPase 1 h 0.393 0.358 0.588 3.6e-148
UNIPROTKB|F1SFG2653 LSG1 "Uncharacterized protein" 0.401 0.366 0.580 9.6e-148
UNIPROTKB|Q9H089658 LSG1 "Large subunit GTPase 1 h 0.391 0.354 0.591 1.6e-147
MGI|MGI:107236644 Lsg1 "large subunit GTPase 1 h 0.401 0.371 0.580 6.7e-147
RGD|1309089655 Lsg1 "large subunit GTPase 1 h 0.401 0.364 0.580 8.6e-147
UNIPROTKB|Q4R8L2653 LSG1 "Large subunit GTPase 1 h 0.391 0.356 0.595 4.7e-146
FB|FBgn0028274 ns3 "nucleostemin 3" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 850 (304.3 bits), Expect = 1.0e-169, Sum P(2) = 1.0e-169
 Identities = 162/243 (66%), Positives = 196/243 (80%)

Query:     1 MGKK--GGQNSLGKALIKNRFGHKPKR-VSNDGLLHTSELEDGYDWNKINLKSVTEESSF 57
             MGKK  GG  +LG+ LIK+RFGH  +R V ND +LHT+EL+DGYDW ++NL SVTEESSF
Sbjct:     1 MGKKNKGGAPNLGRQLIKDRFGHTQRRKVDNDTMLHTTELQDGYDWGRLNLSSVTEESSF 60

Query:    58 QEFLSTAQLAGTEFTAEKLNITFVNPKSGVGLLSKEEKELALQAHKEKRELLKIPRRPKW 117
             Q FL TA+LAGTEF AEKLNITFVNPK  VGLLSK +++   Q H E R+ LKIPRRPKW
Sbjct:    61 QAFLRTAELAGTEFQAEKLNITFVNPKQRVGLLSKTQEQRMHQKHDEHRDQLKIPRRPKW 120

Query:   118 DKNTTAEQLQAMERDEFLQWRRELNLLQEEDGLVITPYEKNLDFWRQLWRVIERSDVIVQ 177
              K T+AE+L   E + FL WRR+L LLQE++ +++TPYEKNL+FWRQLWRV+ERSDV+VQ
Sbjct:   121 TKETSAEELVRAENEAFLDWRRDLALLQEDEEILMTPYEKNLEFWRQLWRVVERSDVVVQ 180

Query:   178 IVDARNPLLFRCEDLERYVKEVSPHKRNMILLNKADLLTRKQRCYWTKYFNSVNVAVAFF 237
             IVDARNPLLFR  DLERYVKEV P K NMIL+NK+DLLT +QR +W +YF+S  +  AF+
Sbjct:   181 IVDARNPLLFRSADLERYVKEVEPSKMNMILVNKSDLLTEEQRRHWAEYFDSEGIRTAFY 240

Query:   238 SAT 240
             SAT
Sbjct:   241 SAT 243
GO:0005525 "GTP binding" evidence=IEA
GO:0005737 "cytoplasm" evidence=IDA
GO:0003924 "GTPase activity" evidence=IBA
GO:0042254 "ribosome biogenesis" evidence=IBA
GO:0005829 "cytosol" evidence=IBA
ZFIN|ZDB-GENE-030131-2184 lsg1 "large subunit GTPase 1 homolog (S. cerevisiae)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1P8H7 LSG1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1MZT8 LSG1 "Large subunit GTPase 1 homolog" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q2YDM7 LSG1 "Large subunit GTPase 1 homolog" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1SFG2 LSG1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q9H089 LSG1 "Large subunit GTPase 1 homolog" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:107236 Lsg1 "large subunit GTPase 1 homolog (S. cerevisiae)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1309089 Lsg1 "large subunit GTPase 1 homolog (S. cerevisiae)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q4R8L2 LSG1 "Large subunit GTPase 1 homolog" [Macaca fascicularis (taxid:9541)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P53145LSG1_YEAST3, ., 6, ., 1, ., -0.44840.72430.6734yesN/A
Q2YDM7LSG1_BOVIN3, ., 6, ., 1, ., -0.48100.96630.8819yesN/A
Q5RA07GNL1_PONABNo assigned EC number0.30710.65710.6441yesN/A
Q9H089LSG1_HUMAN3, ., 6, ., 1, ., -0.48120.96630.8738yesN/A
Q3UM18LSG1_MOUSE3, ., 6, ., 1, ., -0.48370.97310.8990yesN/A
Q6NY89LSG1_DANRE3, ., 6, ., 1, ., -0.49840.96130.8937yesN/A
Q5ZJD3LSG1_CHICK3, ., 6, ., 1, ., -0.50160.49910.4548yesN/A
Q9W590LSG1_DROME3, ., 6, ., 1, ., -0.56950.95960.9422yesN/A
Q10190LSG1_SCHPO3, ., 6, ., 1, ., -0.46320.77980.7532yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.6.1LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query595
COG1161322 COG1161, COG1161, Predicted GTPases [General funct 2e-48
cd01857140 cd01857, HSR1_MMR1, A circularly permuted subfamil 8e-44
cd01857140 cd01857, HSR1_MMR1, A circularly permuted subfamil 1e-36
cd04178171 cd04178, Nucleostemin_like, A circularly permuted 3e-30
cd01849146 cd01849, YlqF_related_GTPase, Circularly permuted 8e-30
PRK09563287 PRK09563, rbgA, GTPase YlqF; Reviewed 3e-21
TIGR03596276 TIGR03596, GTPase_YlqF, ribosome biogenesis GTP-bi 2e-20
cd01856171 cd01856, YlqF, Circularly permuted YlqF GTPase 2e-18
pfam01926117 pfam01926, MMR_HSR1, 50S ribosome-binding GTPase 8e-17
cd01858157 cd01858, NGP_1, A novel nucleolar GTP-binding prot 7e-15
cd01859157 cd01859, MJ1464, An uncharacterized, circularly pe 2e-12
cd01876170 cd01876, YihA_EngB, YihA (EngB) GTPase family 1e-11
cd01858157 cd01858, NGP_1, A novel nucleolar GTP-binding prot 2e-11
TIGR03598178 TIGR03598, GTPase_YsxC, ribosome biogenesis GTP-bi 6e-11
COG0218200 COG0218, COG0218, Predicted GTPase [General functi 3e-10
PRK00454196 PRK00454, engB, GTP-binding protein YsxC; Reviewed 9e-10
cd01859157 cd01859, MJ1464, An uncharacterized, circularly pe 5e-09
cd00882161 cd00882, Ras_like_GTPase, Rat sarcoma (Ras)-like s 7e-08
cd00880161 cd00880, Era_like, E 9e-08
cd01895174 cd01895, EngA2, EngA2 GTPase contains the second d 1e-06
TIGR03594429 TIGR03594, GTPase_EngA, ribosome-associated GTPase 2e-06
cd01855191 cd01855, YqeH, Circularly permuted YqeH GTPase 1e-05
COG1160444 COG1160, COG1160, Predicted GTPases [General funct 2e-05
PRK00093435 PRK00093, PRK00093, GTP-binding protein Der; Revie 3e-05
cd04163168 cd04163, Era, E 5e-05
cd04163168 cd04163, Era, E 6e-05
cd01898170 cd01898, Obg, Obg GTPase 6e-05
PRK05291449 PRK05291, trmE, tRNA modification GTPase TrmE; Rev 8e-05
COG0486454 COG0486, ThdF, Predicted GTPase [General function 1e-04
TIGR00450442 TIGR00450, mnmE_trmE_thdF, tRNA modification GTPas 1e-04
PRK12297424 PRK12297, obgE, GTPase CgtA; Reviewed 3e-04
COG1159298 COG1159, Era, GTPase [General function prediction 4e-04
TIGR02729329 TIGR02729, Obg_CgtA, Obg family GTPase CgtA 4e-04
COG0536369 COG0536, Obg, Predicted GTPase [General function p 4e-04
pfam02421190 pfam02421, FeoB_N, Ferrous iron transport protein 4e-04
COG3596296 COG3596, COG3596, Predicted GTPase [General functi 5e-04
cd04164159 cd04164, trmE, trmE is a tRNA modification GTPase 0.001
cd01897167 cd01897, NOG, Nucleolar GTP-binding protein (NOG) 0.001
TIGR00436270 TIGR00436, era, GTP-binding protein Era 0.001
COG0370 653 COG0370, FeoB, Fe2+ transport system protein B [In 0.001
COG1084346 COG1084, COG1084, Predicted GTPase [General functi 0.001
PRK00089292 PRK00089, era, GTPase Era; Reviewed 0.001
TIGR03594 429 TIGR03594, GTPase_EngA, ribosome-associated GTPase 0.002
COG1160 444 COG1160, COG1160, Predicted GTPases [General funct 0.002
PRK00093 435 PRK00093, PRK00093, GTP-binding protein Der; Revie 0.002
cd01878204 cd01878, HflX, HflX GTPase family 0.002
TIGR03918 391 TIGR03918, GTP_HydF, [FeFe] hydrogenase H-cluster 0.002
PTZ00258390 PTZ00258, PTZ00258, GTP-binding protein; Provision 0.002
TIGR00231162 TIGR00231, small_GTP, small GTP-binding protein do 0.002
cd01894157 cd01894, EngA1, EngA1 GTPase contains the first do 0.003
PRK12299335 PRK12299, obgE, GTPase CgtA; Reviewed 0.003
TIGR03156351 TIGR03156, GTP_HflX, GTP-binding protein HflX 0.003
PRK09601364 PRK09601, PRK09601, GTP-binding protein YchF; Revi 0.003
pfam04931784 pfam04931, DNA_pol_phi, DNA polymerase phi 0.004
>gnl|CDD|224083 COG1161, COG1161, Predicted GTPases [General function prediction only] Back     alignment and domain information 
 Score =  171 bits (434), Expect = 2e-48
 Identities = 92/327 (28%), Positives = 137/327 (41%), Gaps = 57/327 (17%)

Query: 158 NLDFWRQLWRVIERSDVIVQIVDARNPLLFRCEDLERYVKEVSPHKRNMILLNKADLLTR 217
                RQL  V++  DV+V++VDAR+PL  R  +LER VKE    K  +++LNKADL  +
Sbjct: 21  MKKAKRQLKEVLKSVDVVVEVVDARDPLGTRNPELERIVKE----KPKLLVLNKADLAPK 76

Query: 218 KQRCYWTKYFNSVNVAVAFFSATNIYDDIPEGDEELEDEVVSEESESDESEWEDISEEEE 277
           +    W KYF         F +                                      
Sbjct: 77  EVTKKWKKYFKKEEGIKPIFVSAK-----------------------------------S 101

Query: 278 EDDGQKVLENDLKIKSSPKLLNREELISLFKSFHDVNIPRMNPDVMTIGLVGYPNVGKSS 337
              G+K+ +   K+         EE I   K         +    + +G+VGYPNVGKS+
Sbjct: 102 RQGGKKIRKALEKLS--------EEKIKRLKKKG------LLKRKIRVGVVGYPNVGKST 147

Query: 338 TINALLNAKKVSVSATPGKTKHFQTLFVDDELLLCDCPGLVMPSFVFSKADMILNGILPI 397
            IN LL  K    S  PG TK  Q + +DD + L D PG++ P F   +   +L  + P 
Sbjct: 148 LINRLLGKKVAKTSNRPGTTKGIQWIKLDDGIYLLDTPGIIPPKFDDDEL--VLLKLAPK 205

Query: 398 DQMRDHVPAVNMLCTLVPRHVLEN-IYGIMITQPDEGEDPNRPPFSEELCNAYGYNRGFM 456
            +++D V   + +   +   +L +  YG  +       +P      EE        RG++
Sbjct: 206 GEIKDPVLPADEVAERLLGGLLIDEHYGEKLNITRYESNPIHRTDPEEFLELIAKKRGWL 265

Query: 457 -TSNGQPDNPRSARYILKDFVNGHLLY 482
               G+PD  R+A  ILKD  NG L +
Sbjct: 266 LLKGGEPDLERAAETILKDIRNGKLGW 292

Length = 322
>gnl|CDD|206750 cd01857, HSR1_MMR1, A circularly permuted subfamily of the Ras GTPases Back     alignment and domain information
>gnl|CDD|206750 cd01857, HSR1_MMR1, A circularly permuted subfamily of the Ras GTPases Back     alignment and domain information
>gnl|CDD|206753 cd04178, Nucleostemin_like, A circularly permuted subfamily of the Ras GTPases Back     alignment and domain information
>gnl|CDD|206746 cd01849, YlqF_related_GTPase, Circularly permuted YlqF-related GTPases Back     alignment and domain information
>gnl|CDD|236570 PRK09563, rbgA, GTPase YlqF; Reviewed Back     alignment and domain information
>gnl|CDD|213833 TIGR03596, GTPase_YlqF, ribosome biogenesis GTP-binding protein YlqF Back     alignment and domain information
>gnl|CDD|206749 cd01856, YlqF, Circularly permuted YlqF GTPase Back     alignment and domain information
>gnl|CDD|216791 pfam01926, MMR_HSR1, 50S ribosome-binding GTPase Back     alignment and domain information
>gnl|CDD|206751 cd01858, NGP_1, A novel nucleolar GTP-binding protein, circularly permuted subfamily of the Ras GTPases Back     alignment and domain information
>gnl|CDD|206752 cd01859, MJ1464, An uncharacterized, circularly permuted subfamily of the Ras GTPases Back     alignment and domain information
>gnl|CDD|206665 cd01876, YihA_EngB, YihA (EngB) GTPase family Back     alignment and domain information
>gnl|CDD|206751 cd01858, NGP_1, A novel nucleolar GTP-binding protein, circularly permuted subfamily of the Ras GTPases Back     alignment and domain information
>gnl|CDD|213835 TIGR03598, GTPase_YsxC, ribosome biogenesis GTP-binding protein YsxC/EngB Back     alignment and domain information
>gnl|CDD|223296 COG0218, COG0218, Predicted GTPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|234770 PRK00454, engB, GTP-binding protein YsxC; Reviewed Back     alignment and domain information
>gnl|CDD|206752 cd01859, MJ1464, An uncharacterized, circularly permuted subfamily of the Ras GTPases Back     alignment and domain information
>gnl|CDD|206648 cd00882, Ras_like_GTPase, Rat sarcoma (Ras)-like superfamily of small guanosine triphosphatases (GTPases) Back     alignment and domain information
>gnl|CDD|206646 cd00880, Era_like, E Back     alignment and domain information
>gnl|CDD|206682 cd01895, EngA2, EngA2 GTPase contains the second domain of EngA Back     alignment and domain information
>gnl|CDD|234274 TIGR03594, GTPase_EngA, ribosome-associated GTPase EngA Back     alignment and domain information
>gnl|CDD|206748 cd01855, YqeH, Circularly permuted YqeH GTPase Back     alignment and domain information
>gnl|CDD|224082 COG1160, COG1160, Predicted GTPases [General function prediction only] Back     alignment and domain information
>gnl|CDD|234628 PRK00093, PRK00093, GTP-binding protein Der; Reviewed Back     alignment and domain information
>gnl|CDD|206726 cd04163, Era, E Back     alignment and domain information
>gnl|CDD|206726 cd04163, Era, E Back     alignment and domain information
>gnl|CDD|206685 cd01898, Obg, Obg GTPase Back     alignment and domain information
>gnl|CDD|235392 PRK05291, trmE, tRNA modification GTPase TrmE; Reviewed Back     alignment and domain information
>gnl|CDD|223561 COG0486, ThdF, Predicted GTPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|232980 TIGR00450, mnmE_trmE_thdF, tRNA modification GTPase TrmE Back     alignment and domain information
>gnl|CDD|237046 PRK12297, obgE, GTPase CgtA; Reviewed Back     alignment and domain information
>gnl|CDD|224081 COG1159, Era, GTPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|233986 TIGR02729, Obg_CgtA, Obg family GTPase CgtA Back     alignment and domain information
>gnl|CDD|223610 COG0536, Obg, Predicted GTPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|217025 pfam02421, FeoB_N, Ferrous iron transport protein B Back     alignment and domain information
>gnl|CDD|226124 COG3596, COG3596, Predicted GTPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|206727 cd04164, trmE, trmE is a tRNA modification GTPase Back     alignment and domain information
>gnl|CDD|206684 cd01897, NOG, Nucleolar GTP-binding protein (NOG) Back     alignment and domain information
>gnl|CDD|129528 TIGR00436, era, GTP-binding protein Era Back     alignment and domain information
>gnl|CDD|223447 COG0370, FeoB, Fe2+ transport system protein B [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|224009 COG1084, COG1084, Predicted GTPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|234624 PRK00089, era, GTPase Era; Reviewed Back     alignment and domain information
>gnl|CDD|234274 TIGR03594, GTPase_EngA, ribosome-associated GTPase EngA Back     alignment and domain information
>gnl|CDD|224082 COG1160, COG1160, Predicted GTPases [General function prediction only] Back     alignment and domain information
>gnl|CDD|234628 PRK00093, PRK00093, GTP-binding protein Der; Reviewed Back     alignment and domain information
>gnl|CDD|206666 cd01878, HflX, HflX GTPase family Back     alignment and domain information
>gnl|CDD|234395 TIGR03918, GTP_HydF, [FeFe] hydrogenase H-cluster maturation GTPase HydF Back     alignment and domain information
>gnl|CDD|240334 PTZ00258, PTZ00258, GTP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|232886 TIGR00231, small_GTP, small GTP-binding protein domain Back     alignment and domain information
>gnl|CDD|206681 cd01894, EngA1, EngA1 GTPase contains the first domain of EngA Back     alignment and domain information
>gnl|CDD|237048 PRK12299, obgE, GTPase CgtA; Reviewed Back     alignment and domain information
>gnl|CDD|234125 TIGR03156, GTP_HflX, GTP-binding protein HflX Back     alignment and domain information
>gnl|CDD|236583 PRK09601, PRK09601, GTP-binding protein YchF; Reviewed Back     alignment and domain information
>gnl|CDD|218333 pfam04931, DNA_pol_phi, DNA polymerase phi Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 595
KOG1424|consensus562 100.0
KOG2423|consensus572 100.0
KOG2484|consensus435 100.0
PRK09563287 rbgA GTPase YlqF; Reviewed 100.0
COG1161322 Predicted GTPases [General function prediction onl 100.0
TIGR03596276 GTPase_YlqF ribosome biogenesis GTP-binding protei 100.0
COG1160444 Predicted GTPases [General function prediction onl 99.97
cd01858157 NGP_1 NGP-1. Autoantigen NGP-1 (Nucleolar G-protei 99.96
cd01857141 HSR1_MMR1 HSR1/MMR1. Human HSR1, is localized to t 99.95
cd04178172 Nucleostemin_like Nucleostemin-like. Nucleostemin 99.95
cd01856171 YlqF YlqF. Proteins of the YlqF family contain all 99.92
cd01859156 MJ1464 MJ1464. This family represents archaeal GTP 99.92
cd01849155 YlqF_related_GTPase YlqF-related GTPases. These pr 99.92
KOG2485|consensus335 99.91
PRK12289352 GTPase RsgA; Reviewed 99.9
TIGR03594429 GTPase_EngA ribosome-associated GTPase EngA. EngA 99.9
PRK03003472 GTP-binding protein Der; Reviewed 99.89
cd01855190 YqeH YqeH. YqeH is an essential GTP-binding protei 99.89
PRK00093435 GTP-binding protein Der; Reviewed 99.89
PRK09518712 bifunctional cytidylate kinase/GTPase Der; Reviewe 99.87
TIGR00157245 ribosome small subunit-dependent GTPase A. The Aqu 99.87
PRK13796365 GTPase YqeH; Provisional 99.85
PRK12288347 GTPase RsgA; Reviewed 99.84
TIGR03597360 GTPase_YqeH ribosome biogenesis GTPase YqeH. This 99.84
cd01854287 YjeQ_engC YjeQ/EngC. YjeQ (YloQ in Bacillus subtil 99.83
PRK00098298 GTPase RsgA; Reviewed 99.82
COG1162301 Predicted GTPases [General function prediction onl 99.76
PRK01889356 GTPase RsgA; Reviewed 99.67
COG0486454 ThdF Predicted GTPase [General function prediction 99.57
COG1159298 Era GTPase [General function prediction only] 99.51
COG1160444 Predicted GTPases [General function prediction onl 99.38
PF03193161 DUF258: Protein of unknown function, DUF258; Inter 99.36
PRK11058426 GTPase HflX; Provisional 99.35
TIGR03156351 GTP_HflX GTP-binding protein HflX. This protein fa 99.33
TIGR00436270 era GTP-binding protein Era. Era is an essential G 99.32
COG1159298 Era GTPase [General function prediction only] 99.22
PF02421156 FeoB_N: Ferrous iron transport protein B; InterPro 99.22
PRK15494339 era GTPase Era; Provisional 99.19
PRK00089292 era GTPase Era; Reviewed 99.17
COG0218200 Predicted GTPase [General function prediction only 99.17
cd01894157 EngA1 EngA1 subfamily. This CD represents the firs 99.15
PF01926116 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: I 99.12
COG0486454 ThdF Predicted GTPase [General function prediction 99.12
TIGR03156351 GTP_HflX GTP-binding protein HflX. This protein fa 99.12
COG2262411 HflX GTPases [General function prediction only] 99.12
PF02421156 FeoB_N: Ferrous iron transport protein B; InterPro 99.11
KOG1191|consensus531 99.08
cd04171164 SelB SelB subfamily. SelB is an elongation factor 99.05
PRK00093435 GTP-binding protein Der; Reviewed 99.05
PRK03003472 GTP-binding protein Der; Reviewed 99.04
cd01898170 Obg Obg subfamily. The Obg nucleotide binding prot 99.04
PRK05291449 trmE tRNA modification GTPase TrmE; Reviewed 99.02
cd04163168 Era Era subfamily. Era (E. coli Ras-like protein) 99.02
PRK12299335 obgE GTPase CgtA; Reviewed 99.02
COG1084346 Predicted GTPase [General function prediction only 99.01
cd01878204 HflX HflX subfamily. A distinct conserved domain w 99.0
TIGR03594429 GTPase_EngA ribosome-associated GTPase EngA. EngA 99.0
PRK12296500 obgE GTPase CgtA; Reviewed 98.99
cd01897168 NOG NOG1 is a nucleolar GTP-binding protein presen 98.98
cd04164157 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein 98.97
PRK15467158 ethanolamine utilization protein EutP; Provisional 98.97
TIGR02528142 EutP ethanolamine utilization protein, EutP. This 98.96
cd01884195 EF_Tu EF-Tu subfamily. This subfamily includes ort 98.96
TIGR02729329 Obg_CgtA Obg family GTPase CgtA. This model descri 98.96
cd01881176 Obg_like The Obg-like subfamily consists of five w 98.95
cd01895174 EngA2 EngA2 subfamily. This CD represents the seco 98.94
COG1084346 Predicted GTPase [General function prediction only 98.93
PRK12298390 obgE GTPase CgtA; Reviewed 98.93
PRK11058426 GTPase HflX; Provisional 98.92
TIGR00450442 mnmE_trmE_thdF tRNA modification GTPase TrmE. TrmE 98.91
cd01889192 SelB_euk SelB subfamily. SelB is an elongation fac 98.9
cd04166208 CysN_ATPS CysN_ATPS subfamily. CysN, together with 98.9
PRK12297424 obgE GTPase CgtA; Reviewed 98.9
TIGR00436270 era GTP-binding protein Era. Era is an essential G 98.88
PRK09518712 bifunctional cytidylate kinase/GTPase Der; Reviewe 98.88
cd01852196 AIG1 AIG1 (avrRpt2-induced gene 1). This represent 98.88
cd01879158 FeoB Ferrous iron transport protein B (FeoB) subfa 98.87
KOG1191|consensus531 98.86
COG2262411 HflX GTPases [General function prediction only] 98.86
cd00881189 GTP_translation_factor GTP translation factor fami 98.85
PF10662143 PduV-EutP: Ethanolamine utilisation - propanediol 98.82
TIGR03598179 GTPase_YsxC ribosome biogenesis GTP-binding protei 98.81
KOG1423|consensus379 98.8
PRK12298390 obgE GTPase CgtA; Reviewed 98.79
TIGR03598179 GTPase_YsxC ribosome biogenesis GTP-binding protei 98.79
cd01853249 Toc34_like Toc34-like (Translocon at the Outer-env 98.78
PRK00454196 engB GTP-binding protein YsxC; Reviewed 98.78
KOG0057|consensus591 98.78
PTZ00258390 GTP-binding protein; Provisional 98.77
TIGR00991313 3a0901s02IAP34 GTP-binding protein (Chloroplast En 98.77
KOG0058|consensus716 98.76
cd01891194 TypA_BipA TypA (tyrosine phosphorylated protein A) 98.76
PRK09601364 GTP-binding protein YchF; Reviewed 98.76
cd01890179 LepA LepA subfamily. LepA belongs to the GTPase fa 98.75
PRK12317425 elongation factor 1-alpha; Reviewed 98.73
CHL00071409 tufA elongation factor Tu 98.73
PF00009188 GTP_EFTU: Elongation factor Tu GTP binding domain; 98.69
cd01900274 YchF YchF subfamily. YchF is a member of the Obg f 98.69
PRK05291449 trmE tRNA modification GTPase TrmE; Reviewed 98.69
cd01852196 AIG1 AIG1 (avrRpt2-induced gene 1). This represent 98.68
PRK00454196 engB GTP-binding protein YsxC; Reviewed 98.67
PRK15494339 era GTPase Era; Provisional 98.67
cd00880163 Era_like Era (E. coli Ras-like protein)-like. This 98.65
PRK04213201 GTP-binding protein; Provisional 98.65
cd01888203 eIF2_gamma eIF2-gamma (gamma subunit of initiation 98.65
PRK00089292 era GTPase Era; Reviewed 98.64
KOG1423|consensus379 98.64
PRK09866741 hypothetical protein; Provisional 98.62
TIGR00450442 mnmE_trmE_thdF tRNA modification GTPase TrmE. TrmE 98.62
cd04142198 RRP22 RRP22 subfamily. RRP22 (Ras-related protein 98.62
KOG0055|consensus1228 98.61
cd01886270 EF-G Elongation factor G (EF-G) subfamily. Translo 98.59
cd04160167 Arfrp1 Arfrp1 subfamily. Arfrp1 (Arf-related prote 98.59
COG1132567 MdlB ABC-type multidrug transport system, ATPase a 98.59
cd01883219 EF1_alpha Eukaryotic elongation factor 1 (EF1) alp 98.58
PF01926116 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: I 98.58
cd01887168 IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryo 98.57
cd04164157 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein 98.57
TIGR02034406 CysN sulfate adenylyltransferase, large subunit. H 98.57
PRK12299335 obgE GTPase CgtA; Reviewed 98.57
PRK12297424 obgE GTPase CgtA; Reviewed 98.55
PRK12296500 obgE GTPase CgtA; Reviewed 98.54
PRK12735396 elongation factor Tu; Reviewed 98.53
PRK04213201 GTP-binding protein; Provisional 98.53
PRK05506632 bifunctional sulfate adenylyltransferase subunit 1 98.53
cd01876170 YihA_EngB The YihA (EngB) subfamily. This subfamil 98.52
PRK05124474 cysN sulfate adenylyltransferase subunit 1; Provis 98.52
PRK10512 614 selenocysteinyl-tRNA-specific translation factor; 98.51
cd01898170 Obg Obg subfamily. The Obg nucleotide binding prot 98.51
cd01876170 YihA_EngB The YihA (EngB) subfamily. This subfamil 98.5
PLN03127447 Elongation factor Tu; Provisional 98.49
cd01895174 EngA2 EngA2 subfamily. This CD represents the seco 98.49
cd04165224 GTPBP1_like GTPBP1-like. Mammalian GTP binding pro 98.49
PRK12736394 elongation factor Tu; Reviewed 98.48
cd01894157 EngA1 EngA1 subfamily. This CD represents the firs 98.48
TIGR00437591 feoB ferrous iron transporter FeoB. FeoB (773 amin 98.48
cd01897168 NOG NOG1 is a nucleolar GTP-binding protein presen 98.48
cd04151158 Arl1 Arl1 subfamily. Arl1 (Arf-like 1) localizes t 98.48
cd04124161 RabL2 RabL2 subfamily. RabL2 (Rab-like2) subfamily 98.48
cd01879158 FeoB Ferrous iron transport protein B (FeoB) subfa 98.47
KOG1489|consensus366 98.47
cd04163168 Era Era subfamily. Era (E. coli Ras-like protein) 98.47
cd04157162 Arl6 Arl6 subfamily. Arl6 (Arf-like 6) forms a sub 98.47
TIGR00485394 EF-Tu translation elongation factor TU. This align 98.47
cd01896233 DRG The developmentally regulated GTP-binding prot 98.47
PRK00049396 elongation factor Tu; Reviewed 98.47
PLN03126478 Elongation factor Tu; Provisional 98.46
PRK09554 772 feoB ferrous iron transport protein B; Reviewed 98.46
cd01866168 Rab2 Rab2 subfamily. Rab2 is localized on cis-Golg 98.46
TIGR00993 763 3a0901s04IAP86 chloroplast protein import componen 98.45
smart00175164 RAB Rab subfamily of small GTPases. Rab GTPases ar 98.45
TIGR00475581 selB selenocysteine-specific elongation factor Sel 98.45
KOG1490|consensus 620 98.43
KOG0055|consensus 1228 98.43
TIGR02729329 Obg_CgtA Obg family GTPase CgtA. This model descri 98.42
cd04154173 Arl2 Arl2 subfamily. Arl2 (Arf-like 2) GTPases are 98.42
cd01878204 HflX HflX subfamily. A distinct conserved domain w 98.42
COG0370 653 FeoB Fe2+ transport system protein B [Inorganic io 98.42
TIGR02868529 CydC thiol reductant ABC exporter, CydC subunit. T 98.42
PRK00007 693 elongation factor G; Reviewed 98.42
PTZ002651466 multidrug resistance protein (mdr1); Provisional 98.41
cd04119168 RJL RJL (RabJ-Like) subfamily. RJLs are found in m 98.41
cd04169267 RF3 RF3 subfamily. Peptide chain release factor 3 98.41
COG1163365 DRG Predicted GTPase [General function prediction 98.4
TIGR01393595 lepA GTP-binding protein LepA. LepA (GUF1 in Sacca 98.38
cd04153174 Arl5_Arl8 Arl5/Arl8 subfamily. Arl5 (Arf-like 5) a 98.38
PF04548212 AIG1: AIG1 family; InterPro: IPR006703 This entry 98.38
cd04145164 M_R_Ras_like M-Ras/R-Ras-like subfamily. This subf 98.37
PRK09602396 translation-associated GTPase; Reviewed 98.37
cd04159159 Arl10_like Arl10-like subfamily. Arl9/Arl10 was id 98.37
TIGR00484 689 EF-G translation elongation factor EF-G. After pep 98.37
PTZ00327460 eukaryotic translation initiation factor 2 gamma s 98.36
cd04139164 RalA_RalB RalA/RalB subfamily. The Ral (Ras-like) 98.35
TIGR00483426 EF-1_alpha translation elongation factor EF-1 alph 98.35
PRK12739 691 elongation factor G; Reviewed 98.35
TIGR00231161 small_GTP small GTP-binding protein domain. This m 98.35
PRK05433600 GTP-binding protein LepA; Provisional 98.34
cd00154159 Rab Rab family. Rab GTPases form the largest famil 98.34
cd01868165 Rab11_like Rab11-like. Rab11a, Rab11b, and Rab25 a 98.34
cd01861161 Rab6 Rab6 subfamily. Rab6 is involved in microtubu 98.34
cd01862172 Rab7 Rab7 subfamily. Rab7 is a small Rab GTPase th 98.33
cd01882225 BMS1 Bms1. Bms1 is an essential, evolutionarily co 98.33
COG0218200 Predicted GTPase [General function prediction only 98.33
TIGR03680406 eif2g_arch translation initiation factor 2 subunit 98.33
cd04149168 Arf6 Arf6 subfamily. Arf6 (ADP ribosylation factor 98.33
cd01869166 Rab1_Ypt1 Rab1/Ypt1 subfamily. Rab1 is found in ev 98.32
PRK09554 772 feoB ferrous iron transport protein B; Reviewed 98.32
cd04168237 TetM_like Tet(M)-like subfamily. Tet(M), Tet(O), T 98.32
PRK11174588 cysteine/glutathione ABC transporter membrane/ATP- 98.31
cd01863161 Rab18 Rab18 subfamily. Mammalian Rab18 is implicat 98.31
PRK04000411 translation initiation factor IF-2 subunit gamma; 98.31
cd01881176 Obg_like The Obg-like subfamily consists of five w 98.31
cd01896233 DRG The developmentally regulated GTP-binding prot 98.3
cd04113161 Rab4 Rab4 subfamily. Rab4 has been implicated in n 98.3
cd01867167 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2. Rab8/Sec4/Yp 98.3
KOG0056|consensus790 98.28
TIGR01394594 TypA_BipA GTP-binding protein TypA/BipA. This bact 98.28
cd04138162 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily. H-Ras, 98.27
cd04156160 ARLTS1 ARLTS1 subfamily. ARLTS1 (Arf-like tumor su 98.27
cd04171164 SelB SelB subfamily. SelB is an elongation factor 98.27
cd04123162 Rab21 Rab21 subfamily. The localization and functi 98.26
smart00178184 SAR Sar1p-like members of the Ras-family of small 98.25
cd00879190 Sar1 Sar1 subfamily. Sar1 is an essential componen 98.25
COG2274709 SunT ABC-type bacteriocin/lantibiotic exporters, c 98.25
cd04101164 RabL4 RabL4 (Rab-like4) subfamily. RabL4s are nove 98.24
cd01864165 Rab19 Rab19 subfamily. Rab19 proteins are associat 98.24
cd04127180 Rab27A Rab27a subfamily. The Rab27a subfamily cons 98.22
cd01860163 Rab5_related Rab5-related subfamily. This subfamil 98.22
cd01865165 Rab3 Rab3 subfamily. The Rab3 subfamily contains R 98.22
cd00878158 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-lik 98.22
cd01893166 Miro1 Miro1 subfamily. Miro (mitochondrial Rho) pr 98.22
cd04106162 Rab23_lke Rab23-like subfamily. Rab23 is a member 98.22
TIGR03797686 NHPM_micro_ABC2 NHPM bacteriocin system ABC transp 98.21
cd04112191 Rab26 Rab26 subfamily. First identified in rat pan 98.21
cd01887168 IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryo 98.21
cd04144190 Ras2 Ras2 subfamily. The Ras2 subfamily, found exc 98.2
cd04107201 Rab32_Rab38 Rab38/Rab32 subfamily. Rab32 and Rab38 98.19
cd04158169 ARD1 ARD1 subfamily. ARD1 (ADP-ribosylation factor 98.19
cd04122166 Rab14 Rab14 subfamily. Rab14 GTPases are localized 98.19
COG0370 653 FeoB Fe2+ transport system protein B [Inorganic io 98.18
COG4917148 EutP Ethanolamine utilization protein [Amino acid 98.18
smart00173164 RAS Ras subfamily of RAS small GTPases. Similar in 98.18
cd04140165 ARHI_like ARHI subfamily. ARHI (A Ras homolog memb 98.17
cd04136163 Rap_like Rap-like subfamily. The Rap subfamily con 98.17
cd04170268 EF-G_bact Elongation factor G (EF-G) subfamily. Tr 98.16
cd01899318 Ygr210 Ygr210 subfamily. Ygr210 is a member of Obg 98.16
cd04118193 Rab24 Rab24 subfamily. Rab24 is distinct from othe 98.16
cd04152183 Arl4_Arl7 Arl4/Arl7 subfamily. Arl4 (Arf-like 4) i 98.16
cd01885222 EF2 EF2 (for archaea and eukarya). Translocation r 98.16
TIGR03375694 type_I_sec_LssB type I secretion system ATPase, Ls 98.15
COG0536369 Obg Predicted GTPase [General function prediction 98.15
cd01861161 Rab6 Rab6 subfamily. Rab6 is involved in microtubu 98.14
cd01851224 GBP Guanylate-binding protein (GBP), N-terminal do 98.13
cd00882157 Ras_like_GTPase Ras-like GTPase superfamily. The R 98.13
cd00877166 Ran Ran (Ras-related nuclear proteins) /TC4 subfam 98.13
cd00157171 Rho Rho (Ras homology) family. Members of the Rho 98.12
COG3596296 Predicted GTPase [General function prediction only 98.12
cd04155173 Arl3 Arl3 subfamily. Arl3 (Arf-like 3) is an Arf f 98.12
cd00154159 Rab Rab family. Rab GTPases form the largest famil 98.11
cd04109215 Rab28 Rab28 subfamily. First identified in maize, 98.11
TIGR00958711 3a01208 Conjugate Transporter-2 (CT2) Family prote 98.11
TIGR03796710 NHPM_micro_ABC1 NHPM bacteriocin system ABC transp 98.11
KOG1490|consensus620 98.1
cd04147198 Ras_dva Ras-dva subfamily. Ras-dva (Ras - dorsal-v 98.09
PRK10790592 putative multidrug transporter membrane\ATP-bindin 98.09
cd04104197 p47_IIGP_like p47 (47-kDa) family. The p47 GTPase 98.09
cd01863161 Rab18 Rab18 subfamily. Mammalian Rab18 is implicat 98.09
cd04155173 Arl3 Arl3 subfamily. Arl3 (Arf-like 3) is an Arf f 98.07
cd04110199 Rab35 Rab35 subfamily. Rab35 is one of several Rab 98.07
CHL00189742 infB translation initiation factor 2; Provisional 98.07
PRK10218607 GTP-binding protein; Provisional 98.07
PRK05306787 infB translation initiation factor IF-2; Validated 98.06
cd04132187 Rho4_like Rho4-like subfamily. Rho4 is a GTPase th 98.06
PLN03118211 Rab family protein; Provisional 98.06
TIGR01193708 bacteriocin_ABC ABC-type bacteriocin transporter. 98.05
PLN03130 1622 ABC transporter C family member; Provisional 98.05
cd04146165 RERG_RasL11_like RERG/RasL11-like subfamily. RERG 98.05
cd01860163 Rab5_related Rab5-related subfamily. This subfamil 98.05
cd04125188 RabA_like RabA-like subfamily. RabA was first iden 98.05
cd04154173 Arl2 Arl2 subfamily. Arl2 (Arf-like 2) GTPases are 98.04
cd04166208 CysN_ATPS CysN_ATPS subfamily. CysN, together with 98.04
PRK13768253 GTPase; Provisional 98.04
COG0012372 Predicted GTPase, probable translation factor [Tra 98.04
cd04150159 Arf1_5_like Arf1-Arf5-like subfamily. This subfami 98.04
PLN03118211 Rab family protein; Provisional 98.04
cd04126220 Rab20 Rab20 subfamily. Rab20 is one of several Rab 98.03
cd04175164 Rap1 Rap1 subgroup. The Rap1 subgroup is part of t 98.03
TIGR00231161 small_GTP small GTP-binding protein domain. This m 98.03
cd01899318 Ygr210 Ygr210 subfamily. Ygr210 is a member of Obg 98.03
PLN00223181 ADP-ribosylation factor; Provisional 98.03
cd04161167 Arl2l1_Arl13_like Arl2l1/Arl13 subfamily. Arl2l1 ( 98.02
TIGR02857529 CydD thiol reductant ABC exporter, CydD subunit. U 98.02
TIGR00491590 aIF-2 translation initiation factor aIF-2/yIF-2. T 98.02
cd00880163 Era_like Era (E. coli Ras-like protein)-like. This 98.01
PTZ00141446 elongation factor 1- alpha; Provisional 98.01
PRK11176582 lipid transporter ATP-binding/permease protein; Pr 98.01
cd01866168 Rab2 Rab2 subfamily. Rab2 is localized on cis-Golg 98.01
TIGR009571522 MRP_assoc_pro multi drug resistance-associated pro 98.0
COG1163365 DRG Predicted GTPase [General function prediction 98.0
TIGR00487587 IF-2 translation initiation factor IF-2. This mode 98.0
KOG1489|consensus366 98.0
smart00177175 ARF ARF-like small GTPases; ARF, ADP-ribosylation 97.99
COG0536369 Obg Predicted GTPase [General function prediction 97.99
TIGR00092368 GTP-binding protein YchF. This predicted GTP-bindi 97.98
cd01868165 Rab11_like Rab11-like. Rab11a, Rab11b, and Rab25 a 97.98
PTZ00133182 ADP-ribosylation factor; Provisional 97.97
PRK11160574 cysteine/glutathione ABC transporter membrane/ATP- 97.97
PTZ002431560 ABC transporter; Provisional 97.97
TIGR02836 492 spore_IV_A stage IV sporulation protein A. A compa 97.97
PLN032321495 ABC transporter C family member; Provisional 97.97
smart00174174 RHO Rho (Ras homology) subfamily of Ras-like small 97.97
cd00876160 Ras Ras family. The Ras family of the Ras superfam 97.96
PLN00043447 elongation factor 1-alpha; Provisional 97.96
cd04156160 ARLTS1 ARLTS1 subfamily. ARLTS1 (Arf-like tumor su 97.96
cd01867167 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2. Rab8/Sec4/Yp 97.95
cd01889192 SelB_euk SelB subfamily. SelB is an elongation fac 97.94
PLN03110216 Rab GTPase; Provisional 97.94
cd04114169 Rab30 Rab30 subfamily. Rab30 appears to be associa 97.93
cd04115170 Rab33B_Rab33A Rab33B/Rab33A subfamily. Rab33B is u 97.93
cd04141172 Rit_Rin_Ric Rit/Rin/Ric subfamily. Rit (Ras-like p 97.93
PLN03108210 Rab family protein; Provisional 97.93
PTZ00369189 Ras-like protein; Provisional 97.92
PRK00741526 prfC peptide chain release factor 3; Provisional 97.92
cd04162164 Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily. Arl9 97.91
cd04143247 Rhes_like Rhes_like subfamily. This subfamily incl 97.91
cd04153174 Arl5_Arl8 Arl5/Arl8 subfamily. Arl5 (Arf-like 5) a 97.9
cd04157162 Arl6 Arl6 subfamily. Arl6 (Arf-like 6) forms a sub 97.9
PRK15467158 ethanolamine utilization protein EutP; Provisional 97.9
smart00175164 RAB Rab subfamily of small GTPases. Rab GTPases ar 97.9
cd00881189 GTP_translation_factor GTP translation factor fami 97.89
PRK13657588 cyclic beta-1,2-glucan ABC transporter; Provisiona 97.89
TIGR01846694 type_I_sec_HlyB type I secretion system ABC transp 97.89
cd04119168 RJL RJL (RabJ-Like) subfamily. RJLs are found in m 97.88
cd04176163 Rap2 Rap2 subgroup. The Rap2 subgroup is part of t 97.88
cd01853249 Toc34_like Toc34-like (Translocon at the Outer-env 97.88
TIGR00437 591 feoB ferrous iron transporter FeoB. FeoB (773 amin 97.88
KOG1491|consensus391 97.87
cd00878158 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-lik 97.87
cd04116170 Rab9 Rab9 subfamily. Rab9 is found in late endosom 97.86
cd04148221 RGK RGK subfamily. The RGK (Rem, Rem2, Rad, Gem/Ki 97.86
cd04145164 M_R_Ras_like M-Ras/R-Ras-like subfamily. This subf 97.86
cd04167213 Snu114p Snu114p subfamily. Snu114p is one of sever 97.86
TIGR02203571 MsbA_lipidA lipid A export permease/ATP-binding pr 97.86
KOG2486|consensus320 97.85
cd01862172 Rab7 Rab7 subfamily. Rab7 is a small Rab GTPase th 97.85
cd04113161 Rab4 Rab4 subfamily. Rab4 has been implicated in n 97.85
cd01864165 Rab19 Rab19 subfamily. Rab19 proteins are associat 97.85
TIGR00503527 prfC peptide chain release factor 3. This translat 97.84
cd01892169 Miro2 Miro2 subfamily. Miro (mitochondrial Rho) pr 97.84
cd01890179 LepA LepA subfamily. LepA belongs to the GTPase fa 97.83
COG5265497 ATM1 ABC-type transport system involved in Fe-S cl 97.82
smart00178184 SAR Sar1p-like members of the Ras-family of small 97.82
PLN03071219 GTP-binding nuclear protein Ran; Provisional 97.8
cd04111211 Rab39 Rab39 subfamily. Found in eukaryotes, Rab39 97.8
cd01850276 CDC_Septin CDC/Septin. Septins are a conserved fam 97.8
PTZ00258390 GTP-binding protein; Provisional 97.79
cd01865165 Rab3 Rab3 subfamily. The Rab3 subfamily contains R 97.79
cd04118193 Rab24 Rab24 subfamily. Rab24 is distinct from othe 97.79
cd04160167 Arfrp1 Arfrp1 subfamily. Arfrp1 (Arf-related prote 97.78
smart00053240 DYNc Dynamin, GTPase. Large GTPases that mediate v 97.78
cd01869166 Rab1_Ypt1 Rab1/Ypt1 subfamily. Rab1 is found in ev 97.77
cd04177168 RSR1 RSR1 subgroup. RSR1/Bud1p is a member of the 97.77
cd04151158 Arl1 Arl1 subfamily. Arl1 (Arf-like 1) localizes t 97.76
cd01891194 TypA_BipA TypA (tyrosine phosphorylated protein A) 97.76
KOG0462|consensus650 97.76
cd04149168 Arf6 Arf6 subfamily. Arf6 (ADP ribosylation factor 97.76
PRK12317 425 elongation factor 1-alpha; Reviewed 97.76
cd04138162 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily. H-Ras, 97.75
PF00350168 Dynamin_N: Dynamin family; InterPro: IPR001401 Mem 97.75
PRK12740 668 elongation factor G; Reviewed 97.75
cd04135174 Tc10 TC10 subfamily. TC10 is a Rho family protein 97.75
cd04159159 Arl10_like Arl10-like subfamily. Arl9/Arl10 was id 97.74
cd04152183 Arl4_Arl7 Arl4/Arl7 subfamily. Arl4 (Arf-like 4) i 97.74
COG4988559 CydD ABC-type transport system involved in cytochr 97.74
TIGR02204576 MsbA_rel ABC transporter, permease/ATP-binding pro 97.73
TIGR012711490 CFTR_protein cystic fibrosis transmembrane conduct 97.73
PTZ00099176 rab6; Provisional 97.72
cd01884195 EF_Tu EF-Tu subfamily. This subfamily includes ort 97.72
cd04110199 Rab35 Rab35 subfamily. Rab35 is one of several Rab 97.72
cd04121189 Rab40 Rab40 subfamily. This subfamily contains Rab 97.72
PRK13351 687 elongation factor G; Reviewed 97.71
cd01870175 RhoA_like RhoA-like subfamily. The RhoA subfamily 97.71
cd00879190 Sar1 Sar1 subfamily. Sar1 is an essential componen 97.71
cd04161167 Arl2l1_Arl13_like Arl2l1/Arl13 subfamily. Arl2l1 ( 97.71
PRK04004586 translation initiation factor IF-2; Validated 97.7
PRK09601364 GTP-binding protein YchF; Reviewed 97.7
cd04137180 RheB Rheb (Ras Homolog Enriched in Brain) subfamil 97.69
cd00876160 Ras Ras family. The Ras family of the Ras superfam 97.69
cd04130173 Wrch_1 Wrch-1 subfamily. Wrch-1 (Wnt-1 responsive 97.68
cd04142198 RRP22 RRP22 subfamily. RRP22 (Ras-related protein 97.67
cd04137180 RheB Rheb (Ras Homolog Enriched in Brain) subfamil 97.67
cd04112191 Rab26 Rab26 subfamily. First identified in rat pan 97.67
smart00173164 RAS Ras subfamily of RAS small GTPases. Similar in 97.67
TIGR02528142 EutP ethanolamine utilization protein, EutP. This 97.66
cd04123162 Rab21 Rab21 subfamily. The localization and functi 97.65
cd04106162 Rab23_lke Rab23-like subfamily. Rab23 is a member 97.65
cd04139164 RalA_RalB RalA/RalB subfamily. The Ral (Ras-like) 97.65
cd00157171 Rho Rho (Ras homology) family. Members of the Rho 97.65
COG1126240 GlnQ ABC-type polar amino acid transport system, A 97.65
PRK10789569 putative multidrug transporter membrane\ATP-bindin 97.64
PF05049376 IIGP: Interferon-inducible GTPase (IIGP); InterPro 97.64
KOG0054|consensus1381 97.64
cd04115170 Rab33B_Rab33A Rab33B/Rab33A subfamily. Rab33B is u 97.63
cd01893166 Miro1 Miro1 subfamily. Miro (mitochondrial Rho) pr 97.63
TIGR01842544 type_I_sec_PrtD type I secretion system ABC transp 97.63
cd04122166 Rab14 Rab14 subfamily. Rab14 GTPases are localized 97.63
cd04125188 RabA_like RabA-like subfamily. RabA was first iden 97.61
CHL00071 409 tufA elongation factor Tu 97.6
cd04136163 Rap_like Rap-like subfamily. The Rap subfamily con 97.59
cd04177168 RSR1 RSR1 subgroup. RSR1/Bud1p is a member of the 97.59
PTZ00416 836 elongation factor 2; Provisional 97.58
cd01900274 YchF YchF subfamily. YchF is a member of the Obg f 97.58
PRK09602396 translation-associated GTPase; Reviewed 97.58
cd04140165 ARHI_like ARHI subfamily. ARHI (A Ras homolog memb 97.57
cd04175164 Rap1 Rap1 subgroup. The Rap1 subgroup is part of t 97.57
cd04124161 RabL2 RabL2 subfamily. RabL2 (Rab-like2) subfamily 97.57
cd04128182 Spg1 Spg1p. Spg1p (septum-promoting GTPase) was fi 97.57
PLN00116 843 translation elongation factor EF-2 subunit; Provis 97.56
KOG0410|consensus410 97.56
cd04135174 Tc10 TC10 subfamily. TC10 is a Rho family protein 97.56
TIGR01192585 chvA glucan exporter ATP-binding protein. This mod 97.56
cd04120202 Rab12 Rab12 subfamily. Rab12 was first identified 97.56
cd04108170 Rab36_Rab34 Rab34/Rab36 subfamily. Rab34, found pr 97.56
PTZ00133182 ADP-ribosylation factor; Provisional 97.55
TIGR00487 587 IF-2 translation initiation factor IF-2. This mode 97.55
PLN03110216 Rab GTPase; Provisional 97.55
cd04134189 Rho3 Rho3 subfamily. Rho3 is a member of the Rho f 97.54
cd04174232 Rnd1_Rho6 Rnd1/Rho6 subfamily. Rnd1/Rho6 is a memb 97.53
cd04116170 Rab9 Rab9 subfamily. Rab9 is found in late endosom 97.52
cd01873195 RhoBTB RhoBTB subfamily. Members of the RhoBTB sub 97.52
PRK12735396 elongation factor Tu; Reviewed 97.51
cd04172182 Rnd3_RhoE_Rho8 Rnd3/RhoE/Rho8 subfamily. Rnd3/RhoE 97.51
cd04150159 Arf1_5_like Arf1-Arf5-like subfamily. This subfami 97.5
cd01871174 Rac1_like Rac1-like subfamily. The Rac1-like subfa 97.49
cd04114169 Rab30 Rab30 subfamily. Rab30 appears to be associa 97.49
cd04176163 Rap2 Rap2 subgroup. The Rap2 subgroup is part of t 97.49
cd04131178 Rnd Rnd subfamily. The Rnd subfamily contains Rnd1 97.48
COG4987573 CydC ABC-type transport system involved in cytochr 97.48
cd04101164 RabL4 RabL4 (Rab-like4) subfamily. RabL4s are nove 97.48
cd04158169 ARD1 ARD1 subfamily. ARD1 (ADP-ribosylation factor 97.47
cd04132187 Rho4_like Rho4-like subfamily. Rho4 is a GTPase th 97.46
cd00877166 Ran Ran (Ras-related nuclear proteins) /TC4 subfam 97.46
COG2895431 CysN GTPases - Sulfate adenylate transferase subun 97.45
TIGR00490 720 aEF-2 translation elongation factor aEF-2. This mo 97.44
COG1117253 PstB ABC-type phosphate transport system, ATPase c 97.44
PF08477119 Miro: Miro-like protein; InterPro: IPR013684 Mitoc 97.44
cd04127180 Rab27A Rab27a subfamily. The Rab27a subfamily cons 97.43
cd04104197 p47_IIGP_like p47 (47-kDa) family. The p47 GTPase 97.43
PF00735281 Septin: Septin; InterPro: IPR000038 Septins consti 97.43
smart00176200 RAN Ran (Ras-related nuclear proteins) /TC4 subfam 97.43
cd04144190 Ras2 Ras2 subfamily. The Ras2 subfamily, found exc 97.42
cd04105203 SR_beta Signal recognition particle receptor, beta 97.42
cd04109215 Rab28 Rab28 subfamily. First identified in maize, 97.41
PRK05306 787 infB translation initiation factor IF-2; Validated 97.4
cd04117161 Rab15 Rab15 subfamily. Rab15 colocalizes with the 97.39
cd01850276 CDC_Septin CDC/Septin. Septins are a conserved fam 97.38
PLN03127447 Elongation factor Tu; Provisional 97.38
smart00177175 ARF ARF-like small GTPases; ARF, ADP-ribosylation 97.38
COG3839338 MalK ABC-type sugar transport systems, ATPase comp 97.37
PTZ00369189 Ras-like protein; Provisional 97.36
cd04111211 Rab39 Rab39 subfamily. Found in eukaryotes, Rab39 97.36
PLN00223181 ADP-ribosylation factor; Provisional 97.35
COG1217603 TypA Predicted membrane GTPase involved in stress 97.35
cd01886270 EF-G Elongation factor G (EF-G) subfamily. Translo 97.34
PLN03071219 GTP-binding nuclear protein Ran; Provisional 97.34
COG1135339 AbcC ABC-type metal ion transport system, ATPase c 97.34
cd00882157 Ras_like_GTPase Ras-like GTPase superfamily. The R 97.34
PRK07560 731 elongation factor EF-2; Reviewed 97.34
cd04107201 Rab32_Rab38 Rab38/Rab32 subfamily. Rab32 and Rab38 97.33
smart00174174 RHO Rho (Ras homology) subfamily of Ras-like small 97.33
TIGR00993 763 3a0901s04IAP86 chloroplast protein import componen 97.33
cd04148221 RGK RGK subfamily. The RGK (Rem, Rem2, Rad, Gem/Ki 97.32
TIGR00991313 3a0901s02IAP34 GTP-binding protein (Chloroplast En 97.32
cd04146165 RERG_RasL11_like RERG/RasL11-like subfamily. RERG 97.32
PLN03108210 Rab family protein; Provisional 97.31
CHL00189 742 infB translation initiation factor 2; Provisional 97.31
PRK00049396 elongation factor Tu; Reviewed 97.3
KOG1145|consensus683 97.3
COG0481603 LepA Membrane GTPase LepA [Cell envelope biogenesi 97.29
PF10662143 PduV-EutP: Ethanolamine utilisation - propanediol 97.28
TIGR00491 590 aIF-2 translation initiation factor aIF-2/yIF-2. T 97.28
cd04108170 Rab36_Rab34 Rab34/Rab36 subfamily. Rab34, found pr 97.28
PF00025175 Arf: ADP-ribosylation factor family The prints ent 97.26
cd01874175 Cdc42 Cdc42 subfamily. Cdc42 is an essential GTPas 97.26
PRK148451049 translation initiation factor IF-2; Provisional 97.25
cd04170268 EF-G_bact Elongation factor G (EF-G) subfamily. Tr 97.24
cd01870175 RhoA_like RhoA-like subfamily. The RhoA subfamily 97.23
PTZ00132215 GTP-binding nuclear protein Ran; Provisional 97.23
cd04117161 Rab15 Rab15 subfamily. Rab15 colocalizes with the 97.23
cd01875191 RhoG RhoG subfamily. RhoG is a GTPase with high se 97.23
PRK05506 632 bifunctional sulfate adenylyltransferase subunit 1 97.22
COG1116248 TauB ABC-type nitrate/sulfonate/bicarbonate transp 97.22
cd04126220 Rab20 Rab20 subfamily. Rab20 is one of several Rab 97.21
TIGR00475 581 selB selenocysteine-specific elongation factor Sel 97.2
KOG1486|consensus364 97.2
TIGR00485394 EF-Tu translation elongation factor TU. This align 97.19
cd04133176 Rop_like Rop subfamily. The Rop (Rho-related prote 97.18
cd04173222 Rnd2_Rho7 Rnd2/Rho7 subfamily. Rnd2/Rho7 is a memb 97.18
cd01882225 BMS1 Bms1. Bms1 is an essential, evolutionarily co 97.16
cd04141172 Rit_Rin_Ric Rit/Rin/Ric subfamily. Rit (Ras-like p 97.15
cd04129187 Rho2 Rho2 subfamily. Rho2 is a fungal GTPase that 97.15
KOG1547|consensus336 97.14
cd04147198 Ras_dva Ras-dva subfamily. Ras-dva (Ras - dorsal-v 97.13
cd04168237 TetM_like Tet(M)-like subfamily. Tet(M), Tet(O), T 97.12
cd04162164 Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily. Arl9 97.12
PRK04004 586 translation initiation factor IF-2; Validated 97.12
cd04105203 SR_beta Signal recognition particle receptor, beta 97.11
PTZ00265 1466 multidrug resistance protein (mdr1); Provisional 97.09
PTZ00132215 GTP-binding nuclear protein Ran; Provisional 97.07
COG4618580 ArpD ABC-type protease/lipase transport system, AT 97.06
PRK10522547 multidrug transporter membrane component/ATP-bindi 97.05
cd01874175 Cdc42 Cdc42 subfamily. Cdc42 is an essential GTPas 97.02
cd01892169 Miro2 Miro2 subfamily. Miro (mitochondrial Rho) pr 97.02
COG0532509 InfB Translation initiation factor 2 (IF-2; GTPase 97.0
cd04134189 Rho3 Rho3 subfamily. Rho3 is a member of the Rho f 97.0
TIGR01194555 cyc_pep_trnsptr cyclic peptide transporter. This m 97.0
PRK12736394 elongation factor Tu; Reviewed 96.99
TIGR00484 689 EF-G translation elongation factor EF-G. After pep 96.99
TIGR02836492 spore_IV_A stage IV sporulation protein A. A compa 96.98
COG1100219 GTPase SAR1 and related small G proteins [General 96.96
>KOG1424|consensus Back     alignment and domain information 
Probab=100.00  E-value=5.4e-113  Score=907.02  Aligned_cols=548  Identities=45%  Similarity=0.737  Sum_probs=441.7

Q ss_pred             CCCC--CCCCCchHHHHhhhhcCCCCcc-CCCCccceeeccccccccccCcccccccccHHHHHHHHHhcCCcccccccc
Q psy9995           1 MGKK--GGQNSLGKALIKNRFGHKPKRV-SNDGLLHTSELEDGYDWNKINLKSVTEESSFQEFLSTAQLAGTEFTAEKLN   77 (595)
Q Consensus         1 m~~~--~~~~~lg~~l~~~r~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~svte~~~l~~fl~~a~l~~~~f~ae~~~   77 (595)
                      |||.  +...+||+++++++.+....++ +..+++|++   |.|+|++++++|||++++||+||.||++|+++|+||+.|
T Consensus         1 m~k~~k~~~~~lgr~~~k~~~~~~q~~~~~~~s~~~~~---d~~~~~~~~l~svt~~s~~d~~l~~ae~a~~~f~ae~~~   77 (562)
T KOG1424|consen    1 MGKQPKKALPSLGRALRKHHDGMRQRSKEKGKSKLLRS---DKYEWGKLVLESVTEESDLDAFLGTAELAETEFTAEKSN   77 (562)
T ss_pred             CCcCccccccchHHHhhhcccchhhhhhhcCCcccccc---cccccccceeeeeecccChHHhhhhhhhhhhhhhhhhcc
Confidence            8887  4567899999999998764443 778889987   889999999999999999999999999999999999999


Q ss_pred             eEEeCCCCCCccCC-HHHHHHHHHHHHh--cCCcccCCCCCCCCcCCCHHHHHHHHHHHhhhhcCeeeEEEeCCCcccCh
Q psy9995          78 ITFVNPKSGVGLLS-KEEKELALQAHKE--KRELLKIPRRPKWDKNTTAEQLQAMERDEFLQWRRELNLLQEEDGLVITP  154 (595)
Q Consensus        78 ~~~~~~~~~~~l~~-~~~~~~~~~~~~~--~~~~l~iprRPnw~kst~~n~L~~~Er~~f~~wrg~~~~L~DT~Gi~~t~  154 (595)
                      +++|..++..+.++ ..++....++|++  |...|+|||||+|+..|++++|++.|+++|++|++.++.|++..++++||
T Consensus        78 ~~~i~~~~~~~~~~s~~ee~r~~q~~ee~~~~~~L~iPRRP~W~~~~s~eeLd~~EkeaFlewrr~L~~Lqe~e~l~lTp  157 (562)
T KOG1424|consen   78 ETIIENEQRTGSLSSATEEQRELQKQEEALNASRLDIPRRPPWTLEMSKEELDRQEKEAFLEWRRKLASLQENEKLVLTP  157 (562)
T ss_pred             ccccchhhcccccccHHHHhhhhhhhhhhhhcccccccCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHhhhcCCeeech
Confidence            99999887777666 8888888889999  99999999999999999999999999999999999999999999999999


Q ss_pred             hhhhHHHHHHHHHHHhhcCeEEEEEeCCCCCCCCchHHHHHHHHhCCCCcEEEEEeCCCCCCHHHHHHHHHHHhhCCCeE
Q psy9995         155 YEKNLDFWRQLWRVIERSDVIVQIVDARNPLLFRCEDLERYVKEVSPHKRNMILLNKADLLTRKQRCYWTKYFNSVNVAV  234 (595)
Q Consensus       155 ~ern~e~~rql~~vie~sDvVl~VvDAR~Pl~~~~~~Le~~lk~v~~~K~~ILVlNK~DLl~~~~~~~w~~~~~~~gi~v  234 (595)
                      ||+|+++|||||+|+|+|||||+|||||+|+.|++++|++|++++...|.+|||+||+||++++++.+|++||.+.++.+
T Consensus       158 FErNLE~WRQLWRVlErSDivvqIVDARnPllfr~~dLe~Yvke~d~~K~~~LLvNKaDLl~~~qr~aWa~YF~~~ni~~  237 (562)
T KOG1424|consen  158 FERNLEIWRQLWRVLERSDIVVQIVDARNPLLFRSPDLEDYVKEVDPSKANVLLVNKADLLPPEQRVAWAEYFRQNNIPV  237 (562)
T ss_pred             hhhCHHHHHHHHHHHhhcceEEEEeecCCccccCChhHHHHHhccccccceEEEEehhhcCCHHHHHHHHHHHHhcCceE
Confidence            99999999999999999999999999999999999999999999988899999999999999999999999999999999


Q ss_pred             EEEecccCCCCCCCCccchhhhhhhccccccchhhhhhhhhhhccccchhhhhhcc-ccCCccccCHHHHHHHhhhhccc
Q psy9995         235 AFFSATNIYDDIPEGDEELEDEVVSEESESDESEWEDISEEEEEDDGQKVLENDLK-IKSSPKLLNREELISLFKSFHDV  313 (595)
Q Consensus       235 i~~SA~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~il~~~eL~e~~~~~~~~  313 (595)
                      +||||......++.....+. ....+......   ..+..    ++....+..... ..+..+ +...++++.+.....+
T Consensus       238 vf~SA~~at~~~~~~~~~e~-~r~~d~~~~~~---~~~~~----~~~d~~i~r~~~d~~e~~~-v~~~~~~s~~~~~~t~  308 (562)
T KOG1424|consen  238 VFFSALAATEQLESKVLKED-RRSLDGVSRAL---GAIFV----GEVDLKIARDKGDGEEIED-VEQLRLISAMEPTPTG  308 (562)
T ss_pred             EEEecccccccccccchhhh-hhcccchhhhc---ccccc----ccchhhhhhhcccccchhh-HHhhhhhhccccCCCC
Confidence            99999885443222100000 00000000000   00000    000000000000 000000 2222334444433333


Q ss_pred             CCCCCCCCceEEEEeecCCCCcchHhhhhcCcceeEecCCCCCceeeEEEEcCCceEEEeCCCCccCCcccchhHHHHhc
Q psy9995         314 NIPRMNPDVMTIGLVGYPNVGKSSTINALLNAKKVSVSATPGKTKHFQTLFVDDELLLCDCPGLVMPSFVFSKADMILNG  393 (595)
Q Consensus       314 ~~~~~~~~~i~i~lvG~pnvGKSSliN~L~~~~kvsVs~tPG~TKh~Qti~~~~~~~liDtPGl~~p~f~~tk~eli~~g  393 (595)
                        .+.++ .++||+||||||||||+||+|+|.++|+||+|||+|||||||.+++.++||||||++||+|..++++|||+|
T Consensus       309 --~~~~~-~vtVG~VGYPNVGKSSTINaLvG~KkVsVS~TPGkTKHFQTi~ls~~v~LCDCPGLVfPSf~~~r~emvl~G  385 (562)
T KOG1424|consen  309 --ERYKD-VVTVGFVGYPNVGKSSTINALVGRKKVSVSSTPGKTKHFQTIFLSPSVCLCDCPGLVFPSFSPTRAEMVLNG  385 (562)
T ss_pred             --cCCCc-eeEEEeecCCCCchhHHHHHHhcCceeeeecCCCCcceeEEEEcCCCceecCCCCccccCCCchHHHHHHhc
Confidence              33344 799999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCchhhhhhhhhhHHHHhhhcChhHHHHHhCCCCCCCCCCCCCCCCCCHHHHHHHhhhhcCccccCCCCCHHHHHHHHHH
Q psy9995         394 ILPIDQMRDHVPAVNMLCTLVPRHVLENIYGIMITQPDEGEDPNRPPFSEELCNAYGYNRGFMTSNGQPDNPRSARYILK  473 (595)
Q Consensus       394 il~id~lrd~~~~v~~l~~~i~~~~le~~Y~i~~~~p~~~~~~~~~~~~~e~L~~~a~~rG~~~~gG~pD~~rAAr~iLk  473 (595)
                      |+|||||++|++++.++|++||.++|+..||   ..|.+.++..++|++.|+|.+||++||||+++|.||..||||+||+
T Consensus       386 iLPIDQmrd~~~~~~llaerIP~~~Le~~Y~---~k~~e~~~~~~pp~A~ell~a~a~~RGfmts~~~~D~~RAAr~ILK  462 (562)
T KOG1424|consen  386 ILPIDQLRDHYGAVGLLAERIPRHVLERLYG---HKPREDPEDSRPPSAAELLNAYAYKRGFMTSKGLPDEYRAARYILK  462 (562)
T ss_pred             CccHHHhhcccchHHHHHHhcCHHHHHHHhC---CCcccccCCCCCchHHHHHHHHHHhcchhhhccCCcchHHHHHHHH
Confidence            9999999999999999999999999999999   3566777778899999999999999999999999999999999999


Q ss_pred             HHHhCCceeecCCCCCChhhhhh--chhcccC-----CCCCCchhhhhccCCCCccccccchhhhccCCCceEecccccc
Q psy9995         474 DFVNGHLLYCQAPPGVPQEKYHI--FKLKERK-----PLPKQTPRAMRALEPNVVRATDIDSKFFKKATGTALVKGRASV  546 (595)
Q Consensus       474 D~~~GKL~~~~~PP~~~~~~f~~--~~~~~~~-----~~~~~~~~~~~~~~~~~~~~~~~d~~ff~~~~~~~~~~~~~~~  546 (595)
                      ||++|||+||++||++++..|.+  .|+....     .++......  ...... .++.+|..||.+.++.+|++|....
T Consensus       463 Dyv~GKL~~~~~PPg~~~~~~~~~~~pe~~~~~~~~~~l~~~~~e~--~~~~~~-~~~~~d~~~~~~~~~~~~~~g~~~~  539 (562)
T KOG1424|consen  463 DYVSGKLLYCFPPPGYEPQKFTWEEHPETTERVYLQDRLEGLQSEQ--EEEGEE-LSSSVDEEFEDDLSSDAETNGDEET  539 (562)
T ss_pred             HHhCCeeeeeeCCCCCCccccchhhCchHhhhhhhhhhcCchhhhh--hhhhhh-hhhhhhhhhccccchhhhcCccccc
Confidence            99999999999999999886663  4443321     111111111  111011 2244999999999999999998877


Q ss_pred             CCCCCCccccCCCcccccccCCCCCCCcccccccccc
Q psy9995         547 VPQGLGKGSMNASTMSLNTISSEDPKPWKQHKEKRNK  583 (595)
Q Consensus       547 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  583 (595)
                      |          .+...+   .....+||+.|+ +.+|
T Consensus       540 ~----------~~~~~~---~~~~~~~~~~~~-~~~~  562 (562)
T KOG1424|consen  540 P----------TSAPGS---ENAGRNPYALLN-EDGK  562 (562)
T ss_pred             c----------ccCCcc---cccCCCcccccc-ccCC
Confidence            5          122222   377889999998 5543

>KOG2423|consensus Back     alignment and domain information
>KOG2484|consensus Back     alignment and domain information
>PRK09563 rbgA GTPase YlqF; Reviewed Back     alignment and domain information
>COG1161 Predicted GTPases [General function prediction only] Back     alignment and domain information
>TIGR03596 GTPase_YlqF ribosome biogenesis GTP-binding protein YlqF Back     alignment and domain information
>COG1160 Predicted GTPases [General function prediction only] Back     alignment and domain information
>cd01858 NGP_1 NGP-1 Back     alignment and domain information
>cd01857 HSR1_MMR1 HSR1/MMR1 Back     alignment and domain information
>cd04178 Nucleostemin_like Nucleostemin-like Back     alignment and domain information
>cd01856 YlqF YlqF Back     alignment and domain information
>cd01859 MJ1464 MJ1464 Back     alignment and domain information
>cd01849 YlqF_related_GTPase YlqF-related GTPases Back     alignment and domain information
>KOG2485|consensus Back     alignment and domain information
>PRK12289 GTPase RsgA; Reviewed Back     alignment and domain information
>TIGR03594 GTPase_EngA ribosome-associated GTPase EngA Back     alignment and domain information
>PRK03003 GTP-binding protein Der; Reviewed Back     alignment and domain information
>cd01855 YqeH YqeH Back     alignment and domain information
>PRK00093 GTP-binding protein Der; Reviewed Back     alignment and domain information
>PRK09518 bifunctional cytidylate kinase/GTPase Der; Reviewed Back     alignment and domain information
>TIGR00157 ribosome small subunit-dependent GTPase A Back     alignment and domain information
>PRK13796 GTPase YqeH; Provisional Back     alignment and domain information
>PRK12288 GTPase RsgA; Reviewed Back     alignment and domain information
>TIGR03597 GTPase_YqeH ribosome biogenesis GTPase YqeH Back     alignment and domain information
>cd01854 YjeQ_engC YjeQ/EngC Back     alignment and domain information
>PRK00098 GTPase RsgA; Reviewed Back     alignment and domain information
>COG1162 Predicted GTPases [General function prediction only] Back     alignment and domain information
>PRK01889 GTPase RsgA; Reviewed Back     alignment and domain information
>COG0486 ThdF Predicted GTPase [General function prediction only] Back     alignment and domain information
>COG1159 Era GTPase [General function prediction only] Back     alignment and domain information
>COG1160 Predicted GTPases [General function prediction only] Back     alignment and domain information
>PF03193 DUF258: Protein of unknown function, DUF258; InterPro: IPR004881 This entry contains Escherichia coli (strain K12) RsgA, which may play a role in 30S ribosomal subunit biogenesis Back     alignment and domain information
>PRK11058 GTPase HflX; Provisional Back     alignment and domain information
>TIGR03156 GTP_HflX GTP-binding protein HflX Back     alignment and domain information
>TIGR00436 era GTP-binding protein Era Back     alignment and domain information
>COG1159 Era GTPase [General function prediction only] Back     alignment and domain information
>PF02421 FeoB_N: Ferrous iron transport protein B; InterPro: IPR011619 Escherichia coli has an iron(II) transport system (feo) which may make an important contribution to the iron supply of the cell under anaerobic conditions Back     alignment and domain information
>PRK15494 era GTPase Era; Provisional Back     alignment and domain information
>PRK00089 era GTPase Era; Reviewed Back     alignment and domain information
>COG0218 Predicted GTPase [General function prediction only] Back     alignment and domain information
>cd01894 EngA1 EngA1 subfamily Back     alignment and domain information
>PF01926 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: IPR002917 Human HSR1, has been localized to the human MHC class I region and is highly homologous to a putative GTP-binding protein, MMR1 from mouse Back     alignment and domain information
>COG0486 ThdF Predicted GTPase [General function prediction only] Back     alignment and domain information
>TIGR03156 GTP_HflX GTP-binding protein HflX Back     alignment and domain information
>COG2262 HflX GTPases [General function prediction only] Back     alignment and domain information
>PF02421 FeoB_N: Ferrous iron transport protein B; InterPro: IPR011619 Escherichia coli has an iron(II) transport system (feo) which may make an important contribution to the iron supply of the cell under anaerobic conditions Back     alignment and domain information
>KOG1191|consensus Back     alignment and domain information
>cd04171 SelB SelB subfamily Back     alignment and domain information
>PRK00093 GTP-binding protein Der; Reviewed Back     alignment and domain information
>PRK03003 GTP-binding protein Der; Reviewed Back     alignment and domain information
>cd01898 Obg Obg subfamily Back     alignment and domain information
>PRK05291 trmE tRNA modification GTPase TrmE; Reviewed Back     alignment and domain information
>cd04163 Era Era subfamily Back     alignment and domain information
>PRK12299 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>COG1084 Predicted GTPase [General function prediction only] Back     alignment and domain information
>cd01878 HflX HflX subfamily Back     alignment and domain information
>TIGR03594 GTPase_EngA ribosome-associated GTPase EngA Back     alignment and domain information
>PRK12296 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>cd01897 NOG NOG1 is a nucleolar GTP-binding protein present in eukaryotes ranging from trypanosomes to humans Back     alignment and domain information
>cd04164 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein found in bacteria and eukaryotes Back     alignment and domain information
>PRK15467 ethanolamine utilization protein EutP; Provisional Back     alignment and domain information
>TIGR02528 EutP ethanolamine utilization protein, EutP Back     alignment and domain information
>cd01884 EF_Tu EF-Tu subfamily Back     alignment and domain information
>TIGR02729 Obg_CgtA Obg family GTPase CgtA Back     alignment and domain information
>cd01881 Obg_like The Obg-like subfamily consists of five well-delimited, ancient subfamilies, namely Obg, DRG, YyaF/YchF, Ygr210, and NOG1 Back     alignment and domain information
>cd01895 EngA2 EngA2 subfamily Back     alignment and domain information
>COG1084 Predicted GTPase [General function prediction only] Back     alignment and domain information
>PRK12298 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>PRK11058 GTPase HflX; Provisional Back     alignment and domain information
>TIGR00450 mnmE_trmE_thdF tRNA modification GTPase TrmE Back     alignment and domain information
>cd01889 SelB_euk SelB subfamily Back     alignment and domain information
>cd04166 CysN_ATPS CysN_ATPS subfamily Back     alignment and domain information
>PRK12297 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>TIGR00436 era GTP-binding protein Era Back     alignment and domain information
>PRK09518 bifunctional cytidylate kinase/GTPase Der; Reviewed Back     alignment and domain information
>cd01852 AIG1 AIG1 (avrRpt2-induced gene 1) Back     alignment and domain information
>cd01879 FeoB Ferrous iron transport protein B (FeoB) subfamily Back     alignment and domain information
>KOG1191|consensus Back     alignment and domain information
>COG2262 HflX GTPases [General function prediction only] Back     alignment and domain information
>cd00881 GTP_translation_factor GTP translation factor family Back     alignment and domain information
>PF10662 PduV-EutP: Ethanolamine utilisation - propanediol utilisation; InterPro: IPR012381 Members of this family function in ethanolamine [] and propanediol [] degradation pathways Back     alignment and domain information
>TIGR03598 GTPase_YsxC ribosome biogenesis GTP-binding protein YsxC/EngB Back     alignment and domain information
>KOG1423|consensus Back     alignment and domain information
>PRK12298 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>TIGR03598 GTPase_YsxC ribosome biogenesis GTP-binding protein YsxC/EngB Back     alignment and domain information
>cd01853 Toc34_like Toc34-like (Translocon at the Outer-envelope membrane of Chloroplasts) Back     alignment and domain information
>PRK00454 engB GTP-binding protein YsxC; Reviewed Back     alignment and domain information
>KOG0057|consensus Back     alignment and domain information
>PTZ00258 GTP-binding protein; Provisional Back     alignment and domain information
>TIGR00991 3a0901s02IAP34 GTP-binding protein (Chloroplast Envelope Protein Translocase) Back     alignment and domain information
>KOG0058|consensus Back     alignment and domain information
>cd01891 TypA_BipA TypA (tyrosine phosphorylated protein A)/BipA subfamily Back     alignment and domain information
>PRK09601 GTP-binding protein YchF; Reviewed Back     alignment and domain information
>cd01890 LepA LepA subfamily Back     alignment and domain information
>PRK12317 elongation factor 1-alpha; Reviewed Back     alignment and domain information
>CHL00071 tufA elongation factor Tu Back     alignment and domain information
>PF00009 GTP_EFTU: Elongation factor Tu GTP binding domain; InterPro: IPR000795 Elongation factors belong to a family of proteins that promote the GTP-dependent binding of aminoacyl tRNA to the A site of ribosomes during protein biosynthesis, and catalyse the translocation of the synthesised protein chain from the A to the P site Back     alignment and domain information
>cd01900 YchF YchF subfamily Back     alignment and domain information
>PRK05291 trmE tRNA modification GTPase TrmE; Reviewed Back     alignment and domain information
>cd01852 AIG1 AIG1 (avrRpt2-induced gene 1) Back     alignment and domain information
>PRK00454 engB GTP-binding protein YsxC; Reviewed Back     alignment and domain information
>PRK15494 era GTPase Era; Provisional Back     alignment and domain information
>cd00880 Era_like Era (E Back     alignment and domain information
>PRK04213 GTP-binding protein; Provisional Back     alignment and domain information
>cd01888 eIF2_gamma eIF2-gamma (gamma subunit of initiation factor 2) Back     alignment and domain information
>PRK00089 era GTPase Era; Reviewed Back     alignment and domain information
>KOG1423|consensus Back     alignment and domain information
>PRK09866 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00450 mnmE_trmE_thdF tRNA modification GTPase TrmE Back     alignment and domain information
>cd04142 RRP22 RRP22 subfamily Back     alignment and domain information
>KOG0055|consensus Back     alignment and domain information
>cd01886 EF-G Elongation factor G (EF-G) subfamily Back     alignment and domain information
>cd04160 Arfrp1 Arfrp1 subfamily Back     alignment and domain information
>COG1132 MdlB ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] Back     alignment and domain information
>cd01883 EF1_alpha Eukaryotic elongation factor 1 (EF1) alpha subfamily Back     alignment and domain information
>PF01926 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: IPR002917 Human HSR1, has been localized to the human MHC class I region and is highly homologous to a putative GTP-binding protein, MMR1 from mouse Back     alignment and domain information
>cd01887 IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryotic initiation factor 5B) subfamily Back     alignment and domain information
>cd04164 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein found in bacteria and eukaryotes Back     alignment and domain information
>TIGR02034 CysN sulfate adenylyltransferase, large subunit Back     alignment and domain information
>PRK12299 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>PRK12297 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>PRK12296 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>PRK12735 elongation factor Tu; Reviewed Back     alignment and domain information
>PRK04213 GTP-binding protein; Provisional Back     alignment and domain information
>PRK05506 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Provisional Back     alignment and domain information
>cd01876 YihA_EngB The YihA (EngB) subfamily Back     alignment and domain information
>PRK05124 cysN sulfate adenylyltransferase subunit 1; Provisional Back     alignment and domain information
>PRK10512 selenocysteinyl-tRNA-specific translation factor; Provisional Back     alignment and domain information
>cd01898 Obg Obg subfamily Back     alignment and domain information
>cd01876 YihA_EngB The YihA (EngB) subfamily Back     alignment and domain information
>PLN03127 Elongation factor Tu; Provisional Back     alignment and domain information
>cd01895 EngA2 EngA2 subfamily Back     alignment and domain information
>cd04165 GTPBP1_like GTPBP1-like Back     alignment and domain information
>PRK12736 elongation factor Tu; Reviewed Back     alignment and domain information
>cd01894 EngA1 EngA1 subfamily Back     alignment and domain information
>TIGR00437 feoB ferrous iron transporter FeoB Back     alignment and domain information
>cd01897 NOG NOG1 is a nucleolar GTP-binding protein present in eukaryotes ranging from trypanosomes to humans Back     alignment and domain information
>cd04151 Arl1 Arl1 subfamily Back     alignment and domain information
>cd04124 RabL2 RabL2 subfamily Back     alignment and domain information
>cd01879 FeoB Ferrous iron transport protein B (FeoB) subfamily Back     alignment and domain information
>KOG1489|consensus Back     alignment and domain information
>cd04163 Era Era subfamily Back     alignment and domain information
>cd04157 Arl6 Arl6 subfamily Back     alignment and domain information
>TIGR00485 EF-Tu translation elongation factor TU Back     alignment and domain information
>cd01896 DRG The developmentally regulated GTP-binding protein (DRG) subfamily is an uncharacterized member of the Obg family, an evolutionary branch of GTPase superfamily proteins Back     alignment and domain information
>PRK00049 elongation factor Tu; Reviewed Back     alignment and domain information
>PLN03126 Elongation factor Tu; Provisional Back     alignment and domain information
>PRK09554 feoB ferrous iron transport protein B; Reviewed Back     alignment and domain information
>cd01866 Rab2 Rab2 subfamily Back     alignment and domain information
>TIGR00993 3a0901s04IAP86 chloroplast protein import component Toc86/159, G and M domains Back     alignment and domain information
>smart00175 RAB Rab subfamily of small GTPases Back     alignment and domain information
>TIGR00475 selB selenocysteine-specific elongation factor SelB Back     alignment and domain information
>KOG1490|consensus Back     alignment and domain information
>KOG0055|consensus Back     alignment and domain information
>TIGR02729 Obg_CgtA Obg family GTPase CgtA Back     alignment and domain information
>cd04154 Arl2 Arl2 subfamily Back     alignment and domain information
>cd01878 HflX HflX subfamily Back     alignment and domain information
>COG0370 FeoB Fe2+ transport system protein B [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR02868 CydC thiol reductant ABC exporter, CydC subunit Back     alignment and domain information
>PRK00007 elongation factor G; Reviewed Back     alignment and domain information
>PTZ00265 multidrug resistance protein (mdr1); Provisional Back     alignment and domain information
>cd04119 RJL RJL (RabJ-Like) subfamily Back     alignment and domain information
>cd04169 RF3 RF3 subfamily Back     alignment and domain information
>COG1163 DRG Predicted GTPase [General function prediction only] Back     alignment and domain information
>TIGR01393 lepA GTP-binding protein LepA Back     alignment and domain information
>cd04153 Arl5_Arl8 Arl5/Arl8 subfamily Back     alignment and domain information
>PF04548 AIG1: AIG1 family; InterPro: IPR006703 This entry represents a domain found in Arabidopsis protein AIG1 which appears to be involved in plant resistance to bacteria Back     alignment and domain information
>cd04145 M_R_Ras_like M-Ras/R-Ras-like subfamily Back     alignment and domain information
>PRK09602 translation-associated GTPase; Reviewed Back     alignment and domain information
>cd04159 Arl10_like Arl10-like subfamily Back     alignment and domain information
>TIGR00484 EF-G translation elongation factor EF-G Back     alignment and domain information
>PTZ00327 eukaryotic translation initiation factor 2 gamma subunit; Provisional Back     alignment and domain information
>cd04139 RalA_RalB RalA/RalB subfamily Back     alignment and domain information
>TIGR00483 EF-1_alpha translation elongation factor EF-1 alpha Back     alignment and domain information
>PRK12739 elongation factor G; Reviewed Back     alignment and domain information
>TIGR00231 small_GTP small GTP-binding protein domain Back     alignment and domain information
>PRK05433 GTP-binding protein LepA; Provisional Back     alignment and domain information
>cd00154 Rab Rab family Back     alignment and domain information
>cd01868 Rab11_like Rab11-like Back     alignment and domain information
>cd01861 Rab6 Rab6 subfamily Back     alignment and domain information
>cd01862 Rab7 Rab7 subfamily Back     alignment and domain information
>cd01882 BMS1 Bms1 Back     alignment and domain information
>COG0218 Predicted GTPase [General function prediction only] Back     alignment and domain information
>TIGR03680 eif2g_arch translation initiation factor 2 subunit gamma Back     alignment and domain information
>cd04149 Arf6 Arf6 subfamily Back     alignment and domain information
>cd01869 Rab1_Ypt1 Rab1/Ypt1 subfamily Back     alignment and domain information
>PRK09554 feoB ferrous iron transport protein B; Reviewed Back     alignment and domain information
>cd04168 TetM_like Tet(M)-like subfamily Back     alignment and domain information
>PRK11174 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>cd01863 Rab18 Rab18 subfamily Back     alignment and domain information
>PRK04000 translation initiation factor IF-2 subunit gamma; Validated Back     alignment and domain information
>cd01881 Obg_like The Obg-like subfamily consists of five well-delimited, ancient subfamilies, namely Obg, DRG, YyaF/YchF, Ygr210, and NOG1 Back     alignment and domain information
>cd01896 DRG The developmentally regulated GTP-binding protein (DRG) subfamily is an uncharacterized member of the Obg family, an evolutionary branch of GTPase superfamily proteins Back     alignment and domain information
>cd04113 Rab4 Rab4 subfamily Back     alignment and domain information
>cd01867 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2 Back     alignment and domain information
>KOG0056|consensus Back     alignment and domain information
>TIGR01394 TypA_BipA GTP-binding protein TypA/BipA Back     alignment and domain information
>cd04138 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily Back     alignment and domain information
>cd04156 ARLTS1 ARLTS1 subfamily Back     alignment and domain information
>cd04171 SelB SelB subfamily Back     alignment and domain information
>cd04123 Rab21 Rab21 subfamily Back     alignment and domain information
>smart00178 SAR Sar1p-like members of the Ras-family of small GTPases Back     alignment and domain information
>cd00879 Sar1 Sar1 subfamily Back     alignment and domain information
>COG2274 SunT ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] Back     alignment and domain information
>cd04101 RabL4 RabL4 (Rab-like4) subfamily Back     alignment and domain information
>cd01864 Rab19 Rab19 subfamily Back     alignment and domain information
>cd04127 Rab27A Rab27a subfamily Back     alignment and domain information
>cd01860 Rab5_related Rab5-related subfamily Back     alignment and domain information
>cd01865 Rab3 Rab3 subfamily Back     alignment and domain information
>cd00878 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-like) small GTPases Back     alignment and domain information
>cd01893 Miro1 Miro1 subfamily Back     alignment and domain information
>cd04106 Rab23_lke Rab23-like subfamily Back     alignment and domain information
>TIGR03797 NHPM_micro_ABC2 NHPM bacteriocin system ABC transporter, ATP-binding protein Back     alignment and domain information
>cd04112 Rab26 Rab26 subfamily Back     alignment and domain information
>cd01887 IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryotic initiation factor 5B) subfamily Back     alignment and domain information
>cd04144 Ras2 Ras2 subfamily Back     alignment and domain information
>cd04107 Rab32_Rab38 Rab38/Rab32 subfamily Back     alignment and domain information
>cd04158 ARD1 ARD1 subfamily Back     alignment and domain information
>cd04122 Rab14 Rab14 subfamily Back     alignment and domain information
>COG0370 FeoB Fe2+ transport system protein B [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG4917 EutP Ethanolamine utilization protein [Amino acid transport and metabolism] Back     alignment and domain information
>smart00173 RAS Ras subfamily of RAS small GTPases Back     alignment and domain information
>cd04140 ARHI_like ARHI subfamily Back     alignment and domain information
>cd04136 Rap_like Rap-like subfamily Back     alignment and domain information
>cd04170 EF-G_bact Elongation factor G (EF-G) subfamily Back     alignment and domain information
>cd01899 Ygr210 Ygr210 subfamily Back     alignment and domain information
>cd04118 Rab24 Rab24 subfamily Back     alignment and domain information
>cd04152 Arl4_Arl7 Arl4/Arl7 subfamily Back     alignment and domain information
>cd01885 EF2 EF2 (for archaea and eukarya) Back     alignment and domain information
>TIGR03375 type_I_sec_LssB type I secretion system ATPase, LssB family Back     alignment and domain information
>COG0536 Obg Predicted GTPase [General function prediction only] Back     alignment and domain information
>cd01861 Rab6 Rab6 subfamily Back     alignment and domain information
>cd01851 GBP Guanylate-binding protein (GBP), N-terminal domain Back     alignment and domain information
>cd00882 Ras_like_GTPase Ras-like GTPase superfamily Back     alignment and domain information
>cd00877 Ran Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases Back     alignment and domain information
>cd00157 Rho Rho (Ras homology) family Back     alignment and domain information
>COG3596 Predicted GTPase [General function prediction only] Back     alignment and domain information
>cd04155 Arl3 Arl3 subfamily Back     alignment and domain information
>cd00154 Rab Rab family Back     alignment and domain information
>cd04109 Rab28 Rab28 subfamily Back     alignment and domain information
>TIGR00958 3a01208 Conjugate Transporter-2 (CT2) Family protein Back     alignment and domain information
>TIGR03796 NHPM_micro_ABC1 NHPM bacteriocin system ABC transporter, peptidase/ATP-binding protein Back     alignment and domain information
>KOG1490|consensus Back     alignment and domain information
>cd04147 Ras_dva Ras-dva subfamily Back     alignment and domain information
>PRK10790 putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>cd04104 p47_IIGP_like p47 (47-kDa) family Back     alignment and domain information
>cd01863 Rab18 Rab18 subfamily Back     alignment and domain information
>cd04155 Arl3 Arl3 subfamily Back     alignment and domain information
>cd04110 Rab35 Rab35 subfamily Back     alignment and domain information
>CHL00189 infB translation initiation factor 2; Provisional Back     alignment and domain information
>PRK10218 GTP-binding protein; Provisional Back     alignment and domain information
>PRK05306 infB translation initiation factor IF-2; Validated Back     alignment and domain information
>cd04132 Rho4_like Rho4-like subfamily Back     alignment and domain information
>PLN03118 Rab family protein; Provisional Back     alignment and domain information
>TIGR01193 bacteriocin_ABC ABC-type bacteriocin transporter Back     alignment and domain information
>PLN03130 ABC transporter C family member; Provisional Back     alignment and domain information
>cd04146 RERG_RasL11_like RERG/RasL11-like subfamily Back     alignment and domain information
>cd01860 Rab5_related Rab5-related subfamily Back     alignment and domain information
>cd04125 RabA_like RabA-like subfamily Back     alignment and domain information
>cd04154 Arl2 Arl2 subfamily Back     alignment and domain information
>cd04166 CysN_ATPS CysN_ATPS subfamily Back     alignment and domain information
>PRK13768 GTPase; Provisional Back     alignment and domain information
>COG0012 Predicted GTPase, probable translation factor [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd04150 Arf1_5_like Arf1-Arf5-like subfamily Back     alignment and domain information
>PLN03118 Rab family protein; Provisional Back     alignment and domain information
>cd04126 Rab20 Rab20 subfamily Back     alignment and domain information
>cd04175 Rap1 Rap1 subgroup Back     alignment and domain information
>TIGR00231 small_GTP small GTP-binding protein domain Back     alignment and domain information
>cd01899 Ygr210 Ygr210 subfamily Back     alignment and domain information
>PLN00223 ADP-ribosylation factor; Provisional Back     alignment and domain information
>cd04161 Arl2l1_Arl13_like Arl2l1/Arl13 subfamily Back     alignment and domain information
>TIGR02857 CydD thiol reductant ABC exporter, CydD subunit Back     alignment and domain information
>TIGR00491 aIF-2 translation initiation factor aIF-2/yIF-2 Back     alignment and domain information
>cd00880 Era_like Era (E Back     alignment and domain information
>PTZ00141 elongation factor 1- alpha; Provisional Back     alignment and domain information
>PRK11176 lipid transporter ATP-binding/permease protein; Provisional Back     alignment and domain information
>cd01866 Rab2 Rab2 subfamily Back     alignment and domain information
>TIGR00957 MRP_assoc_pro multi drug resistance-associated protein (MRP) Back     alignment and domain information
>COG1163 DRG Predicted GTPase [General function prediction only] Back     alignment and domain information
>TIGR00487 IF-2 translation initiation factor IF-2 Back     alignment and domain information
>KOG1489|consensus Back     alignment and domain information
>smart00177 ARF ARF-like small GTPases; ARF, ADP-ribosylation factor Back     alignment and domain information
>COG0536 Obg Predicted GTPase [General function prediction only] Back     alignment and domain information
>TIGR00092 GTP-binding protein YchF Back     alignment and domain information
>cd01868 Rab11_like Rab11-like Back     alignment and domain information
>PTZ00133 ADP-ribosylation factor; Provisional Back     alignment and domain information
>PRK11160 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>PTZ00243 ABC transporter; Provisional Back     alignment and domain information
>TIGR02836 spore_IV_A stage IV sporulation protein A Back     alignment and domain information
>PLN03232 ABC transporter C family member; Provisional Back     alignment and domain information
>smart00174 RHO Rho (Ras homology) subfamily of Ras-like small GTPases Back     alignment and domain information
>cd00876 Ras Ras family Back     alignment and domain information
>PLN00043 elongation factor 1-alpha; Provisional Back     alignment and domain information
>cd04156 ARLTS1 ARLTS1 subfamily Back     alignment and domain information
>cd01867 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2 Back     alignment and domain information
>cd01889 SelB_euk SelB subfamily Back     alignment and domain information
>PLN03110 Rab GTPase; Provisional Back     alignment and domain information
>cd04114 Rab30 Rab30 subfamily Back     alignment and domain information
>cd04115 Rab33B_Rab33A Rab33B/Rab33A subfamily Back     alignment and domain information
>cd04141 Rit_Rin_Ric Rit/Rin/Ric subfamily Back     alignment and domain information
>PLN03108 Rab family protein; Provisional Back     alignment and domain information
>PTZ00369 Ras-like protein; Provisional Back     alignment and domain information
>PRK00741 prfC peptide chain release factor 3; Provisional Back     alignment and domain information
>cd04162 Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily Back     alignment and domain information
>cd04143 Rhes_like Rhes_like subfamily Back     alignment and domain information
>cd04153 Arl5_Arl8 Arl5/Arl8 subfamily Back     alignment and domain information
>cd04157 Arl6 Arl6 subfamily Back     alignment and domain information
>PRK15467 ethanolamine utilization protein EutP; Provisional Back     alignment and domain information
>smart00175 RAB Rab subfamily of small GTPases Back     alignment and domain information
>cd00881 GTP_translation_factor GTP translation factor family Back     alignment and domain information
>PRK13657 cyclic beta-1,2-glucan ABC transporter; Provisional Back     alignment and domain information
>TIGR01846 type_I_sec_HlyB type I secretion system ABC transporter, HlyB family Back     alignment and domain information
>cd04119 RJL RJL (RabJ-Like) subfamily Back     alignment and domain information
>cd04176 Rap2 Rap2 subgroup Back     alignment and domain information
>cd01853 Toc34_like Toc34-like (Translocon at the Outer-envelope membrane of Chloroplasts) Back     alignment and domain information
>TIGR00437 feoB ferrous iron transporter FeoB Back     alignment and domain information
>KOG1491|consensus Back     alignment and domain information
>cd00878 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-like) small GTPases Back     alignment and domain information
>cd04116 Rab9 Rab9 subfamily Back     alignment and domain information
>cd04148 RGK RGK subfamily Back     alignment and domain information
>cd04145 M_R_Ras_like M-Ras/R-Ras-like subfamily Back     alignment and domain information
>cd04167 Snu114p Snu114p subfamily Back     alignment and domain information
>TIGR02203 MsbA_lipidA lipid A export permease/ATP-binding protein MsbA Back     alignment and domain information
>KOG2486|consensus Back     alignment and domain information
>cd01862 Rab7 Rab7 subfamily Back     alignment and domain information
>cd04113 Rab4 Rab4 subfamily Back     alignment and domain information
>cd01864 Rab19 Rab19 subfamily Back     alignment and domain information
>TIGR00503 prfC peptide chain release factor 3 Back     alignment and domain information
>cd01892 Miro2 Miro2 subfamily Back     alignment and domain information
>cd01890 LepA LepA subfamily Back     alignment and domain information
>COG5265 ATM1 ABC-type transport system involved in Fe-S cluster assembly, permease and ATPase components [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00178 SAR Sar1p-like members of the Ras-family of small GTPases Back     alignment and domain information
>PLN03071 GTP-binding nuclear protein Ran; Provisional Back     alignment and domain information
>cd04111 Rab39 Rab39 subfamily Back     alignment and domain information
>cd01850 CDC_Septin CDC/Septin Back     alignment and domain information
>PTZ00258 GTP-binding protein; Provisional Back     alignment and domain information
>cd01865 Rab3 Rab3 subfamily Back     alignment and domain information
>cd04118 Rab24 Rab24 subfamily Back     alignment and domain information
>cd04160 Arfrp1 Arfrp1 subfamily Back     alignment and domain information
>smart00053 DYNc Dynamin, GTPase Back     alignment and domain information
>cd01869 Rab1_Ypt1 Rab1/Ypt1 subfamily Back     alignment and domain information
>cd04177 RSR1 RSR1 subgroup Back     alignment and domain information
>cd04151 Arl1 Arl1 subfamily Back     alignment and domain information
>cd01891 TypA_BipA TypA (tyrosine phosphorylated protein A)/BipA subfamily Back     alignment and domain information
>KOG0462|consensus Back     alignment and domain information
>cd04149 Arf6 Arf6 subfamily Back     alignment and domain information
>PRK12317 elongation factor 1-alpha; Reviewed Back     alignment and domain information
>cd04138 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily Back     alignment and domain information
>PF00350 Dynamin_N: Dynamin family; InterPro: IPR001401 Membrane transport between compartments in eukaryotic cells requires proteins that allow the budding and scission of nascent cargo vesicles from one compartment and their targeting and fusion with another Back     alignment and domain information
>PRK12740 elongation factor G; Reviewed Back     alignment and domain information
>cd04135 Tc10 TC10 subfamily Back     alignment and domain information
>cd04159 Arl10_like Arl10-like subfamily Back     alignment and domain information
>cd04152 Arl4_Arl7 Arl4/Arl7 subfamily Back     alignment and domain information
>COG4988 CydD ABC-type transport system involved in cytochrome bd biosynthesis, ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02204 MsbA_rel ABC transporter, permease/ATP-binding protein Back     alignment and domain information
>TIGR01271 CFTR_protein cystic fibrosis transmembrane conductor regulator (CFTR) Back     alignment and domain information
>PTZ00099 rab6; Provisional Back     alignment and domain information
>cd01884 EF_Tu EF-Tu subfamily Back     alignment and domain information
>cd04110 Rab35 Rab35 subfamily Back     alignment and domain information
>cd04121 Rab40 Rab40 subfamily Back     alignment and domain information
>PRK13351 elongation factor G; Reviewed Back     alignment and domain information
>cd01870 RhoA_like RhoA-like subfamily Back     alignment and domain information
>cd00879 Sar1 Sar1 subfamily Back     alignment and domain information
>cd04161 Arl2l1_Arl13_like Arl2l1/Arl13 subfamily Back     alignment and domain information
>PRK04004 translation initiation factor IF-2; Validated Back     alignment and domain information
>PRK09601 GTP-binding protein YchF; Reviewed Back     alignment and domain information
>cd04137 RheB Rheb (Ras Homolog Enriched in Brain) subfamily Back     alignment and domain information
>cd00876 Ras Ras family Back     alignment and domain information
>cd04130 Wrch_1 Wrch-1 subfamily Back     alignment and domain information
>cd04142 RRP22 RRP22 subfamily Back     alignment and domain information
>cd04137 RheB Rheb (Ras Homolog Enriched in Brain) subfamily Back     alignment and domain information
>cd04112 Rab26 Rab26 subfamily Back     alignment and domain information
>smart00173 RAS Ras subfamily of RAS small GTPases Back     alignment and domain information
>TIGR02528 EutP ethanolamine utilization protein, EutP Back     alignment and domain information
>cd04123 Rab21 Rab21 subfamily Back     alignment and domain information
>cd04106 Rab23_lke Rab23-like subfamily Back     alignment and domain information
>cd04139 RalA_RalB RalA/RalB subfamily Back     alignment and domain information
>cd00157 Rho Rho (Ras homology) family Back     alignment and domain information
>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK10789 putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>PF05049 IIGP: Interferon-inducible GTPase (IIGP); InterPro: IPR007743 Interferon-inducible GTPase (IIGP) is thought to play a role in in intracellular defence Back     alignment and domain information
>KOG0054|consensus Back     alignment and domain information
>cd04115 Rab33B_Rab33A Rab33B/Rab33A subfamily Back     alignment and domain information
>cd01893 Miro1 Miro1 subfamily Back     alignment and domain information
>TIGR01842 type_I_sec_PrtD type I secretion system ABC transporter, PrtD family Back     alignment and domain information
>cd04122 Rab14 Rab14 subfamily Back     alignment and domain information
>cd04125 RabA_like RabA-like subfamily Back     alignment and domain information
>CHL00071 tufA elongation factor Tu Back     alignment and domain information
>cd04136 Rap_like Rap-like subfamily Back     alignment and domain information
>cd04177 RSR1 RSR1 subgroup Back     alignment and domain information
>PTZ00416 elongation factor 2; Provisional Back     alignment and domain information
>cd01900 YchF YchF subfamily Back     alignment and domain information
>PRK09602 translation-associated GTPase; Reviewed Back     alignment and domain information
>cd04140 ARHI_like ARHI subfamily Back     alignment and domain information
>cd04175 Rap1 Rap1 subgroup Back     alignment and domain information
>cd04124 RabL2 RabL2 subfamily Back     alignment and domain information
>cd04128 Spg1 Spg1p Back     alignment and domain information
>PLN00116 translation elongation factor EF-2 subunit; Provisional Back     alignment and domain information
>KOG0410|consensus Back     alignment and domain information
>cd04135 Tc10 TC10 subfamily Back     alignment and domain information
>TIGR01192 chvA glucan exporter ATP-binding protein Back     alignment and domain information
>cd04120 Rab12 Rab12 subfamily Back     alignment and domain information
>cd04108 Rab36_Rab34 Rab34/Rab36 subfamily Back     alignment and domain information
>PTZ00133 ADP-ribosylation factor; Provisional Back     alignment and domain information
>TIGR00487 IF-2 translation initiation factor IF-2 Back     alignment and domain information
>PLN03110 Rab GTPase; Provisional Back     alignment and domain information
>cd04134 Rho3 Rho3 subfamily Back     alignment and domain information
>cd04174 Rnd1_Rho6 Rnd1/Rho6 subfamily Back     alignment and domain information
>cd04116 Rab9 Rab9 subfamily Back     alignment and domain information
>cd01873 RhoBTB RhoBTB subfamily Back     alignment and domain information
>PRK12735 elongation factor Tu; Reviewed Back     alignment and domain information
>cd04172 Rnd3_RhoE_Rho8 Rnd3/RhoE/Rho8 subfamily Back     alignment and domain information
>cd04150 Arf1_5_like Arf1-Arf5-like subfamily Back     alignment and domain information
>cd01871 Rac1_like Rac1-like subfamily Back     alignment and domain information
>cd04114 Rab30 Rab30 subfamily Back     alignment and domain information
>cd04176 Rap2 Rap2 subgroup Back     alignment and domain information
>cd04131 Rnd Rnd subfamily Back     alignment and domain information
>COG4987 CydC ABC-type transport system involved in cytochrome bd biosynthesis, fused ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd04101 RabL4 RabL4 (Rab-like4) subfamily Back     alignment and domain information
>cd04158 ARD1 ARD1 subfamily Back     alignment and domain information
>cd04132 Rho4_like Rho4-like subfamily Back     alignment and domain information
>cd00877 Ran Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases Back     alignment and domain information
>COG2895 CysN GTPases - Sulfate adenylate transferase subunit 1 [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR00490 aEF-2 translation elongation factor aEF-2 Back     alignment and domain information
>COG1117 PstB ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF08477 Miro: Miro-like protein; InterPro: IPR013684 Mitochondrial Rho proteins (Miro-1, Q8IXI2 from SWISSPROT and Miro-2, Q8IXI1 from SWISSPROT) are atypical Rho GTPases Back     alignment and domain information
>cd04127 Rab27A Rab27a subfamily Back     alignment and domain information
>cd04104 p47_IIGP_like p47 (47-kDa) family Back     alignment and domain information
>PF00735 Septin: Septin; InterPro: IPR000038 Septins constitute a eukaryotic family of guanine nucleotide-binding proteins, most of which polymerise to form filaments [] Back     alignment and domain information
>smart00176 RAN Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases Back     alignment and domain information
>cd04144 Ras2 Ras2 subfamily Back     alignment and domain information
>cd04105 SR_beta Signal recognition particle receptor, beta subunit (SR-beta) Back     alignment and domain information
>cd04109 Rab28 Rab28 subfamily Back     alignment and domain information
>PRK05306 infB translation initiation factor IF-2; Validated Back     alignment and domain information
>cd04117 Rab15 Rab15 subfamily Back     alignment and domain information
>cd01850 CDC_Septin CDC/Septin Back     alignment and domain information
>PLN03127 Elongation factor Tu; Provisional Back     alignment and domain information
>smart00177 ARF ARF-like small GTPases; ARF, ADP-ribosylation factor Back     alignment and domain information
>COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] Back     alignment and domain information
>PTZ00369 Ras-like protein; Provisional Back     alignment and domain information
>cd04111 Rab39 Rab39 subfamily Back     alignment and domain information
>PLN00223 ADP-ribosylation factor; Provisional Back     alignment and domain information
>COG1217 TypA Predicted membrane GTPase involved in stress response [Signal transduction mechanisms] Back     alignment and domain information
>cd01886 EF-G Elongation factor G (EF-G) subfamily Back     alignment and domain information
>PLN03071 GTP-binding nuclear protein Ran; Provisional Back     alignment and domain information
>COG1135 AbcC ABC-type metal ion transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd00882 Ras_like_GTPase Ras-like GTPase superfamily Back     alignment and domain information
>PRK07560 elongation factor EF-2; Reviewed Back     alignment and domain information
>cd04107 Rab32_Rab38 Rab38/Rab32 subfamily Back     alignment and domain information
>smart00174 RHO Rho (Ras homology) subfamily of Ras-like small GTPases Back     alignment and domain information
>TIGR00993 3a0901s04IAP86 chloroplast protein import component Toc86/159, G and M domains Back     alignment and domain information
>cd04148 RGK RGK subfamily Back     alignment and domain information
>TIGR00991 3a0901s02IAP34 GTP-binding protein (Chloroplast Envelope Protein Translocase) Back     alignment and domain information
>cd04146 RERG_RasL11_like RERG/RasL11-like subfamily Back     alignment and domain information
>PLN03108 Rab family protein; Provisional Back     alignment and domain information
>CHL00189 infB translation initiation factor 2; Provisional Back     alignment and domain information
>PRK00049 elongation factor Tu; Reviewed Back     alignment and domain information
>KOG1145|consensus Back     alignment and domain information
>COG0481 LepA Membrane GTPase LepA [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PF10662 PduV-EutP: Ethanolamine utilisation - propanediol utilisation; InterPro: IPR012381 Members of this family function in ethanolamine [] and propanediol [] degradation pathways Back     alignment and domain information
>TIGR00491 aIF-2 translation initiation factor aIF-2/yIF-2 Back     alignment and domain information
>cd04108 Rab36_Rab34 Rab34/Rab36 subfamily Back     alignment and domain information
>PF00025 Arf: ADP-ribosylation factor family The prints entry specific to Sar1 proteins The Prosite entry specific to Sar1 proteins; InterPro: IPR006689 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases Back     alignment and domain information
>cd01874 Cdc42 Cdc42 subfamily Back     alignment and domain information
>PRK14845 translation initiation factor IF-2; Provisional Back     alignment and domain information
>cd04170 EF-G_bact Elongation factor G (EF-G) subfamily Back     alignment and domain information
>cd01870 RhoA_like RhoA-like subfamily Back     alignment and domain information
>PTZ00132 GTP-binding nuclear protein Ran; Provisional Back     alignment and domain information
>cd04117 Rab15 Rab15 subfamily Back     alignment and domain information
>cd01875 RhoG RhoG subfamily Back     alignment and domain information
>PRK05506 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Provisional Back     alignment and domain information
>COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd04126 Rab20 Rab20 subfamily Back     alignment and domain information
>TIGR00475 selB selenocysteine-specific elongation factor SelB Back     alignment and domain information
>KOG1486|consensus Back     alignment and domain information
>TIGR00485 EF-Tu translation elongation factor TU Back     alignment and domain information
>cd04133 Rop_like Rop subfamily Back     alignment and domain information
>cd04173 Rnd2_Rho7 Rnd2/Rho7 subfamily Back     alignment and domain information
>cd01882 BMS1 Bms1 Back     alignment and domain information
>cd04141 Rit_Rin_Ric Rit/Rin/Ric subfamily Back     alignment and domain information
>cd04129 Rho2 Rho2 subfamily Back     alignment and domain information
>KOG1547|consensus Back     alignment and domain information
>cd04147 Ras_dva Ras-dva subfamily Back     alignment and domain information
>cd04168 TetM_like Tet(M)-like subfamily Back     alignment and domain information
>cd04162 Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily Back     alignment and domain information
>PRK04004 translation initiation factor IF-2; Validated Back     alignment and domain information
>cd04105 SR_beta Signal recognition particle receptor, beta subunit (SR-beta) Back     alignment and domain information
>PTZ00265 multidrug resistance protein (mdr1); Provisional Back     alignment and domain information
>PTZ00132 GTP-binding nuclear protein Ran; Provisional Back     alignment and domain information
>COG4618 ArpD ABC-type protease/lipase transport system, ATPase and permease components [General function prediction only] Back     alignment and domain information
>PRK10522 multidrug transporter membrane component/ATP-binding component; Provisional Back     alignment and domain information
>cd01874 Cdc42 Cdc42 subfamily Back     alignment and domain information
>cd01892 Miro2 Miro2 subfamily Back     alignment and domain information
>COG0532 InfB Translation initiation factor 2 (IF-2; GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd04134 Rho3 Rho3 subfamily Back     alignment and domain information
>TIGR01194 cyc_pep_trnsptr cyclic peptide transporter Back     alignment and domain information
>PRK12736 elongation factor Tu; Reviewed Back     alignment and domain information
>TIGR00484 EF-G translation elongation factor EF-G Back     alignment and domain information
>TIGR02836 spore_IV_A stage IV sporulation protein A Back     alignment and domain information
>COG1100 GTPase SAR1 and related small G proteins [General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query595
3cnl_A262 Crystal Structure Of Gnp-Bound Ylqf From T. Maritim 2e-08
3pqc_A195 Crystal Structure Of Thermotoga Maritima Ribosome B 3e-06
1puj_A282 Structure Of B. Subtilis Ylqf Gtpase Length = 282 3e-06
1sul_A195 Crystal Structure Of The Apo-Ysxc Length = 195 4e-06
4dcs_A456 Crystal Structure Of B. Subtilis Enga In Complex Wi 5e-05
1mky_A439 Structural Analysis Of The Domain Interactions In D 1e-04
2hjg_A436 The Crystal Structure Of The B. Subtilis Yphc Gtpas 2e-04
>pdb|3CNL|A Chain A, Crystal Structure Of Gnp-Bound Ylqf From T. Maritima Length = 262 Back     alignment and structure 
Iteration: 1

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 41/155 (26%), Positives = 69/155 (44%), Gaps = 23/155 (14%)
Query: 327 LVGYPNVGKSSTINALLNAKKVSVSATPGKTKHFQTLFVDDELLLCDCPGLVMPSFVFSK 386
           +VG PN GKS+ IN L   +  SV A PG TK  Q   +++ + + D PG++  + +FS+
Sbjct: 104 IVGVPNTGKSTIINKLKGKRASSVGAQPGITKGIQWFSLENGVKILDTPGILYKN-IFSE 162
Query: 387 ---ADMILNGILPIDQMRDHVPAVNMLCTLVPRHVLENIYGIMITQPDEGEDPNRPPFSE 443
              A ++L G LP++++ D               + E  + I       G + +   F E
Sbjct: 163 DLAAKLLLVGSLPVERIEDQ-------------RIFERAFEIFARSI--GIESSFSEFFE 207
Query: 444 ELCNAYGYNRGFMTSNGQPDNPRSARYILKDFVNG 478
           +    +   RG +   G PD  R+      +   G
Sbjct: 208 D----FARKRGLLKKGGVPDIERALMLFFTEVAQG 238
>pdb|3PQC|A Chain A, Crystal Structure Of Thermotoga Maritima Ribosome Biogenesis Gtp- Binding Protein Engb (YsxcYIHA) IN COMPLEX WITH GDP Length = 195 Back     alignment and structure
>pdb|1PUJ|A Chain A, Structure Of B. Subtilis Ylqf Gtpase Length = 282 Back     alignment and structure
>pdb|1SUL|A Chain A, Crystal Structure Of The Apo-Ysxc Length = 195 Back     alignment and structure
>pdb|4DCS|A Chain A, Crystal Structure Of B. Subtilis Enga In Complex With Sulfate Ion And Gdp Length = 456 Back     alignment and structure
>pdb|1MKY|A Chain A, Structural Analysis Of The Domain Interactions In Der, A Switch Protein Containing Two Gtpase Domains Length = 439 Back     alignment and structure
>pdb|2HJG|A Chain A, The Crystal Structure Of The B. Subtilis Yphc Gtpase In Complex With Gdp Length = 436 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query595
1puj_A282 YLQF, conserved hypothetical protein YLQF; structu 3e-40
3cnl_A262 YLQF, putative uncharacterized protein; circular p 1e-21
3cnl_A262 YLQF, putative uncharacterized protein; circular p 2e-12
3h2y_A368 GTPase family protein; GTP-binding protein YQEH, p 4e-19
3ec1_A369 YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase 2e-18
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-13
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-09
3def_A262 T7I23.11 protein; chloroplast, TOC33, GTPase, hydr 2e-10
3pqc_A195 Probable GTP-binding protein ENGB; rossmann fold, 2e-10
1svi_A195 GTP-binding protein YSXC; ENGB, GTPase, GDP, hydro 4e-10
1pui_A210 ENGB, probable GTP-binding protein ENGB; structura 1e-09
2cxx_A190 Probable GTP-binding protein ENGB; structural geno 4e-09
1tq4_A413 IIGP1, interferon-inducible GTPase; interferon gam 2e-08
1h65_A270 Chloroplast outer envelope protein OEP34; GTPase, 7e-08
4dhe_A223 Probable GTP-binding protein ENGB; melioidosis, RA 7e-08
2qu8_A228 Putative nucleolar GTP-binding protein 1; GTPase, 2e-07
1xzp_A482 Probable tRNA modification GTPase TRME; GTP-bindin 3e-06
1xzp_A482 Probable tRNA modification GTPase TRME; GTP-bindin 4e-05
3gee_A476 MNME, tRNA modification GTPase MNME; G protein, cy 5e-06
3gee_A476 MNME, tRNA modification GTPase MNME; G protein, cy 7e-05
3qq5_A 423 Small GTP-binding protein; hydrogenase, H-cluster, 6e-06
3geh_A462 MNME, tRNA modification GTPase MNME; G protein, U3 1e-05
3geh_A462 MNME, tRNA modification GTPase MNME; G protein, U3 1e-04
2hjg_A436 GTP-binding protein ENGA; GTPase ENGA KH-domain, h 2e-05
2gj8_A172 MNME, tRNA modification GTPase TRME; G-domain dime 3e-05
2gj8_A172 MNME, tRNA modification GTPase TRME; G-domain dime 7e-04
1mky_A439 Probable GTP-binding protein ENGA; GTPase, DER, KH 4e-05
1wxq_A 397 GTP-binding protein; structural genomics, riken st 2e-04
2ohf_A 396 Protein OLA1, GTP-binding protein 9; ATPase, GTPas 4e-04
1udx_A416 The GTP-binding protein OBG; TGS domain, riken str 4e-04
1ni3_A392 YCHF GTPase, YCHF GTP-binding protein; structural 5e-04
2e87_A357 Hypothetical protein PH1320; GTP-binding, GTPase, 5e-04
1ega_A301 Protein (GTP-binding protein ERA); GTPase, RNA-bin 6e-04
2dby_A368 GTP-binding protein; GDP, structural genomics, NPP 7e-04
2wji_A165 Ferrous iron transport protein B homolog; membrane 8e-04
2wjg_A188 FEOB, ferrous iron transport protein B homolog; me 8e-04
>1puj_A YLQF, conserved hypothetical protein YLQF; structural genomics, nysgxrc T18, GTPase, PSI, protein structure initiative; HET: GNP; 2.00A {Bacillus subtilis} SCOP: c.37.1.8 Length = 282 Back     alignment and structure
 Score =  147 bits (372), Expect = 3e-40
 Identities = 68/323 (21%), Positives = 110/323 (34%), Gaps = 68/323 (21%)

Query: 162 WRQLWRVIERSDVIVQIVDARNPLLFRCEDLERYVKEVSPHKRNMILLNKADLLTRKQRC 221
            R++   ++  D++ ++VDAR P+  R   +E  +K    +K  ++LLNKAD        
Sbjct: 14  RREVTEKLKLIDIVYELVDARIPMSSRNPMIEDILK----NKPRIMLLNKADKADAAVTQ 69

Query: 222 YWTKYFNSVNVAVAFFSATNIYDDIPEGDEELEDEVVSEESESDESEWEDISEEEEEDDG 281
            W ++F +  +     ++ N                                       G
Sbjct: 70  QWKEHFENQGIRSLSINSVN-------------------------------------GQG 92

Query: 282 QKVLENDLKIKSSPKLLNREELISLFKSFHDVNIPRMNPDVMTIGLVGYPNVGKSSTINA 341
              +    K     K                     + P  +   ++G PNVGKS+ IN 
Sbjct: 93  LNQIVPASKEILQEKFDRMRA-------------KGVKPRAIRALIIGIPNVGKSTLINR 139

Query: 342 LLNAKKVSVSATPGKTKHFQTLFVDDELLLCDCPGLVMPSFVFSKADMIL--NGILPIDQ 399
           L           PG T   Q + V  EL L D PG++ P F      + L   G +    
Sbjct: 140 LAKKNIAKTGDRPGITTSQQWVKVGKELELLDTPGILWPKFEDELVGLRLAVTGAIKDSI 199

Query: 400 MRDHVPAVNMLCTL--VPRHVLENIYGIMITQPDEGEDPNRPPFSEELCNAYGYNRGFMT 457
           +     AV  L  L       L+  YG+     +  ED        EL +A G  RG + 
Sbjct: 200 INLQDVAVFGLRFLEEHYPERLKERYGL----DEIPEDI------AELFDAIGEKRGCLM 249

Query: 458 SNGQPDNPRSARYILKDFVNGHL 480
           S G  +  ++   I++D      
Sbjct: 250 SGGLINYDKTTEVIIRDIRTEKF 272
>3cnl_A YLQF, putative uncharacterized protein; circular permutation, GNP, signaling protein; HET: GNP; 2.00A {Thermotoga maritima} PDB: 3cnn_A* 3cno_A* Length = 262 Back     alignment and structure
>3cnl_A YLQF, putative uncharacterized protein; circular permutation, GNP, signaling protein; HET: GNP; 2.00A {Thermotoga maritima} PDB: 3cnn_A* 3cno_A* Length = 262 Back     alignment and structure
>3h2y_A GTPase family protein; GTP-binding protein YQEH, possibly involved in replication initiation, csgid, IDP90222; HET: DGI; 1.80A {Bacillus anthracis str} Length = 368 Back     alignment and structure
>3ec1_A YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase, signaling protein; HET: GDP; 2.36A {Geobacillus stearothermophilus} Length = 369 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3def_A T7I23.11 protein; chloroplast, TOC33, GTPase, hydrolase; HET: GDP; 1.96A {Arabidopsis thaliana} PDB: 3bb3_A* 3bb4_A* 2j3e_A* Length = 262 Back     alignment and structure
>3pqc_A Probable GTP-binding protein ENGB; rossmann fold, GTPase, cell cycle, hydrolase; HET: GDP; 1.90A {Thermotoga maritima} PDB: 3pr1_A Length = 195 Back     alignment and structure
>1svi_A GTP-binding protein YSXC; ENGB, GTPase, GDP, hydrolase; HET: GDP; 1.95A {Bacillus subtilis} SCOP: c.37.1.8 PDB: 1sul_A* 1svw_A* Length = 195 Back     alignment and structure
>1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8 Length = 210 Back     alignment and structure
>2cxx_A Probable GTP-binding protein ENGB; structural genomics, NPPSFA, national P protein structural and functional analyses; HET: GDP; 1.70A {Pyrococcus horikoshii} SCOP: c.37.1.8 Length = 190 Back     alignment and structure
>1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A* Length = 413 Back     alignment and structure
>1h65_A Chloroplast outer envelope protein OEP34; GTPase, translocon; HET: GDP; 2.0A {Pisum sativum} SCOP: c.37.1.8 PDB: 3bb1_A* Length = 270 Back     alignment and structure
>4dhe_A Probable GTP-binding protein ENGB; melioidosis, RAS-like GTPase, cell division, cell cycle, SEP GTP-binding; 2.20A {Burkholderia thailandensis} Length = 223 Back     alignment and structure
>2qu8_A Putative nucleolar GTP-binding protein 1; GTPase, malaria, structural genomics, structural genomics consortium, SGC, unknown function; HET: GDP; 2.01A {Plasmodium falciparum} Length = 228 Back     alignment and structure
>1xzp_A Probable tRNA modification GTPase TRME; GTP-binding, THF-binding, hydrolase; 2.30A {Thermotoga maritima} SCOP: a.24.25.1 c.37.1.8 d.250.1.2 PDB: 1xzq_A* 1xzp_B 1xzq_B* Length = 482 Back     alignment and structure
>1xzp_A Probable tRNA modification GTPase TRME; GTP-binding, THF-binding, hydrolase; 2.30A {Thermotoga maritima} SCOP: a.24.25.1 c.37.1.8 d.250.1.2 PDB: 1xzq_A* 1xzp_B 1xzq_B* Length = 482 Back     alignment and structure
>3gee_A MNME, tRNA modification GTPase MNME; G protein, cytoplasm, GTP- binding, hydrolase, magnesium, metal-binding, nucleotide- binding, potassium; HET: GDP FON; 2.95A {Chlorobium tepidum} PDB: 3gei_A* Length = 476 Back     alignment and structure
>3gee_A MNME, tRNA modification GTPase MNME; G protein, cytoplasm, GTP- binding, hydrolase, magnesium, metal-binding, nucleotide- binding, potassium; HET: GDP FON; 2.95A {Chlorobium tepidum} PDB: 3gei_A* Length = 476 Back     alignment and structure
>3qq5_A Small GTP-binding protein; hydrogenase, H-cluster, HYDA maturation, GTP-binding domain, maturation enzyme, oxidoreductase; 2.99A {Thermotoga neapolitana} Length = 423 Back     alignment and structure
>3geh_A MNME, tRNA modification GTPase MNME; G protein, U34, GTP-binding, HYDR magnesium, metal-binding, nucleotide-binding, potassium, TR processing; HET: GDP FON; 3.20A {Nostoc SP} Length = 462 Back     alignment and structure
>3geh_A MNME, tRNA modification GTPase MNME; G protein, U34, GTP-binding, HYDR magnesium, metal-binding, nucleotide-binding, potassium, TR processing; HET: GDP FON; 3.20A {Nostoc SP} Length = 462 Back     alignment and structure
>2hjg_A GTP-binding protein ENGA; GTPase ENGA KH-domain, hydrolase; HET: GDP; 2.50A {Bacillus subtilis} Length = 436 Back     alignment and structure
>2gj8_A MNME, tRNA modification GTPase TRME; G-domain dimer, alpha-beta-sandwich, hydrolase; HET: GDP; 1.70A {Escherichia coli BL21} SCOP: c.37.1.8 PDB: 2gj9_A* 2gja_A* 1rfl_A Length = 172 Back     alignment and structure
>2gj8_A MNME, tRNA modification GTPase TRME; G-domain dimer, alpha-beta-sandwich, hydrolase; HET: GDP; 1.70A {Escherichia coli BL21} SCOP: c.37.1.8 PDB: 2gj9_A* 2gja_A* 1rfl_A Length = 172 Back     alignment and structure
>1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1 Length = 439 Back     alignment and structure
>1wxq_A GTP-binding protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; 2.60A {Pyrococcus horikoshii} SCOP: c.37.1.8 d.15.10.2 Length = 397 Back     alignment and structure
>2ohf_A Protein OLA1, GTP-binding protein 9; ATPase, GTPase, P-loop, OBG-like, hydrolase; HET: ACP; 2.70A {Homo sapiens} Length = 396 Back     alignment and structure
>1udx_A The GTP-binding protein OBG; TGS domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.07A {Thermus thermophilus} SCOP: b.117.1.1 c.37.1.8 d.242.1.1 Length = 416 Back     alignment and structure
>1ni3_A YCHF GTPase, YCHF GTP-binding protein; structural genomics, GTP1OBG, PSI, protein structure initiative; 2.80A {Schizosaccharomyces pombe} SCOP: c.37.1.8 d.15.10.2 Length = 392 Back     alignment and structure
>2e87_A Hypothetical protein PH1320; GTP-binding, GTPase, OBG, bundle, GDP, complex, structural G NPPSFA; HET: GDP; 2.35A {Pyrococcus horikoshii} Length = 357 Back     alignment and structure
>1ega_A Protein (GTP-binding protein ERA); GTPase, RNA-binding, RAS-like, hydrolase; 2.40A {Escherichia coli} SCOP: c.37.1.8 d.52.3.1 PDB: 1x1l_X 3ieu_A* 1x18_X Length = 301 Back     alignment and structure
>2dby_A GTP-binding protein; GDP, structural genomics, NPPSFA, natio project on protein structural and functional analyses; HET: GDP; 1.76A {Thermus thermophilus} PDB: 2dwq_A Length = 368 Back     alignment and structure
>2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A* Length = 165 Back     alignment and structure
>2wjg_A FEOB, ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GDP; 2.20A {Methanocaldococcus jannaschii} Length = 188 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query595
1puj_A282 YLQF, conserved hypothetical protein YLQF; structu 100.0
3cnl_A262 YLQF, putative uncharacterized protein; circular p 100.0
1mky_A439 Probable GTP-binding protein ENGA; GTPase, DER, KH 99.91
2hjg_A436 GTP-binding protein ENGA; GTPase ENGA KH-domain, h 99.89
4dcu_A456 GTP-binding protein ENGA; GTPase, GDP, protein bin 99.87
3ec1_A369 YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase 99.86
3h2y_A368 GTPase family protein; GTP-binding protein YQEH, p 99.84
1t9h_A307 YLOQ, probable GTPase ENGC; N-terminal beta-barrel 99.8
2rcn_A358 Probable GTPase ENGC; YJEQ, circularly permuted, G 99.74
2yv5_A302 YJEQ protein; hydrolase, GTPase, permutation, stru 99.72
1u0l_A301 Probable GTPase ENGC; permutation, OB-fold, zinc-f 99.61
2e87_A357 Hypothetical protein PH1320; GTP-binding, GTPase, 99.3
1wf3_A301 GTP-binding protein; GTPase, riken structural geno 99.19
3iev_A308 GTP-binding protein ERA; ERA, GTPase, KH domain, a 99.19
1xzp_A482 Probable tRNA modification GTPase TRME; GTP-bindin 99.12
3gee_A476 MNME, tRNA modification GTPase MNME; G protein, cy 98.99
4dhe_A223 Probable GTP-binding protein ENGB; melioidosis, RA 98.98
1x3s_A195 RAS-related protein RAB-18; GTPase, GNP, structura 98.96
3geh_A462 MNME, tRNA modification GTPase MNME; G protein, U3 98.95
3cb4_D 599 GTP-binding protein LEPA; GTPase, OB-fold, membran 98.93
1ega_A301 Protein (GTP-binding protein ERA); GTPase, RNA-bin 98.93
2gj8_A172 MNME, tRNA modification GTPase TRME; G-domain dime 98.91
4a9a_A376 Ribosome-interacting GTPase 1; DRG-DFRP complex, r 98.89
3pqc_A195 Probable GTP-binding protein ENGB; rossmann fold, 98.88
1svi_A195 GTP-binding protein YSXC; ENGB, GTPase, GDP, hydro 98.85
4dcu_A456 GTP-binding protein ENGA; GTPase, GDP, protein bin 98.85
2hjg_A436 GTP-binding protein ENGA; GTPase ENGA KH-domain, h 98.85
1mky_A439 Probable GTP-binding protein ENGA; GTPase, DER, KH 98.83
2qu8_A228 Putative nucleolar GTP-binding protein 1; GTPase, 98.82
2qtf_A364 Protein HFLX, GTP-binding protein; beta-alpha-barr 98.79
2e87_A357 Hypothetical protein PH1320; GTP-binding, GTPase, 98.78
2dyk_A161 GTP-binding protein; GTPase, ribosome-binding prot 98.77
1svi_A195 GTP-binding protein YSXC; ENGB, GTPase, GDP, hydro 98.77
3j2k_7439 ERF3, eukaryotic polypeptide chain release factor 98.76
3pqc_A195 Probable GTP-binding protein ENGB; rossmann fold, 98.72
3iby_A256 Ferrous iron transport protein B; G protein, G dom 98.72
3lxw_A247 GTPase IMAP family member 1; immunity, structural 98.7
1zj6_A187 ADP-ribosylation factor-like protein 5; ARL, GTP-b 98.7
1zd9_A188 ADP-ribosylation factor-like 10B; transport protei 98.69
4dhe_A223 Probable GTP-binding protein ENGB; melioidosis, RA 98.69
1wf3_A301 GTP-binding protein; GTPase, riken structural geno 98.69
4bas_A199 ADP-ribosylation factor, putative (small GTPase, p 98.69
3i8s_A274 Ferrous iron transport protein B; GTPase, GPCR, ir 98.69
3sjy_A403 Translation initiation factor 2 subunit gamma; zin 98.68
3t1o_A198 Gliding protein MGLA; G domain containing protein, 98.66
3iev_A308 GTP-binding protein ERA; ERA, GTPase, KH domain, a 98.65
3t5g_A181 GTP-binding protein RHEB; immunoglobulin-like beta 98.64
1r8s_A164 ADP-ribosylation factor 1; protein transport/excha 98.64
1z0f_A179 RAB14, member RAS oncogene family; RAB GTPase, ves 98.63
2h57_A190 ADP-ribosylation factor-like protein 6; GTP, GTPas 98.63
2gj8_A172 MNME, tRNA modification GTPase TRME; G-domain dime 98.63
1upt_A171 ARL1, ADP-ribosylation factor-like protein 1; hydr 98.63
2efe_B181 Small GTP-binding protein-like; GEF, GTPase, VPS9, 98.63
1ksh_A186 ARF-like protein 2; small GTPase, small GTP-bindin 98.63
2f7s_A217 C25KG, RAS-related protein RAB-27B; G-protein, str 98.62
2qtf_A364 Protein HFLX, GTP-binding protein; beta-alpha-barr 98.62
3iby_A256 Ferrous iron transport protein B; G protein, G dom 98.62
3clv_A208 RAB5 protein, putative; malaria, GTPase, structura 98.61
2h17_A181 ADP-ribosylation factor-like protein 5A; GDP, GTPa 98.6
3def_A262 T7I23.11 protein; chloroplast, TOC33, GTPase, hydr 98.6
1h65_A270 Chloroplast outer envelope protein OEP34; GTPase, 98.6
1pui_A210 ENGB, probable GTP-binding protein ENGB; structura 98.6
3i8s_A274 Ferrous iron transport protein B; GTPase, GPCR, ir 98.59
3lxw_A247 GTPase IMAP family member 1; immunity, structural 98.59
3p26_A483 Elongation factor 1 alpha-like protein; GTP/GDP bi 98.58
2cxx_A190 Probable GTP-binding protein ENGB; structural geno 98.58
3dz8_A191 RAS-related protein RAB-3B; GDP, GTPase, structura 98.58
3bc1_A195 RAS-related protein RAB-27A; RAB27, GTPase, RAB, s 98.57
1ega_A301 Protein (GTP-binding protein ERA); GTPase, RNA-bin 98.56
3tkl_A196 RAS-related protein RAB-1A; vesicle trafficking, p 98.55
3tr5_A528 RF-3, peptide chain release factor 3; protein synt 98.55
1r2q_A170 RAS-related protein RAB-5A; GTPase, GNP, atomic re 98.54
3a1s_A258 Iron(II) transport protein B; FEOB, iron transport 98.54
2fu5_C183 RAS-related protein RAB-8A; MSS4:RAB8 protein comp 98.54
3tw8_B181 RAS-related protein RAB-35; longin domain, RAB GTP 98.54
3lxx_A239 GTPase IMAP family member 4; structural genomics c 98.54
2yc2_C208 IFT27, small RAB-related GTPase; transport protein 98.54
2fg5_A192 RAB-22B, RAS-related protein RAB-31; G-protein, GT 98.53
1f5n_A 592 Interferon-induced guanylate-binding protein 1; GB 98.53
2g6b_A180 RAS-related protein RAB-26; G-protein, GTP analogu 98.53
1z0j_A170 RAB-22, RAS-related protein RAB-22A; RAB GTPase, R 98.53
2xtp_A260 GTPase IMAP family member 2; immune system, G prot 98.53
2hxs_A178 RAB-26, RAS-related protein RAB-28; GTPase, signal 98.52
2b6h_A192 ADP-ribosylation factor 5; membrane trafficking, G 98.52
2y8e_A179 RAB-protein 6, GH09086P, RAB6; hydrolase, nucleoti 98.52
3b1v_A272 Ferrous iron uptake transporter protein B; G prote 98.52
2nzj_A175 GTP-binding protein REM 1; GDP/GTP binding, GTP hy 98.52
2il1_A192 RAB12; G-protein, GDP, GTPase, predicted, structur 98.52
3k53_A271 Ferrous iron transport protein B; GTPase fold, hel 98.51
1zun_B434 Sulfate adenylate transferase, subunit 1/adenylyls 98.51
3lxx_A239 GTPase IMAP family member 4; structural genomics c 98.51
3a1s_A258 Iron(II) transport protein B; FEOB, iron transport 98.51
1kao_A167 RAP2A; GTP-binding protein, small G protein, GDP, 98.51
2a9k_A187 RAS-related protein RAL-A; bacterial ADP-ribosyltr 98.51
2gf9_A189 RAS-related protein RAB-3D; G-protein, structural 98.5
3gee_A476 MNME, tRNA modification GTPase MNME; G protein, cy 98.5
2wji_A165 Ferrous iron transport protein B homolog; membrane 98.5
1wb1_A482 Translation elongation factor SELB; selenocysteine 98.5
1u8z_A168 RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNH 98.49
1moz_A183 ARL1, ADP-ribosylation factor-like protein 1; GTP- 98.49
2o52_A200 RAS-related protein RAB-4B; G-protein, GDP, struct 98.49
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 98.48
1xzp_A482 Probable tRNA modification GTPase TRME; GTP-bindin 98.48
1wxq_A397 GTP-binding protein; structural genomics, riken st 98.48
3k53_A271 Ferrous iron transport protein B; GTPase fold, hel 98.48
1lnz_A342 SPO0B-associated GTP-binding protein; GTPase, OBG, 98.48
2c78_A405 Elongation factor TU-A; hydrolase, GTPase, transla 98.47
1ek0_A170 Protein (GTP-binding protein YPT51); vesicular tra 98.47
1wxq_A397 GTP-binding protein; structural genomics, riken st 98.47
2oil_A193 CATX-8, RAS-related protein RAB-25; G-protein, GDP 98.47
3t5d_A274 Septin-7; GTP-binding protein, cytoskeleton, signa 98.47
1zbd_A203 Rabphilin-3A; G protein, effector, RABCDR, synapti 98.47
1z06_A189 RAS-related protein RAB-33B; RAB GTPase, RAB33B GT 98.46
3p32_A355 Probable GTPase RV1496/MT1543; structural genomics 98.46
1m2o_B190 GTP-binding protein SAR1, GTP binding protein; zin 98.46
1c1y_A167 RAS-related protein RAP-1A; GTP-binding proteins, 98.46
2lkc_A178 Translation initiation factor IF-2; NMR {Geobacill 98.46
2hup_A201 RAS-related protein RAB-43; G-protein, GDP, struct 98.45
3izq_1611 HBS1P, elongation factor 1 alpha-like protein; NO- 98.45
2erx_A172 GTP-binding protein DI-RAS2; GTP hydrolysis, trans 98.45
1fzq_A181 ADP-ribosylation factor-like protein 3; protein-GD 98.45
2wjg_A188 FEOB, ferrous iron transport protein B homolog; me 98.44
4dsu_A189 GTPase KRAS, isoform 2B; small G-protein, signalin 98.44
2qu8_A228 Putative nucleolar GTP-binding protein 1; GTPase, 98.44
1f6b_A198 SAR1; gtpases, N-terminal helix, Mg-containing com 98.44
2bme_A186 RAB4A, RAS-related protein RAB4A; GTP-binding prot 98.44
1jal_A363 YCHF protein; nucleotide-binding fold, structural 98.44
1jwy_B315 Dynamin A GTPase domain; dynamin, GTPase, GDP, myo 98.44
2wji_A165 Ferrous iron transport protein B homolog; membrane 98.43
2j1l_A214 RHO-related GTP-binding protein RHOD; GTPase, memb 98.42
2dyk_A161 GTP-binding protein; GTPase, ribosome-binding prot 98.41
2bov_A206 RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, 98.41
1mh1_A186 RAC1; GTP-binding, GTPase, small G-protein, RHO fa 98.41
3cph_A213 RAS-related protein SEC4; RAB GTPase, prenylation, 98.4
2fn4_A181 P23, RAS-related protein R-RAS; GDP/GTP binding, G 98.4
2nzj_A175 GTP-binding protein REM 1; GDP/GTP binding, GTP hy 98.39
3th5_A204 RAS-related C3 botulinum toxin substrate 1; rossma 97.76
3t5d_A274 Septin-7; GTP-binding protein, cytoskeleton, signa 98.39
2p5s_A199 RAS and EF-hand domain containing; G-protein, RAB, 98.39
3kkq_A183 RAS-related protein M-RAS; GTP-binding, GTPase, si 98.39
2gf0_A199 GTP-binding protein DI-RAS1; GDP/GTP binding, GTP 98.38
3con_A190 GTPase NRAS; structural genomics consortium, SGC, 98.38
2x77_A189 ADP-ribosylation factor; GTP-binding protein, smal 98.38
2a5j_A191 RAS-related protein RAB-2B; GTPase, signal transdu 98.38
1g16_A170 RAS-related protein SEC4; G protein RAB, signaling 98.38
3gj0_A221 GTP-binding nuclear protein RAN; G protein, GDP, a 98.38
3b1v_A272 Ferrous iron uptake transporter protein B; G prote 98.37
2bcg_Y206 Protein YP2, GTP-binding protein YPT1; RABGTPase, 98.37
3o47_A329 ADP-ribosylation factor GTPase-activating protein 98.36
2aka_B299 Dynamin-1; fusion protein, GTPase domain, myosin, 98.36
3q72_A166 GTP-binding protein RAD; G-domain, CAV2 beta, sign 98.36
1f60_A458 Elongation factor EEF1A; protein-protein complex, 98.36
3reg_A194 RHO-like small GTPase; cytoskeleton, nucleotide-bi 98.36
2xtp_A260 GTPase IMAP family member 2; immune system, G prot 98.36
1kk1_A410 EIF2gamma; initiation of translation; HET: GNP; 1. 98.36
2atv_A196 RERG, RAS-like estrogen-regulated growth inhibitor 98.35
4djt_A218 GTP-binding nuclear protein GSP1; structural genom 98.35
2www_A349 Methylmalonic aciduria type A protein, mitochondri 98.35
3geh_A462 MNME, tRNA modification GTPase MNME; G protein, U3 98.35
2aka_B299 Dynamin-1; fusion protein, GTPase domain, myosin, 98.35
4a9a_A376 Ribosome-interacting GTPase 1; DRG-DFRP complex, r 98.35
1z2a_A168 RAS-related protein RAB-23; RAB GTPase, vesicular 98.35
2ohf_A396 Protein OLA1, GTP-binding protein 9; ATPase, GTPas 98.35
1z08_A170 RAS-related protein RAB-21; RAB GTPase, vesicular 98.34
2wjg_A188 FEOB, ferrous iron transport protein B homolog; me 98.34
2fv8_A207 H6, RHO-related GTP-binding protein RHOB; GDP/GTP 98.34
3q85_A169 GTP-binding protein REM 2; G-domain, CAV2 beta, si 98.34
3q72_A166 GTP-binding protein RAD; G-domain, CAV2 beta, sign 98.33
3ihw_A184 Centg3; RAS, centaurin, GTPase, structural genomic 98.33
3bwd_D182 RAC-like GTP-binding protein ARAC6; G domain, cyto 98.33
2gco_A201 H9, RHO-related GTP-binding protein RHOC; GTPase,s 98.33
3qq5_A423 Small GTP-binding protein; hydrogenase, H-cluster, 98.33
3cpj_B223 GTP-binding protein YPT31/YPT8; RAB GTPase, prenyl 98.33
3q3j_B214 RHO-related GTP-binding protein RHO6; RAS-binding 98.32
4gzl_A204 RAS-related C3 botulinum toxin substrate 1; rossma 98.32
1ky3_A182 GTP-binding protein YPT7P; vesicular traffic, GTP 98.32
1vg8_A207 RAS-related protein RAB-7; GTP-binding protein, pr 98.32
1wms_A177 RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, p 98.32
2ew1_A201 RAS-related protein RAB-30; G-protein, GTP analogu 98.31
1jny_A435 EF-1-alpha, elongation factor 1-alpha, EF-TU, TUF- 98.31
2iwr_A178 Centaurin gamma 1; ANK repeat, zinc-finger, GTP-bi 98.31
3oes_A201 GTPase rhebl1; small GTPase, structural genomics, 98.31
2ywe_A600 GTP-binding protein LEPA; G domain, beta-barrel, f 98.31
1z0j_A170 RAB-22, RAS-related protein RAB-22A; RAB GTPase, R 98.3
1s0u_A408 EIF-2-gamma, translation initiation factor 2 gamma 98.3
1d2e_A397 Elongation factor TU (EF-TU); G-protein, beta-barr 98.29
2ce2_X166 GTPase HRAS; signaling protein, guanine nucleotide 98.28
1jwy_B315 Dynamin A GTPase domain; dynamin, GTPase, GDP, myo 98.27
1ni3_A392 YCHF GTPase, YCHF GTP-binding protein; structural 98.26
2x2e_A353 Dynamin-1; nitration, hydrolase, membrane fission, 98.25
1ek0_A170 Protein (GTP-binding protein YPT51); vesicular tra 98.25
4f4c_A1321 Multidrug resistance protein PGP-1; ABC transporte 98.25
2p67_A341 LAO/AO transport system kinase; ARGK, structural G 98.24
3mca_A592 HBS1, elongation factor 1 alpha-like protein; prot 98.24
2q3h_A201 RAS homolog gene family, member U; GTPase, structu 98.24
2elf_A370 Protein translation elongation factor 1A; tRNA, py 98.24
2atx_A194 Small GTP binding protein TC10; GTPase, P-loop, al 98.23
3r7w_A307 Gtpase1, GTP-binding protein GTR1; RAG gtpases, GT 98.23
3c5c_A187 RAS-like protein 12; GDP, GTPase, structural genom 98.23
3izy_P537 Translation initiation factor IF-2, mitochondrial; 98.22
2fh5_B214 SR-beta, signal recognition particle receptor beta 98.22
2ged_A193 SR-beta, signal recognition particle receptor beta 98.21
2j69_A695 Bacterial dynamin-like protein; FZO, FZL, GTPase, 98.21
1moz_A183 ARL1, ADP-ribosylation factor-like protein 1; GTP- 98.21
2lkc_A178 Translation initiation factor IF-2; NMR {Geobacill 98.2
1zj6_A187 ADP-ribosylation factor-like protein 5; ARL, GTP-b 98.2
1fzq_A181 ADP-ribosylation factor-like protein 3; protein-GD 98.2
2x77_A189 ADP-ribosylation factor; GTP-binding protein, smal 98.2
1upt_A171 ARL1, ADP-ribosylation factor-like protein 1; hydr 98.2
2fg5_A192 RAB-22B, RAS-related protein RAB-31; G-protein, GT 98.19
2h17_A181 ADP-ribosylation factor-like protein 5A; GDP, GTPa 98.19
1wms_A177 RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, p 98.19
1kao_A167 RAP2A; GTP-binding protein, small G protein, GDP, 98.19
1r5b_A467 Eukaryotic peptide chain release factor GTP-bindi 98.18
2j69_A 695 Bacterial dynamin-like protein; FZO, FZL, GTPase, 98.17
1g16_A170 RAS-related protein SEC4; G protein RAB, signaling 98.17
3gj0_A221 GTP-binding nuclear protein RAN; G protein, GDP, a 98.17
3zvr_A 772 Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mito 98.17
1z0f_A179 RAB14, member RAS oncogene family; RAB GTPase, ves 98.15
2qpt_A 550 EH domain-containing protein-2; protein-nucleotide 98.15
2p5s_A199 RAS and EF-hand domain containing; G-protein, RAB, 98.15
2j0v_A212 RAC-like GTP-binding protein ARAC7; nucleotide-bin 98.15
3cph_A213 RAS-related protein SEC4; RAB GTPase, prenylation, 98.15
1ksh_A186 ARF-like protein 2; small GTPase, small GTP-bindin 98.15
3l0i_B199 RAS-related protein RAB-1A; GEF-GDF-RAB complex, G 98.14
3cbq_A195 GTP-binding protein REM 2; FLJ38964A, structural g 98.14
2g6b_A180 RAS-related protein RAB-26; G-protein, GTP analogu 98.14
4f4c_A 1321 Multidrug resistance protein PGP-1; ABC transporte 98.14
1r2q_A170 RAS-related protein RAB-5A; GTPase, GNP, atomic re 98.14
3llu_A196 RAS-related GTP-binding protein C; structural geno 98.14
1z2a_A168 RAS-related protein RAB-23; RAB GTPase, vesicular 98.14
2www_A349 Methylmalonic aciduria type A protein, mitochondri 98.14
3tw8_B181 RAS-related protein RAB-35; longin domain, RAB GTP 98.13
1m7b_A184 RND3/RHOE small GTP-binding protein; small GTPase, 98.12
3dpu_A535 RAB family protein; roccor, G-domain, COR, GTP-bin 98.12
2dby_A368 GTP-binding protein; GDP, structural genomics, NPP 98.12
2wkq_A332 NPH1-1, RAS-related C3 botulinum toxin substrate 1 98.11
2qpt_A550 EH domain-containing protein-2; protein-nucleotide 98.11
3r7w_A307 Gtpase1, GTP-binding protein GTR1; RAG gtpases, GT 98.11
1lnz_A342 SPO0B-associated GTP-binding protein; GTPase, OBG, 98.11
2efe_B181 Small GTP-binding protein-like; GEF, GTPase, VPS9, 98.1
3qq5_A 423 Small GTP-binding protein; hydrogenase, H-cluster, 98.1
2cxx_A190 Probable GTP-binding protein ENGB; structural geno 98.1
2il1_A192 RAB12; G-protein, GDP, GTPase, predicted, structur 98.1
4dsu_A189 GTPase KRAS, isoform 2B; small G-protein, signalin 98.1
1gwn_A205 RHO-related GTP-binding protein RHOE; GTPase, inac 98.1
2gf9_A189 RAS-related protein RAB-3D; G-protein, structural 98.09
1zbd_A203 Rabphilin-3A; G protein, effector, RABCDR, synapti 98.08
1u8z_A168 RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNH 98.08
3t34_A360 Dynamin-related protein 1A, linker, dynamin-relat 98.08
4djt_A218 GTP-binding nuclear protein GSP1; structural genom 98.07
3clv_A208 RAB5 protein, putative; malaria, GTPase, structura 98.07
1z08_A170 RAS-related protein RAB-21; RAB GTPase, vesicular 98.07
3t5g_A181 GTP-binding protein RHEB; immunoglobulin-like beta 98.07
1nrj_B218 SR-beta, signal recognition particle receptor beta 98.07
3avx_A 1289 Elongation factor TS, elongation factor TU, linke 98.06
1x3s_A195 RAS-related protein RAB-18; GTPase, GNP, structura 98.06
1z06_A189 RAS-related protein RAB-33B; RAB GTPase, RAB33B GT 98.06
4bas_A199 ADP-ribosylation factor, putative (small GTPase, p 98.06
2h57_A190 ADP-ribosylation factor-like protein 6; GTP, GTPas 98.06
2y8e_A179 RAB-protein 6, GH09086P, RAB6; hydrolase, nucleoti 98.05
3tkl_A196 RAS-related protein RAB-1A; vesicle trafficking, p 98.04
1m2o_B190 GTP-binding protein SAR1, GTP binding protein; zin 98.04
1f6b_A198 SAR1; gtpases, N-terminal helix, Mg-containing com 98.04
2fh5_B214 SR-beta, signal recognition particle receptor beta 98.04
1ky3_A182 GTP-binding protein YPT7P; vesicular traffic, GTP 98.04
2ce2_X166 GTPase HRAS; signaling protein, guanine nucleotide 98.03
1vg8_A207 RAS-related protein RAB-7; GTP-binding protein, pr 98.03
2oil_A193 CATX-8, RAS-related protein RAB-25; G-protein, GDP 98.03
1r8s_A164 ADP-ribosylation factor 1; protein transport/excha 98.02
1pui_A210 ENGB, probable GTP-binding protein ENGB; structura 98.01
1c1y_A167 RAS-related protein RAP-1A; GTP-binding proteins, 98.01
1udx_A416 The GTP-binding protein OBG; TGS domain, riken str 98.0
2a5j_A191 RAS-related protein RAB-2B; GTPase, signal transdu 97.99
2bme_A186 RAB4A, RAS-related protein RAB4A; GTP-binding prot 97.99
1g7s_A594 Translation initiation factor IF2/EIF5B; translati 97.99
2xex_A 693 Elongation factor G; GTPase, translation, biosynth 97.98
2erx_A172 GTP-binding protein DI-RAS2; GTP hydrolysis, trans 97.98
2a9k_A187 RAS-related protein RAL-A; bacterial ADP-ribosyltr 97.98
2hxs_A178 RAB-26, RAS-related protein RAB-28; GTPase, signal 97.96
2o52_A200 RAS-related protein RAB-4B; G-protein, GDP, struct 97.96
2iwr_A178 Centaurin gamma 1; ANK repeat, zinc-finger, GTP-bi 97.95
3con_A190 GTPase NRAS; structural genomics consortium, SGC, 97.94
3l0i_B199 RAS-related protein RAB-1A; GEF-GDF-RAB complex, G 97.94
2bcg_Y206 Protein YP2, GTP-binding protein YPT1; RABGTPase, 97.94
2b6h_A192 ADP-ribosylation factor 5; membrane trafficking, G 97.94
2yc2_C208 IFT27, small RAB-related GTPase; transport protein 97.94
2h5e_A529 Peptide chain release factor RF-3; beta barrel, tr 97.94
2zej_A184 Dardarin, leucine-rich repeat kinase 2; parkinson' 97.93
3bc1_A195 RAS-related protein RAB-27A; RAB27, GTPase, RAB, s 97.93
3q85_A169 GTP-binding protein REM 2; G-domain, CAV2 beta, si 97.93
2fu5_C183 RAS-related protein RAB-8A; MSS4:RAB8 protein comp 97.92
3dz8_A191 RAS-related protein RAB-3B; GDP, GTPase, structura 97.92
2bov_A206 RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, 97.92
1h65_A270 Chloroplast outer envelope protein OEP34; GTPase, 97.91
3kkq_A183 RAS-related protein M-RAS; GTP-binding, GTPase, si 97.91
2fn4_A181 P23, RAS-related protein R-RAS; GDP/GTP binding, G 97.9
3cpj_B223 GTP-binding protein YPT31/YPT8; RAB GTPase, prenyl 97.9
3nh6_A306 ATP-binding cassette SUB-family B member 6, mitoc; 97.9
3cbq_A195 GTP-binding protein REM 2; FLJ38964A, structural g 97.89
2atv_A196 RERG, RAS-like estrogen-regulated growth inhibitor 97.88
3j2k_7 439 ERF3, eukaryotic polypeptide chain release factor 97.86
4dkx_A216 RAS-related protein RAB-6A; GTP binding fold, memb 97.86
1zd9_A188 ADP-ribosylation factor-like 10B; transport protei 97.86
2gco_A201 H9, RHO-related GTP-binding protein RHOC; GTPase,s 97.85
2ew1_A201 RAS-related protein RAB-30; G-protein, GTP analogu 97.85
2qm8_A337 GTPase/ATPase; G protein, G3E, metallochaperone, c 97.84
2q3h_A201 RAS homolog gene family, member U; GTPase, structu 97.84
2hup_A201 RAS-related protein RAB-43; G-protein, GDP, struct 97.84
2j1l_A214 RHO-related GTP-binding protein RHOD; GTPase, memb 97.84
2gf0_A199 GTP-binding protein DI-RAS1; GDP/GTP binding, GTP 97.83
2fv8_A207 H6, RHO-related GTP-binding protein RHOB; GDP/GTP 97.83
1nrj_B218 SR-beta, signal recognition particle receptor beta 97.83
3izq_1 611 HBS1P, elongation factor 1 alpha-like protein; NO- 97.82
2ged_A193 SR-beta, signal recognition particle receptor beta 97.81
2cjw_A192 GTP-binding protein GEM; nucleotide-binding, small 97.81
1dar_A 691 EF-G, elongation factor G; ribosomal translocase, 97.8
3oes_A201 GTPase rhebl1; small GTPase, structural genomics, 97.78
2g3y_A211 GTP-binding protein GEM; small GTPase, GDP, inacti 97.78
2zej_A184 Dardarin, leucine-rich repeat kinase 2; parkinson' 97.77
3qf4_B598 Uncharacterized ABC transporter ATP-binding prote 97.77
1zo1_I501 IF2, translation initiation factor 2; E. coli, rib 97.76
3mca_A 592 HBS1, elongation factor 1 alpha-like protein; prot 97.76
3def_A262 T7I23.11 protein; chloroplast, TOC33, GTPase, hydr 97.75
3vqt_A548 RF-3, peptide chain release factor 3; translation, 97.75
4gzl_A204 RAS-related C3 botulinum toxin substrate 1; rossma 97.74
3c5c_A187 RAS-like protein 12; GDP, GTPase, structural genom 97.74
3llu_A196 RAS-related GTP-binding protein C; structural geno 97.73
1mh1_A186 RAC1; GTP-binding, GTPase, small G-protein, RHO fa 97.73
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 97.71
2x2e_A353 Dynamin-1; nitration, hydrolase, membrane fission, 97.71
3p26_A 483 Elongation factor 1 alpha-like protein; GTP/GDP bi 97.7
2cjw_A192 GTP-binding protein GEM; nucleotide-binding, small 97.7
2f9l_A199 RAB11B, member RAS oncogene family; RAB11B GTPase, 97.69
2f7s_A217 C25KG, RAS-related protein RAB-27B; G-protein, str 97.69
3reg_A194 RHO-like small GTPase; cytoskeleton, nucleotide-bi 97.68
2dby_A368 GTP-binding protein; GDP, structural genomics, NPP 97.66
2rdo_7 704 EF-G, elongation factor G; elongation factor G, EF 97.65
1udx_A416 The GTP-binding protein OBG; TGS domain, riken str 97.64
1m7b_A184 RND3/RHOE small GTP-binding protein; small GTPase, 97.64
2g3y_A211 GTP-binding protein GEM; small GTPase, GDP, inacti 97.63
1n0u_A 842 EF-2, elongation factor 2; G-protein, CIS-proline, 97.61
3ihw_A184 Centg3; RAS, centaurin, GTPase, structural genomic 97.61
3qf4_A587 ABC transporter, ATP-binding protein; multidrug tr 97.6
2atx_A194 Small GTP binding protein TC10; GTPase, P-loop, al 97.6
3b5x_A582 Lipid A export ATP-binding/permease protein MSBA; 97.59
1oix_A191 RAS-related protein RAB-11A; small G protein, intr 97.59
3bwd_D182 RAC-like GTP-binding protein ARAC6; G domain, cyto 97.59
2j0v_A212 RAC-like GTP-binding protein ARAC7; nucleotide-bin 97.58
4a82_A578 Cystic fibrosis transmembrane conductance regulat; 97.57
3izy_P 537 Translation initiation factor IF-2, mitochondrial; 97.57
3o47_A329 ADP-ribosylation factor GTPase-activating protein 97.56
2dy1_A 665 Elongation factor G; translocation, GTP complex, s 97.56
3t1o_A198 Gliding protein MGLA; G domain containing protein, 97.55
1gwn_A205 RHO-related GTP-binding protein RHOE; GTPase, inac 97.54
3g5u_A 1284 MCG1178, multidrug resistance protein 1A; P-glycop 97.54
3zvr_A 772 Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mito 97.53
2qag_A361 Septin-2, protein NEDD5; cell cycle, cell division 97.53
1jal_A363 YCHF protein; nucleotide-binding fold, structural 97.51
3t34_A360 Dynamin-related protein 1A, linker, dynamin-relat 97.49
3dpu_A 535 RAB family protein; roccor, G-domain, COR, GTP-bin 97.49
2qag_A361 Septin-2, protein NEDD5; cell cycle, cell division 97.48
3b60_A582 Lipid A export ATP-binding/permease protein MSBA; 97.48
1zo1_I 501 IF2, translation initiation factor 2; E. coli, rib 97.47
3q5d_A447 Atlastin-1; G protein, GTPase, GDP/GTP binding, hy 97.47
3q3j_B214 RHO-related GTP-binding protein RHO6; RAS-binding 97.46
1yrb_A262 ATP(GTP)binding protein; GTPase, P-loop, rossman f 97.43
3p32_A355 Probable GTPase RV1496/MT1543; structural genomics 97.42
2yl4_A595 ATP-binding cassette SUB-family B member 10, mitoc 97.39
2qm8_A337 GTPase/ATPase; G protein, G3E, metallochaperone, c 97.38
2wsm_A221 Hydrogenase expression/formation protein (HYPB); m 97.36
2p67_A341 LAO/AO transport system kinase; ARGK, structural G 97.36
1f60_A 458 Elongation factor EEF1A; protein-protein complex, 97.36
1wb1_A 482 Translation elongation factor SELB; selenocysteine 97.34
3th5_A204 RAS-related C3 botulinum toxin substrate 1; rossma 96.45
2c78_A 405 Elongation factor TU-A; hydrolase, GTPase, transla 97.33
1kk1_A410 EIF2gamma; initiation of translation; HET: GNP; 1. 97.33
2f9l_A199 RAB11B, member RAS oncogene family; RAB11B GTPase, 97.33
2elf_A370 Protein translation elongation factor 1A; tRNA, py 97.33
3c5h_A255 Glucocorticoid receptor DNA-binding factor 1; RAS, 97.31
1d2e_A 397 Elongation factor TU (EF-TU); G-protein, beta-barr 97.31
1zun_B 434 Sulfate adenylate transferase, subunit 1/adenylyls 97.3
2wkq_A332 NPH1-1, RAS-related C3 botulinum toxin substrate 1 97.27
1s0u_A408 EIF-2-gamma, translation initiation factor 2 gamma 97.27
3sop_A270 Neuronal-specific septin-3; hydrolase; HET: GDP; 2 97.26
4dkx_A216 RAS-related protein RAB-6A; GTP binding fold, memb 97.22
3tr5_A 528 RF-3, peptide chain release factor 3; protein synt 97.19
2wsm_A221 Hydrogenase expression/formation protein (HYPB); m 97.17
1jny_A 435 EF-1-alpha, elongation factor 1-alpha, EF-TU, TUF- 97.15
2h5e_A 529 Peptide chain release factor RF-3; beta barrel, tr 97.14
3sjy_A 403 Translation initiation factor 2 subunit gamma; zin 97.14
2qag_B 427 Septin-6, protein NEDD5; cell cycle, cell division 97.12
3j25_A 638 Tetracycline resistance protein TETM; antibiotic r 97.11
2j37_W 504 Signal recognition particle 54 kDa protein (SRP54) 97.05
2xex_A 693 Elongation factor G; GTPase, translation, biosynth 97.04
2ixe_A271 Antigen peptide transporter 1; ABC ATPase, hydrola 97.03
4fn5_A 709 EF-G 1, elongation factor G 1; translation, transl 97.02
2qnr_A301 Septin-2, protein NEDD5; structural genomics conso 97.01
2hf9_A226 Probable hydrogenase nickel incorporation protein 96.94
1g7s_A 594 Translation initiation factor IF2/EIF5B; translati 96.93
1oix_A191 RAS-related protein RAB-11A; small G protein, intr 96.91
2qag_C 418 Septin-7; cell cycle, cell division, GTP-binding, 96.86
3g5u_A1284 MCG1178, multidrug resistance protein 1A; P-glycop 96.86
1r5b_A 467 Eukaryotic peptide chain release factor GTP-bindi 96.84
2ff7_A247 Alpha-hemolysin translocation ATP-binding protein 96.8
1tq4_A413 IIGP1, interferon-inducible GTPase; interferon gam 96.77
1n0u_A 842 EF-2, elongation factor 2; G-protein, CIS-proline, 96.77
1yrb_A262 ATP(GTP)binding protein; GTPase, P-loop, rossman f 96.74
3cb4_D 599 GTP-binding protein LEPA; GTPase, OB-fold, membran 96.69
1mv5_A243 LMRA, multidrug resistance ABC transporter ATP-bin 96.68
3avx_A 1289 Elongation factor TS, elongation factor TU, linke 96.65
3gd7_A390 Fusion complex of cystic fibrosis transmembrane co 96.65
1dar_A 691 EF-G, elongation factor G; ribosomal translocase, 96.58
4g1u_C266 Hemin import ATP-binding protein HMUV; membrane tr 96.57
3ec1_A369 YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase 96.56
2ghi_A260 Transport protein; multidrug resistance protein, M 96.49
2ywe_A 600 GTP-binding protein LEPA; G domain, beta-barrel, f 96.44
2rdo_7 704 EF-G, elongation factor G; elongation factor G, EF 96.38
3c5h_A255 Glucocorticoid receptor DNA-binding factor 1; RAS, 96.37
2qag_B427 Septin-6, protein NEDD5; cell cycle, cell division 96.3
3tif_A235 Uncharacterized ABC transporter ATP-binding prote; 96.24
2qi9_C249 Vitamin B12 import ATP-binding protein BTUD; inner 96.24
3h2y_A368 GTPase family protein; GTP-binding protein YQEH, p 96.23
2j37_W504 Signal recognition particle 54 kDa protein (SRP54) 96.19
2v3c_C432 SRP54, signal recognition 54 kDa protein; nucleoti 95.95
1ji0_A240 ABC transporter; ATP binding protein, structural g 95.95
3tui_C366 Methionine import ATP-binding protein METN; ABC-tr 95.91
3fvq_A359 Fe(3+) IONS import ATP-binding protein FBPC; nucle 95.88
2v3c_C432 SRP54, signal recognition 54 kDa protein; nucleoti 95.87
1v43_A372 Sugar-binding transport ATP-binding protein; ATPas 95.84
3r7w_B331 Gtpase2, GTP-binding protein GTR2; RAG gtpases, GT 95.8
1cip_A353 Protein (guanine nucleotide-binding protein alpha- 95.73
2dy1_A 665 Elongation factor G; translocation, GTP complex, s 95.68
2yyz_A359 Sugar ABC transporter, ATP-binding protein; sugar 95.55
3rlf_A381 Maltose/maltodextrin import ATP-binding protein M; 95.4
3dm5_A443 SRP54, signal recognition 54 kDa protein; protein- 95.37
1zcb_A362 G alpha I/13; GTP-binding, lipoprotein, membrane, 95.29
3ney_A197 55 kDa erythrocyte membrane protein; structural ge 95.22
2qag_C418 Septin-7; cell cycle, cell division, GTP-binding, 95.22
3r7w_B331 Gtpase2, GTP-binding protein GTR2; RAG gtpases, GT 95.11
2hf9_A226 Probable hydrogenase nickel incorporation protein 95.04
4ido_A457 Atlastin-1; GTPase, GTP/GDP binding, hydrolase; HE 94.97
3szr_A 608 Interferon-induced GTP-binding protein MX1; interf 94.4
1azs_C402 GS-alpha; complex (lyase/hydrolase), hydrolase, si 94.03
3ohm_A327 Guanine nucleotide-binding protein G(Q) subunit A; 94.02
1ye8_A178 Protein THEP1, hypothetical UPF0334 kinase-like pr 93.95
3c8u_A208 Fructokinase; YP_612366.1, putative fructose trans 93.95
2qnr_A301 Septin-2, protein NEDD5; structural genomics conso 93.81
1j8m_F297 SRP54, signal recognition 54 kDa protein; signalin 93.78
1kgd_A180 CASK, peripheral plasma membrane CASK; maguk, guan 93.68
1lvg_A198 Guanylate kinase, GMP kinase; transferase; HET: AD 93.66
1zp6_A191 Hypothetical protein ATU3015; alpha-beta protein., 93.63
4fid_A340 G protein alpha subunit; RAS-like domain, all-heli 93.61
2xtz_A354 Guanine nucleotide-binding protein alpha-1 subuni; 93.52
1ko7_A314 HPR kinase/phosphatase; protein kinase, phosphotra 93.44
2ohf_A396 Protein OLA1, GTP-binding protein 9; ATPase, GTPas 93.43
3kl4_A433 SRP54, signal recognition 54 kDa protein; signal r 93.41
3sop_A270 Neuronal-specific septin-3; hydrolase; HET: GDP; 2 93.37
3dm5_A443 SRP54, signal recognition 54 kDa protein; protein- 93.34
3l82_B227 F-box only protein 4; TRFH domain, helix, GTPase d 93.25
1np6_A174 Molybdopterin-guanine dinucleotide biosynthesis pr 93.2
3tr0_A205 Guanylate kinase, GMP kinase; purines, pyrimidines 93.09
2xxa_A433 Signal recognition particle protein; protein trans 93.07
1znw_A207 Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans 92.99
3tau_A208 Guanylate kinase, GMP kinase; structural genomics, 92.91
1z6g_A218 Guanylate kinase; structural genomics, SGC, struct 92.66
3a00_A186 Guanylate kinase, GMP kinase; domain movement, dim 92.53
2pcj_A224 ABC transporter, lipoprotein-releasing system ATP- 92.31
3vqt_A 548 RF-3, peptide chain release factor 3; translation, 92.3
3asz_A211 Uridine kinase; cytidine phosphorylation, transfer 92.27
2j41_A207 Guanylate kinase; GMP, GMK, transferase, ATP-bindi 92.19
3lw7_A179 Adenylate kinase related protein (ADKA-like); AMP, 92.09
4gp7_A171 Metallophosphoesterase; polynucleotide kinase phos 92.01
1kag_A173 SKI, shikimate kinase I; transferase, structural g 91.91
2bbw_A246 Adenylate kinase 4, AK4; nucleotide kinase, nucleo 91.82
2bdt_A189 BH3686; alpha-beta protein, structural genomics, P 91.76
2cbz_A237 Multidrug resistance-associated protein 1; ABC pro 91.72
2qor_A204 Guanylate kinase; phosphotransferase, purine metab 91.57
3lnc_A231 Guanylate kinase, GMP kinase; ALS collaborative cr 91.39
1g6h_A257 High-affinity branched-chain amino acid transport 91.38
1s96_A219 Guanylate kinase, GMP kinase; E.coli, dimer, SAD, 91.37
1b0u_A262 Histidine permease; ABC transporter, transport pro 91.37
4eun_A200 Thermoresistant glucokinase; putative sugar kinase 91.31
1ly1_A181 Polynucleotide kinase; PNK, phosphatase, transfera 91.31
3b85_A208 Phosphate starvation-inducible protein; PHOH2, ATP 91.31
2onk_A240 Molybdate/tungstate ABC transporter, ATP-binding p 91.25
3gfo_A275 Cobalt import ATP-binding protein CBIO 1; structur 91.2
2pze_A229 Cystic fibrosis transmembrane conductance regulat; 91.2
1sgw_A214 Putative ABC transporter; structural genomics, P p 91.19
1rz3_A201 Hypothetical protein rbstp0775; MCSG, structural g 91.13
2v9p_A305 Replication protein E1; AAA+ molecular motor, DNA 91.07
1cke_A227 CK, MSSA, protein (cytidine monophosphate kinase); 91.06
2if2_A204 Dephospho-COA kinase; alpha-beta protein, structur 91.01
2olj_A263 Amino acid ABC transporter; ABC domain, ATPase, hy 90.99
1jjv_A206 Dephospho-COA kinase; P-loop nucleotide-binding fo 90.94
2i3b_A189 HCR-ntpase, human cancer-related ntpase; AAA, ross 90.91
2d2e_A250 SUFC protein; ABC-ATPase, SUF protein, 310-helix, 90.9
1knq_A175 Gluconate kinase; ALFA/beta structure, transferase 90.86
2f1r_A171 Molybdopterin-guanine dinucleotide biosynthesis pr 90.81
3kb2_A173 SPBC2 prophage-derived uncharacterized protein YOR 90.81
>1puj_A YLQF, conserved hypothetical protein YLQF; structural genomics, nysgxrc T18, GTPase, PSI, protein structure initiative; HET: GNP; 2.00A {Bacillus subtilis} SCOP: c.37.1.8 Back     alignment and structure
Probab=100.00  E-value=1.3e-41  Score=350.30  Aligned_cols=257  Identities=23%  Similarity=0.311  Sum_probs=189.6

Q ss_pred             HHHHHHHHHHHhhcCeEEEEEeCCCCCCCCchHHHHHHHHhCCCCcEEEEEeCCCCCCHHHHHHHHHHHhhCCCeEEEEe
Q psy9995         159 LDFWRQLWRVIERSDVIVQIVDARNPLLFRCEDLERYVKEVSPHKRNMILLNKADLLTRKQRCYWTKYFNSVNVAVAFFS  238 (595)
Q Consensus       159 ~e~~rql~~vie~sDvVl~VvDAR~Pl~~~~~~Le~~lk~v~~~K~~ILVlNK~DLl~~~~~~~w~~~~~~~gi~vi~~S  238 (595)
                      ...++|+++.++++|+|++|+|||+|.+++++.+++++    .++|.++|+||+||++++..+.|.+||++.|++++++|
T Consensus        11 ~ka~~~~~~~l~~aDvVl~VvDAr~p~~~~~~~l~~~l----~~kp~ilVlNK~DL~~~~~~~~~~~~~~~~g~~~i~iS   86 (282)
T 1puj_A           11 AKARREVTEKLKLIDIVYELVDARIPMSSRNPMIEDIL----KNKPRIMLLNKADKADAAVTQQWKEHFENQGIRSLSIN   86 (282)
T ss_dssp             THHHHHHHHHGGGCSEEEEEEETTSTTTTSCHHHHHHC----SSSCEEEEEECGGGSCHHHHHHHHHHHHTTTCCEEECC
T ss_pred             HHHHHHHHHHHhhCCEEEEEEeCCCCCccCCHHHHHHH----CCCCEEEEEECcccCCHHHHHHHHHHHHhcCCcEEEEE
Confidence            35689999999999999999999999999999998886    47999999999999998888999999987889999999


Q ss_pred             cccCCCCCCCCccchhhhhhhccccccchhhhhhhhhhhccccchhhhhhccccCCccccCHHHHHHHhhhh---cccCC
Q psy9995         239 ATNIYDDIPEGDEELEDEVVSEESESDESEWEDISEEEEEDDGQKVLENDLKIKSSPKLLNREELISLFKSF---HDVNI  315 (595)
Q Consensus       239 A~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~il~~~eL~e~~~~~---~~~~~  315 (595)
                      |.++.+..+.                                                   .+.+.+++...   ...  
T Consensus        87 A~~~~gi~~L---------------------------------------------------~~~i~~~l~~~~~~~~~--  113 (282)
T 1puj_A           87 SVNGQGLNQI---------------------------------------------------VPASKEILQEKFDRMRA--  113 (282)
T ss_dssp             TTTCTTGGGH---------------------------------------------------HHHHHHHHHHHHHHHHH--
T ss_pred             CCCcccHHHH---------------------------------------------------HHHHHHHHHHHHHHHHh--
Confidence            9877652100                                                   01111111110   000  


Q ss_pred             CCCCCCceEEEEeecCCCCcchHhhhhcCcceeEecCCCCCceeeEEEEcCCceEEEeCCCCccCCcccchh--HHHHhc
Q psy9995         316 PRMNPDVMTIGLVGYPNVGKSSTINALLNAKKVSVSATPGKTKHFQTLFVDDELLLCDCPGLVMPSFVFSKA--DMILNG  393 (595)
Q Consensus       316 ~~~~~~~i~i~lvG~pnvGKSSliN~L~~~~kvsVs~tPG~TKh~Qti~~~~~~~liDtPGl~~p~f~~tk~--eli~~g  393 (595)
                      .......++|++||+||||||||||+|++.+.+.|+++||+|++.|++.++..+.|+||||+.+|++.....  .+++.|
T Consensus       114 ~~~~~~~~~v~~vG~~nvGKSsliN~l~~~~~~~~~~~~g~T~~~~~~~~~~~~~l~DtpG~~~~~~~~~~~~~~~~~~~  193 (282)
T 1puj_A          114 KGVKPRAIRALIIGIPNVGKSTLINRLAKKNIAKTGDRPGITTSQQWVKVGKELELLDTPGILWPKFEDELVGLRLAVTG  193 (282)
T ss_dssp             TTCCCCCEEEEEEESTTSSHHHHHHHHHTSCCC------------CCEEETTTEEEEECCCCCCSCCCCHHHHHHHHHHT
T ss_pred             cCCCCCCceEEEEecCCCchHHHHHHHhcCceeecCCCCCeeeeeEEEEeCCCEEEEECcCcCCCCCCCHHHHHHHHHhC
Confidence            112345689999999999999999999999989999999999999999999999999999999998765543  355666


Q ss_pred             CCc-----hhhhhhhhhhHHHHhhhcChhHHHHHhCCCCCCCCCCCCCCCCCCHHHHHHHhhhhcCccccCCCCCHHHHH
Q psy9995         394 ILP-----IDQMRDHVPAVNMLCTLVPRHVLENIYGIMITQPDEGEDPNRPPFSEELCNAYGYNRGFMTSNGQPDNPRSA  468 (595)
Q Consensus       394 il~-----id~lrd~~~~v~~l~~~i~~~~le~~Y~i~~~~p~~~~~~~~~~~~~e~L~~~a~~rG~~~~gG~pD~~rAA  468 (595)
                      .+.     .+.+..+  .+..+..+.| ..|+.+|++..+.          .+..|||+++|++||++.+||+||+.+||
T Consensus       194 ~i~~~~~~~~~~~~~--~~~~l~~~~~-~~l~~~y~~~~~~----------~~~~~~l~~~a~~~g~~~kgg~~d~~~aa  260 (282)
T 1puj_A          194 AIKDSIINLQDVAVF--GLRFLEEHYP-ERLKERYGLDEIP----------EDIAELFDAIGEKRGCLMSGGLINYDKTT  260 (282)
T ss_dssp             SSCTTSSCHHHHHHH--HHHHHHHHCH-HHHHHHTTCSSCC----------SSHHHHHHHHHHHHTCBCSTTCBCHHHHH
T ss_pred             CcchhhCCHHHHHHH--HHHHHHHhCh-HHHHHHcCCCCCC----------CCHHHHHHHHHHHhCCcccCCcccHHHHH
Confidence            553     3333222  2333444544 3577789984211          14789999999999999999999999999


Q ss_pred             HHHHHHHHhCCceeecC
Q psy9995         469 RYILKDFVNGHLLYCQA  485 (595)
Q Consensus       469 r~iLkD~~~GKL~~~~~  485 (595)
                      +.||+||++|||+++..
T Consensus       261 ~~~l~d~~~Gklg~~~l  277 (282)
T 1puj_A          261 EVIIRDIRTEKFGRLSF  277 (282)
T ss_dssp             HHHHHHHHTTTTCSCCS
T ss_pred             HHHHHHHHcCCCCceEC
Confidence            99999999999996643
>3cnl_A YLQF, putative uncharacterized protein; circular permutation, GNP, signaling protein; HET: GNP; 2.00A {Thermotoga maritima} PDB: 3cnn_A* 3cno_A* Back     alignment and structure
>1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1 Back     alignment and structure
>2hjg_A GTP-binding protein ENGA; GTPase ENGA KH-domain, hydrolase; HET: GDP; 2.50A {Bacillus subtilis} Back     alignment and structure
>4dcu_A GTP-binding protein ENGA; GTPase, GDP, protein binding, hydrolase; HET: GDP; 2.00A {Bacillus subtilis} PDB: 4dct_A* 4dcs_A* 4dcv_A* 2hjg_A* Back     alignment and structure
>3ec1_A YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase, signaling protein; HET: GDP; 2.36A {Geobacillus stearothermophilus} Back     alignment and structure
>3h2y_A GTPase family protein; GTP-binding protein YQEH, possibly involved in replication initiation, csgid, IDP90222; HET: DGI; 1.80A {Bacillus anthracis str} Back     alignment and structure
>1t9h_A YLOQ, probable GTPase ENGC; N-terminal beta-barrel domain with oligonucleotide binding fold, central GTP binding domain; 1.60A {Bacillus subtilis} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>2rcn_A Probable GTPase ENGC; YJEQ, circularly permuted, GTP-binding, hydrolase, nucleotide-binding; HET: GDP; 2.25A {Salmonella typhimurium} PDB: 2ykr_W 4a2i_V Back     alignment and structure
>2yv5_A YJEQ protein; hydrolase, GTPase, permutation, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GDP; 1.90A {Aquifex aeolicus} Back     alignment and structure
>1u0l_A Probable GTPase ENGC; permutation, OB-fold, zinc-finger, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; HET: GDP; 2.80A {Thermotoga maritima} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>2e87_A Hypothetical protein PH1320; GTP-binding, GTPase, OBG, bundle, GDP, complex, structural G NPPSFA; HET: GDP; 2.35A {Pyrococcus horikoshii} Back     alignment and structure
>1wf3_A GTP-binding protein; GTPase, riken structural genomics/prote initiative, RSGI, structural genomics, hydrolase; HET: GNP; 1.88A {Thermus thermophilus} SCOP: c.37.1.8 d.52.3.1 Back     alignment and structure
>3iev_A GTP-binding protein ERA; ERA, GTPase, KH domain, anti-SD, 16S rRNA, 30S ribosome ASSE GTP-binding, nucleotide-binding; HET: GNP; 1.90A {Aquifex aeolicus} PDB: 3r9w_A* 3r9x_A* Back     alignment and structure
>1xzp_A Probable tRNA modification GTPase TRME; GTP-binding, THF-binding, hydrolase; 2.30A {Thermotoga maritima} SCOP: a.24.25.1 c.37.1.8 d.250.1.2 PDB: 1xzq_A* 1xzp_B 1xzq_B* Back     alignment and structure
>3gee_A MNME, tRNA modification GTPase MNME; G protein, cytoplasm, GTP- binding, hydrolase, magnesium, metal-binding, nucleotide- binding, potassium; HET: GDP FON; 2.95A {Chlorobium tepidum} PDB: 3gei_A* Back     alignment and structure
>4dhe_A Probable GTP-binding protein ENGB; melioidosis, RAS-like GTPase, cell division, cell cycle, SEP GTP-binding; 2.20A {Burkholderia thailandensis} Back     alignment and structure
>1x3s_A RAS-related protein RAB-18; GTPase, GNP, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GNP; 1.32A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3geh_A MNME, tRNA modification GTPase MNME; G protein, U34, GTP-binding, HYDR magnesium, metal-binding, nucleotide-binding, potassium, TR processing; HET: GDP FON; 3.20A {Nostoc SP} Back     alignment and structure
>3cb4_D GTP-binding protein LEPA; GTPase, OB-fold, membrane, nucleotide-binding, translation; 2.80A {Escherichia coli} PDB: 3deg_C* Back     alignment and structure
>1ega_A Protein (GTP-binding protein ERA); GTPase, RNA-binding, RAS-like, hydrolase; 2.40A {Escherichia coli} SCOP: c.37.1.8 d.52.3.1 PDB: 1x1l_X 3ieu_A* 1x18_X Back     alignment and structure
>2gj8_A MNME, tRNA modification GTPase TRME; G-domain dimer, alpha-beta-sandwich, hydrolase; HET: GDP; 1.70A {Escherichia coli BL21} SCOP: c.37.1.8 PDB: 2gj9_A* 2gja_A* 1rfl_A Back     alignment and structure
>4a9a_A Ribosome-interacting GTPase 1; DRG-DFRP complex, ribosome binding GTPase; 2.67A {Saccharomyces cerevisiae} Back     alignment and structure
>3pqc_A Probable GTP-binding protein ENGB; rossmann fold, GTPase, cell cycle, hydrolase; HET: GDP; 1.90A {Thermotoga maritima} PDB: 3pr1_A Back     alignment and structure
>1svi_A GTP-binding protein YSXC; ENGB, GTPase, GDP, hydrolase; HET: GDP; 1.95A {Bacillus subtilis} SCOP: c.37.1.8 PDB: 1sul_A* 1svw_A* Back     alignment and structure
>4dcu_A GTP-binding protein ENGA; GTPase, GDP, protein binding, hydrolase; HET: GDP; 2.00A {Bacillus subtilis} PDB: 4dct_A* 4dcs_A* 4dcv_A* 2hjg_A* Back     alignment and structure
>2hjg_A GTP-binding protein ENGA; GTPase ENGA KH-domain, hydrolase; HET: GDP; 2.50A {Bacillus subtilis} Back     alignment and structure
>1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1 Back     alignment and structure
>2qu8_A Putative nucleolar GTP-binding protein 1; GTPase, malaria, structural genomics, structural genomics consortium, SGC, unknown function; HET: GDP; 2.01A {Plasmodium falciparum} Back     alignment and structure
>2qtf_A Protein HFLX, GTP-binding protein; beta-alpha-barrels, nucleotide-binding, nucleotide binding protein; 2.00A {Sulfolobus solfataricus P2} PDB: 2qth_A* 3kxi_A* 3kxl_A 3kxk_A Back     alignment and structure
>2e87_A Hypothetical protein PH1320; GTP-binding, GTPase, OBG, bundle, GDP, complex, structural G NPPSFA; HET: GDP; 2.35A {Pyrococcus horikoshii} Back     alignment and structure
>2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus} Back     alignment and structure
>1svi_A GTP-binding protein YSXC; ENGB, GTPase, GDP, hydrolase; HET: GDP; 1.95A {Bacillus subtilis} SCOP: c.37.1.8 PDB: 1sul_A* 1svw_A* Back     alignment and structure
>3j2k_7 ERF3, eukaryotic polypeptide chain release factor 3; rabbit 80S ribosome, ribosome-translation complex; 17.00A {Oryctolagus cuniculus} Back     alignment and structure
>3pqc_A Probable GTP-binding protein ENGB; rossmann fold, GTPase, cell cycle, hydrolase; HET: GDP; 1.90A {Thermotoga maritima} PDB: 3pr1_A Back     alignment and structure
>3iby_A Ferrous iron transport protein B; G protein, G domain, iron uptake, cell inner membrane, cell GTP-binding, ION transport, membrane; 2.50A {Legionella pneumophila} Back     alignment and structure
>1zj6_A ADP-ribosylation factor-like protein 5; ARL, GTP-binding, transport protein; HET: G3D; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1zd9_A ADP-ribosylation factor-like 10B; transport protein, GDP-binding, membrane trafficking, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2al7_A* 2h18_A* Back     alignment and structure
>4dhe_A Probable GTP-binding protein ENGB; melioidosis, RAS-like GTPase, cell division, cell cycle, SEP GTP-binding; 2.20A {Burkholderia thailandensis} Back     alignment and structure
>1wf3_A GTP-binding protein; GTPase, riken structural genomics/prote initiative, RSGI, structural genomics, hydrolase; HET: GNP; 1.88A {Thermus thermophilus} SCOP: c.37.1.8 d.52.3.1 Back     alignment and structure
>4bas_A ADP-ribosylation factor, putative (small GTPase, putative); hydrolase; HET: GNP; 2.00A {Trypanosoma brucei TREU927} Back     alignment and structure
>3i8s_A Ferrous iron transport protein B; GTPase, GPCR, iron uptake, FEO, cell inner membrane, cell ME GTP-binding, ION transport, membrane; 1.80A {Escherichia coli} PDB: 3i8x_A* 3i92_A* 3hyr_A 3hyt_A* 2wic_A* 2wib_A* 2wia_A* Back     alignment and structure
>3sjy_A Translation initiation factor 2 subunit gamma; zinc finger, initiate translation, tRNA binding, mRNA bindin binding; HET: GCP GDP; 2.00A {Sulfolobus solfataricus P2} PDB: 3pen_A* 3sjz_A* 2qn6_A* 2aho_A 2qmu_A* 2plf_A* 3v11_A* 3i1f_A* 3cw2_A 2pmd_A* 3p3m_A* 3qsy_A* Back     alignment and structure
>3t1o_A Gliding protein MGLA; G domain containing protein, bacterial GTPase, bacterial POL motility, POLE localisation, alpha/beta protein; HET: GDP; 1.90A {Thermus thermophilus} PDB: 3t12_A* 3t1q_A* 3t1t_A* 3t1v_A* Back     alignment and structure
>3iev_A GTP-binding protein ERA; ERA, GTPase, KH domain, anti-SD, 16S rRNA, 30S ribosome ASSE GTP-binding, nucleotide-binding; HET: GNP; 1.90A {Aquifex aeolicus} PDB: 3r9w_A* 3r9x_A* Back     alignment and structure
>3t5g_A GTP-binding protein RHEB; immunoglobulin-like beta sandwitch, PDE delta, RHEB; HET: GDP FAR; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 1xtq_A* 1xtr_A* 1xts_A* 2l0x_A* 3sea_A* Back     alignment and structure
>1r8s_A ADP-ribosylation factor 1; protein transport/exchange factor, protein transport-exchang complex; HET: GDP; 1.46A {Bos taurus} SCOP: c.37.1.8 PDB: 1re0_A* 1s9d_A* 1u81_A* 1r8q_A* 1rrf_A* 1rrg_A* 1hur_A* 1o3y_A* 1j2j_A* 2j59_A* 1mr3_F* 2k5u_A* 3lrp_A* 3tjz_A* 3rd1_A* 2ksq_A* 2a5d_A* 2a5f_A* 2j5x_A* 1e0s_A* ... Back     alignment and structure
>1z0f_A RAB14, member RAS oncogene family; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 2.15A {Homo sapiens} SCOP: c.37.1.8 PDB: 2aed_A* 4drz_A* Back     alignment and structure
>2h57_A ADP-ribosylation factor-like protein 6; GTP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GTP; 2.00A {Homo sapiens} Back     alignment and structure
>2gj8_A MNME, tRNA modification GTPase TRME; G-domain dimer, alpha-beta-sandwich, hydrolase; HET: GDP; 1.70A {Escherichia coli BL21} SCOP: c.37.1.8 PDB: 2gj9_A* 2gja_A* 1rfl_A Back     alignment and structure
>1upt_A ARL1, ADP-ribosylation factor-like protein 1; hydrolase/protein-binding, complex (GTPase/golgin), golgin-245, GRIP, golgin, GTPase, G-protein; HET: GTP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1r4a_A* Back     alignment and structure
>2efe_B Small GTP-binding protein-like; GEF, GTPase, VPS9, nucleotide, transport protein; HET: GNH; 2.08A {Arabidopsis thaliana} PDB: 2efd_B 2efc_B* 2efh_B* Back     alignment and structure
>1ksh_A ARF-like protein 2; small GTPase, small GTP-binding protein, ARF family; HET: CME GDP; 1.80A {Mus musculus} SCOP: c.37.1.8 PDB: 1ksg_A* 1ksj_A* 3doe_A* 3dof_A* Back     alignment and structure
>2f7s_A C25KG, RAS-related protein RAB-27B; G-protein, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2iez_A* Back     alignment and structure
>2qtf_A Protein HFLX, GTP-binding protein; beta-alpha-barrels, nucleotide-binding, nucleotide binding protein; 2.00A {Sulfolobus solfataricus P2} PDB: 2qth_A* 3kxi_A* 3kxl_A 3kxk_A Back     alignment and structure
>3iby_A Ferrous iron transport protein B; G protein, G domain, iron uptake, cell inner membrane, cell GTP-binding, ION transport, membrane; 2.50A {Legionella pneumophila} Back     alignment and structure
>3clv_A RAB5 protein, putative; malaria, GTPase, structural genomics, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.89A {Plasmodium falciparum} Back     alignment and structure
>2h17_A ADP-ribosylation factor-like protein 5A; GDP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GDP; 1.70A {Homo sapiens} PDB: 2h16_A* 1z6y_A* 1yzg_A* Back     alignment and structure
>3def_A T7I23.11 protein; chloroplast, TOC33, GTPase, hydrolase; HET: GDP; 1.96A {Arabidopsis thaliana} PDB: 3bb3_A* 3bb4_A* 2j3e_A* Back     alignment and structure
>1h65_A Chloroplast outer envelope protein OEP34; GTPase, translocon; HET: GDP; 2.0A {Pisum sativum} SCOP: c.37.1.8 PDB: 3bb1_A* Back     alignment and structure
>1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8 Back     alignment and structure
>3i8s_A Ferrous iron transport protein B; GTPase, GPCR, iron uptake, FEO, cell inner membrane, cell ME GTP-binding, ION transport, membrane; 1.80A {Escherichia coli} PDB: 3i8x_A* 3i92_A* 3hyr_A 3hyt_A* 2wic_A* 2wib_A* 2wia_A* Back     alignment and structure
>3p26_A Elongation factor 1 alpha-like protein; GTP/GDP binding domain, beta-barrel, translational GTPase, D structural genomics; 2.50A {Saccharomyces cerevisiae} PDB: 3p27_A* Back     alignment and structure
>2cxx_A Probable GTP-binding protein ENGB; structural genomics, NPPSFA, national P protein structural and functional analyses; HET: GDP; 1.70A {Pyrococcus horikoshii} SCOP: c.37.1.8 Back     alignment and structure
>3dz8_A RAS-related protein RAB-3B; GDP, GTPase, structural genomics consortium, SGC, cell GTP-binding, lipoprotein, membrane, methylation; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3bc1_A RAS-related protein RAB-27A; RAB27, GTPase, RAB, signaling protein, GDPNP, SLP2A, exophil GTP-binding, lipoprotein, membrane, methylation; HET: GNP; 1.80A {Mus musculus} PDB: 2iey_A* 2if0_A* 2zet_A* Back     alignment and structure
>1ega_A Protein (GTP-binding protein ERA); GTPase, RNA-binding, RAS-like, hydrolase; 2.40A {Escherichia coli} SCOP: c.37.1.8 d.52.3.1 PDB: 1x1l_X 3ieu_A* 1x18_X Back     alignment and structure
>3tkl_A RAS-related protein RAB-1A; vesicle trafficking, protein transport-protein binding compl; HET: GTP; 2.18A {Homo sapiens} Back     alignment and structure
>3tr5_A RF-3, peptide chain release factor 3; protein synthesis, translation; HET: GDP; 2.11A {Coxiella burnetii} Back     alignment and structure
>1r2q_A RAS-related protein RAB-5A; GTPase, GNP, atomic resolution, protein transport; HET: GNP; 1.05A {Homo sapiens} SCOP: c.37.1.8 PDB: 1n6h_A* 1tu4_A* 1tu3_A* 1n6k_A* 1n6i_A* 1n6l_A* 1n6o_A* 1n6p_A* 1n6n_A* 1n6r_A* 3mjh_A* 1z0d_A* 1huq_A* 2hei_A* 1z07_A* Back     alignment and structure
>3a1s_A Iron(II) transport protein B; FEOB, iron transporter, small GTPase, G protein, GDI; HET: GDP; 1.50A {Thermotoga maritima} PDB: 3a1t_A* 3a1u_A* 3a1v_A* 3a1w_A Back     alignment and structure
>2fu5_C RAS-related protein RAB-8A; MSS4:RAB8 protein complex, GEF:GTPase nucleotide free complex; 2.00A {Mus musculus} SCOP: c.37.1.8 PDB: 3qbt_A* 3tnf_A* Back     alignment and structure
>3tw8_B RAS-related protein RAB-35; longin domain, RAB GTPase, guanine exchange factor; 2.10A {Homo sapiens} Back     alignment and structure
>3lxx_A GTPase IMAP family member 4; structural genomics consortium, SGC, coiled coil, GTP- binding, nucleotide-binding, immune system; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>2yc2_C IFT27, small RAB-related GTPase; transport protein, cilium, IFT complex; 2.59A {Chlamydomonas reinhardtii} PDB: 2yc4_C Back     alignment and structure
>2fg5_A RAB-22B, RAS-related protein RAB-31; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.80A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1f5n_A Interferon-induced guanylate-binding protein 1; GBP, GTP hydrolysis, GDP, GMP, dynamin related, large GTPase family. GMPPNP, GPPNHP.; HET: GNP; 1.70A {Homo sapiens} SCOP: a.114.1.1 c.37.1.8 PDB: 1dg3_A* 2b8w_A* 2b92_A* 2bc9_A* 2d4h_A* Back     alignment and structure
>2g6b_A RAS-related protein RAB-26; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, unknown function; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1z0j_A RAB-22, RAS-related protein RAB-22A; RAB GTPase, RAB22 GTPase, rabenosyn, endosomal trafficking; HET: GTP; 1.32A {Mus musculus} SCOP: c.37.1.8 PDB: 1yvd_A* Back     alignment and structure
>2xtp_A GTPase IMAP family member 2; immune system, G protein; HET: MSE; 1.50A {Homo sapiens} PDB: 2xto_A* 2xtm_A* 2xtn_A* 3p1j_A Back     alignment and structure
>2hxs_A RAB-26, RAS-related protein RAB-28; GTPase, signaling protein; HET: G3D; 1.10A {Homo sapiens} PDB: 2hy4_A* 3e5h_A* Back     alignment and structure
>2b6h_A ADP-ribosylation factor 5; membrane trafficking, GDP, structural genomics, structural G consortium, SGC, protein transport; HET: GDP; 1.76A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z6x_A* 3aq4_A* Back     alignment and structure
>2y8e_A RAB-protein 6, GH09086P, RAB6; hydrolase, nucleotide binding, GTP binding; HET: GNP; 1.39A {Drosophila melanogaster} PDB: 3cwz_A* 1yzq_A* 2gil_A* 2e9s_A* 2fe4_A* 2ffq_A* 1d5c_A* Back     alignment and structure
>3b1v_A Ferrous iron uptake transporter protein B; G protein, iron transport, GTPase, transmembrane, potassium; HET: GGM; 1.85A {Streptococcus thermophilus} PDB: 3b1w_A* 3lx5_A* 3lx8_A* 3ss8_A* 3b1z_A 3b1y_A* 3b1x_A* 3tah_A* Back     alignment and structure
>2nzj_A GTP-binding protein REM 1; GDP/GTP binding, GTP hydrolysis, RAD and GEM like GTP protein 1, structural genomics; HET: GDP; 2.50A {Homo sapiens} Back     alignment and structure
>2il1_A RAB12; G-protein, GDP, GTPase, predicted, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.10A {Homo sapiens} Back     alignment and structure
>3k53_A Ferrous iron transport protein B; GTPase fold, helical bundle, G-protein, prokaryote, GTP-BIND nucleotide-binding, metal transport; 2.70A {Pyrococcus furiosus} Back     alignment and structure
>1zun_B Sulfate adenylate transferase, subunit 1/adenylylsulfate kinase; beta barrel, switch domain, heterodimer, pyrophosphate, G protein; HET: GDP AGS; 2.70A {Pseudomonas syringae PV} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 Back     alignment and structure
>3lxx_A GTPase IMAP family member 4; structural genomics consortium, SGC, coiled coil, GTP- binding, nucleotide-binding, immune system; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>3a1s_A Iron(II) transport protein B; FEOB, iron transporter, small GTPase, G protein, GDI; HET: GDP; 1.50A {Thermotoga maritima} PDB: 3a1t_A* 3a1u_A* 3a1v_A* 3a1w_A Back     alignment and structure
>1kao_A RAP2A; GTP-binding protein, small G protein, GDP, RAS; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2rap_A* 3rap_R* Back     alignment and structure
>2a9k_A RAS-related protein RAL-A; bacterial ADP-ribosyltransferase, RAL, RHO, GD binding; HET: GDP NAD; 1.73A {Homo sapiens} SCOP: c.37.1.8 PDB: 2a78_A* Back     alignment and structure
>2gf9_A RAS-related protein RAB-3D; G-protein, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.53A {Homo sapiens} PDB: 3rab_A* Back     alignment and structure
>3gee_A MNME, tRNA modification GTPase MNME; G protein, cytoplasm, GTP- binding, hydrolase, magnesium, metal-binding, nucleotide- binding, potassium; HET: GDP FON; 2.95A {Chlorobium tepidum} PDB: 3gei_A* Back     alignment and structure
>2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A* Back     alignment and structure
>1wb1_A Translation elongation factor SELB; selenocysteine, protein synthesis, selenium, ribosome; HET: GDP DXC; 3.0A {Methanococcus maripaludis} SCOP: b.43.3.1 b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1wb2_A* 1wb3_A* Back     alignment and structure
>1u8z_A RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNHP, GDP, GTPase, signaling protein; HET: GDP; 1.50A {Saguinus oedipus} SCOP: c.37.1.8 PDB: 1u8y_A* 1u90_A* 1uad_A* 1zc3_A* 1zc4_A* 2kwi_A* 2ke5_A* Back     alignment and structure
>1moz_A ARL1, ADP-ribosylation factor-like protein 1; GTP-binding, protein binding; HET: GDP; 3.17A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>2o52_A RAS-related protein RAB-4B; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.20A {Homo sapiens} Back     alignment and structure
>1xzp_A Probable tRNA modification GTPase TRME; GTP-binding, THF-binding, hydrolase; 2.30A {Thermotoga maritima} SCOP: a.24.25.1 c.37.1.8 d.250.1.2 PDB: 1xzq_A* 1xzp_B 1xzq_B* Back     alignment and structure
>1wxq_A GTP-binding protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; 2.60A {Pyrococcus horikoshii} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>3k53_A Ferrous iron transport protein B; GTPase fold, helical bundle, G-protein, prokaryote, GTP-BIND nucleotide-binding, metal transport; 2.70A {Pyrococcus furiosus} Back     alignment and structure
>1lnz_A SPO0B-associated GTP-binding protein; GTPase, OBG, stringent factor, stress response, sporulation, large G-protein, structural genomics, PSI; HET: G4P; 2.60A {Bacillus subtilis} SCOP: b.117.1.1 c.37.1.8 Back     alignment and structure
>2c78_A Elongation factor TU-A; hydrolase, GTPase, translation elongation factor, protein synthesis, antibiotic, GTP-binding, nucleotide-binding; HET: GNP PUL; 1.4A {Thermus thermophilus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 2y0u_Z* 2y0w_Z* 2y0y_Z* 2y10_Z* 2y12_Z* 2y14_Z* 2y16_Z* 2y18_Z* 2wrn_Z* 2wrq_Z* 2c77_A* 1aip_A 1exm_A* 1ha3_A* 2xqd_Z* 3fic_Z* 4abr_Z* 1b23_P* 1ob5_A* 1ttt_A* ... Back     alignment and structure
>1ek0_A Protein (GTP-binding protein YPT51); vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase; HET: MHO GNP GDP; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>1wxq_A GTP-binding protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; 2.60A {Pyrococcus horikoshii} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>2oil_A CATX-8, RAS-related protein RAB-25; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.30A {Homo sapiens} Back     alignment and structure
>3t5d_A Septin-7; GTP-binding protein, cytoskeleton, signaling protein; HET: GDP; 3.30A {Homo sapiens} PDB: 3tw4_A* Back     alignment and structure
>1zbd_A Rabphilin-3A; G protein, effector, RABCDR, synaptic exocytosis, RAB protein, RAB3A; HET: GTP; 2.60A {Rattus norvegicus} SCOP: c.37.1.8 Back     alignment and structure
>1z06_A RAS-related protein RAB-33B; RAB GTPase, RAB33B GTPase, vesicular trafficking, protein transport; HET: GNP; 1.81A {Mus musculus} SCOP: c.37.1.8 PDB: 2g77_B* Back     alignment and structure
>3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A* Back     alignment and structure
>1m2o_B GTP-binding protein SAR1, GTP binding protein; zinc-finger, beta barrel, VWA domain, gelsolin domain,; HET: GNP; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 2qtv_B* Back     alignment and structure
>1c1y_A RAS-related protein RAP-1A; GTP-binding proteins, protein-protein complex, effectors, signaling protein; HET: GTP; 1.90A {Homo sapiens} SCOP: c.37.1.8 PDB: 3kuc_A* 1gua_A* 3cf6_R* 3brw_D* Back     alignment and structure
>2lkc_A Translation initiation factor IF-2; NMR {Geobacillus stearothermophilus} PDB: 2lkd_A* Back     alignment and structure
>2hup_A RAS-related protein RAB-43; G-protein, GDP, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.05A {Homo sapiens} Back     alignment and structure
>3izq_1 HBS1P, elongation factor 1 alpha-like protein; NO-GO mRNA decay, ribosomal protein,hydrolase; 9.50A {Saccharomyces cerevisiae} Back     alignment and structure
>2erx_A GTP-binding protein DI-RAS2; GTP hydrolysis, transport protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1fzq_A ADP-ribosylation factor-like protein 3; protein-GDP complex without magnesium, ARF family, RAS superfamily, G-domain, signaling protein; HET: MES GDP; 1.70A {Mus musculus} SCOP: c.37.1.8 PDB: 3bh7_A* 3bh6_A* Back     alignment and structure
>2wjg_A FEOB, ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GDP; 2.20A {Methanocaldococcus jannaschii} Back     alignment and structure
>4dsu_A GTPase KRAS, isoform 2B; small G-protein, signaling, hydrolase; HET: GDP; 1.70A {Homo sapiens} PDB: 4dsn_A* 4dst_A* 4dso_A* Back     alignment and structure
>2qu8_A Putative nucleolar GTP-binding protein 1; GTPase, malaria, structural genomics, structural genomics consortium, SGC, unknown function; HET: GDP; 2.01A {Plasmodium falciparum} Back     alignment and structure
>1f6b_A SAR1; gtpases, N-terminal helix, Mg-containing complex, protein transport; HET: GDP; 1.70A {Cricetulus griseus} SCOP: c.37.1.8 PDB: 2fmx_A* 2fa9_A* 2gao_A* Back     alignment and structure
>2bme_A RAB4A, RAS-related protein RAB4A; GTP-binding protein, vesicular transport, endocytosis, prenylation, protein transport, transport; HET: GNP; 1.57A {Homo sapiens} SCOP: c.37.1.8 PDB: 2bmd_A* 1yu9_A* 1z0k_A* Back     alignment and structure
>1jal_A YCHF protein; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; 2.40A {Haemophilus influenzae} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>1jwy_B Dynamin A GTPase domain; dynamin, GTPase, GDP, myosin, fusion-protein, hydrolase; HET: BGC ADP GDP; 2.30A {Dictyostelium discoideum} SCOP: c.37.1.8 PDB: 1jx2_B* Back     alignment and structure
>2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A* Back     alignment and structure
>2j1l_A RHO-related GTP-binding protein RHOD; GTPase, membrane, prenylation, hydrolase, nucleotide-binding, methylation, lipoprotein, endosome DYNA; HET: GDP; 2.5A {Homo sapiens} Back     alignment and structure
>2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus} Back     alignment and structure
>2bov_A RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, RAla, GTPase, ribosylating toxin, GTP-binding, lipoprotein, prenylation; HET: GDP; 2.66A {Homo sapiens} Back     alignment and structure
>1mh1_A RAC1; GTP-binding, GTPase, small G-protein, RHO family, RAS super family; HET: GNP; 1.38A {Homo sapiens} SCOP: c.37.1.8 PDB: 1hh4_A* 2p2l_A* 2h7v_A* 1g4u_R* 1i4d_D* 1i4l_D* 2vrw_A 1e96_A* 1i4t_D* 2rmk_A* 2yin_C 1ryf_A* 1ryh_A* 3su8_A* 3sua_A* 2fju_A* 1he1_C* 2nz8_A 1foe_B 3bji_C ... Back     alignment and structure
>3cph_A RAS-related protein SEC4; RAB GTPase, prenylation, vesicular transport, cytoplasm, cytoplasmic vesicle, exocytosis, GTP-binding; HET: GDP; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>2fn4_A P23, RAS-related protein R-RAS; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ery_A* Back     alignment and structure
>2nzj_A GTP-binding protein REM 1; GDP/GTP binding, GTP hydrolysis, RAD and GEM like GTP protein 1, structural genomics; HET: GDP; 2.50A {Homo sapiens} Back     alignment and structure
>3th5_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTPase, GTP binding, protein binding, signali protein; HET: GNP; 2.30A {Homo sapiens} Back     alignment and structure
>3t5d_A Septin-7; GTP-binding protein, cytoskeleton, signaling protein; HET: GDP; 3.30A {Homo sapiens} PDB: 3tw4_A* Back     alignment and structure
>2p5s_A RAS and EF-hand domain containing; G-protein, RAB, GDP, structural genomics, SGC, structural genomics consortium, signaling protein; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>3kkq_A RAS-related protein M-RAS; GTP-binding, GTPase, signaling protein; HET: GDP; 1.20A {Mus musculus} SCOP: c.37.1.8 PDB: 3kkp_A* 3kko_A* 3pit_A* 3pir_A* 1x1r_A* 1x1s_A* Back     alignment and structure
>2gf0_A GTP-binding protein DI-RAS1; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, transport protein; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3con_A GTPase NRAS; structural genomics consortium, SGC, GDP, oncogene, disease mutation, golgi apparatus, GTP-binding, lipoprotein membrane, methylation; HET: GDP; 1.65A {Homo sapiens} PDB: 2pmx_A* 3gft_A* 4q21_A* Back     alignment and structure
>2x77_A ADP-ribosylation factor; GTP-binding protein, small GTPase, nucleotide-binding; HET: GDP; 2.10A {Leishmania major} Back     alignment and structure
>2a5j_A RAS-related protein RAB-2B; GTPase, signal transduction, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.50A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z0a_A* Back     alignment and structure
>1g16_A RAS-related protein SEC4; G protein RAB, signaling protein, endocytosis/exocytosis complex; HET: GDP; 1.80A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1g17_A* 2ocy_C 2eqb_A Back     alignment and structure
>3gj0_A GTP-binding nuclear protein RAN; G protein, GDP, acetylation, cytoplasm, HOST- virus interaction, nucleotide-binding, nucleus, phosphoprotein; HET: GDP; 1.48A {Homo sapiens} SCOP: c.37.1.8 PDB: 3gj3_A* 3gj5_A* 3gj4_A* 3gj6_A* 3gj7_A* 3gj8_A* 1i2m_A 1a2k_C 1ibr_A* 1k5d_A* 1k5g_A* 1qbk_C* 3a6p_C* 3ch5_A* 4gmx_A* 4gpt_A* 4hat_A* 4hau_A* 4hav_A* 4haw_A* ... Back     alignment and structure
>3b1v_A Ferrous iron uptake transporter protein B; G protein, iron transport, GTPase, transmembrane, potassium; HET: GGM; 1.85A {Streptococcus thermophilus} PDB: 3b1w_A* 3lx5_A* 3lx8_A* 3ss8_A* 3b1z_A 3b1y_A* 3b1x_A* 3tah_A* Back     alignment and structure
>2bcg_Y Protein YP2, GTP-binding protein YPT1; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ukv_Y* 3cue_F* 1yzn_A* 3sfv_A* 2wwx_A 2fol_A* 3nkv_A* 3jza_A* 2rhd_A* Back     alignment and structure
>3o47_A ADP-ribosylation factor GTPase-activating protein ribosylation factor 1; structural genomics consortium, GTPase activation; HET: GDP; 2.80A {Homo sapiens} Back     alignment and structure
>2aka_B Dynamin-1; fusion protein, GTPase domain, myosin, contractIle protein; 1.90A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 3l43_A* Back     alignment and structure
>3q72_A GTP-binding protein RAD; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.66A {Homo sapiens} SCOP: c.37.1.8 PDB: 3q7p_A* 3q7q_A* 2gjs_A* 2dpx_A* Back     alignment and structure
>1f60_A Elongation factor EEF1A; protein-protein complex, translation; 1.67A {Saccharomyces cerevisiae} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1g7c_A* 1ije_A* 1ijf_A* 2b7b_A* 2b7c_A Back     alignment and structure
>3reg_A RHO-like small GTPase; cytoskeleton, nucleotide-binding, GTP-binding, signaling Pro lipoprotein, prenylation; HET: GSP; 1.80A {Entamoeba histolytica} PDB: 3ref_B* 4dvg_A* Back     alignment and structure
>2xtp_A GTPase IMAP family member 2; immune system, G protein; HET: MSE; 1.50A {Homo sapiens} PDB: 2xto_A* 2xtm_A* 2xtn_A* 3p1j_A Back     alignment and structure
>1kk1_A EIF2gamma; initiation of translation; HET: GNP; 1.80A {Pyrococcus abyssi} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1kjz_A* 1kk2_A* 1kk3_A* 1kk0_A* 2d74_A 2dcu_A* Back     alignment and structure
>2atv_A RERG, RAS-like estrogen-regulated growth inhibitor; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>4djt_A GTP-binding nuclear protein GSP1; structural genomics, seattle structural genomics center for infectious disease, ssgcid, RAN family; HET: GDP; 1.80A {Encephalitozoon cuniculi} Back     alignment and structure
>2www_A Methylmalonic aciduria type A protein, mitochondrial; transport protein, nucleotide-binding; HET: GDP 2PE; 2.64A {Homo sapiens} Back     alignment and structure
>3geh_A MNME, tRNA modification GTPase MNME; G protein, U34, GTP-binding, HYDR magnesium, metal-binding, nucleotide-binding, potassium, TR processing; HET: GDP FON; 3.20A {Nostoc SP} Back     alignment and structure
>2aka_B Dynamin-1; fusion protein, GTPase domain, myosin, contractIle protein; 1.90A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 3l43_A* Back     alignment and structure
>4a9a_A Ribosome-interacting GTPase 1; DRG-DFRP complex, ribosome binding GTPase; 2.67A {Saccharomyces cerevisiae} Back     alignment and structure
>1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A* Back     alignment and structure
>2ohf_A Protein OLA1, GTP-binding protein 9; ATPase, GTPase, P-loop, OBG-like, hydrolase; HET: ACP; 2.70A {Homo sapiens} Back     alignment and structure
>1z08_A RAS-related protein RAB-21; RAB GTPase, vesicular trafficking, protein transport; HET: GNP; 1.80A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ot3_B 1yzu_A* 1z0i_A 1yzt_A* Back     alignment and structure
>2wjg_A FEOB, ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GDP; 2.20A {Methanocaldococcus jannaschii} Back     alignment and structure
>2fv8_A H6, RHO-related GTP-binding protein RHOB; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3q85_A GTP-binding protein REM 2; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.76A {Mus musculus} SCOP: c.37.1.8 PDB: 4aii_A* Back     alignment and structure
>3q72_A GTP-binding protein RAD; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.66A {Homo sapiens} SCOP: c.37.1.8 PDB: 3q7p_A* 3q7q_A* 2gjs_A* 2dpx_A* Back     alignment and structure
>3ihw_A Centg3; RAS, centaurin, GTPase, structural genomics, structural genomics consortium, SGC, alternative splicing, ANK repeat, cytoplasm, GTP-binding; 1.92A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>3bwd_D RAC-like GTP-binding protein ARAC6; G domain, cytoplasm, lipoprotein, membrane, methylation, nucleotide-binding, prenylation, ----; HET: GDP; 1.53A {Arabidopsis thaliana} PDB: 2nty_C* 2wbl_C Back     alignment and structure
>2gco_A H9, RHO-related GTP-binding protein RHOC; GTPase,signaling protein, signaling Pro; HET: GNP; 1.40A {Homo sapiens} PDB: 2gcn_A* 2gcp_A* 1z2c_A* 1x86_B 2rgn_C* 1lb1_B 1s1c_A* 3kz1_E* 3lxr_A* 3lwn_A* 3lw8_A* 1cxz_A* 1a2b_A* 1ow3_B* 1ftn_A* 1cc0_A* 3msx_A* 1xcg_B 3t06_B 1tx4_B* ... Back     alignment and structure
>3qq5_A Small GTP-binding protein; hydrogenase, H-cluster, HYDA maturation, GTP-binding domain, maturation enzyme, oxidoreductase; 2.99A {Thermotoga neapolitana} Back     alignment and structure
>3cpj_B GTP-binding protein YPT31/YPT8; RAB GTPase, prenylation, vesicular transport, acetylation, golgi apparatus, lipoprotein, membrane; HET: GDP; 2.35A {Saccharomyces cerevisiae} Back     alignment and structure
>3q3j_B RHO-related GTP-binding protein RHO6; RAS-binding domain, plexin, small GTPase, structural genomic consortium, SGC; HET: GNP; 1.97A {Homo sapiens} PDB: 2rex_B* 2cls_A* Back     alignment and structure
>4gzl_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTP binding, membrane, hydrolase; HET: GNP; 2.00A {Homo sapiens} PDB: 3th5_A* 4gzm_A* Back     alignment and structure
>1ky3_A GTP-binding protein YPT7P; vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase, endocytosis/exocytosis complex; HET: GDP; 1.35A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ky2_A* Back     alignment and structure
>1vg8_A RAS-related protein RAB-7; GTP-binding protein, protein transport; HET: GNP; 1.70A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 1vg0_B* 3law_A* 1t91_A* 1yhn_A* 1vg1_A* 1vg9_B* Back     alignment and structure
>1wms_A RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, protein transport; HET: GDP; 1.25A {Homo sapiens} SCOP: c.37.1.8 PDB: 1s8f_A* 1yzl_A* 2ocb_A* Back     alignment and structure
>2ew1_A RAS-related protein RAB-30; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1jny_A EF-1-alpha, elongation factor 1-alpha, EF-TU, TUF-1; GTPase, alpha/beta structure, protein biosynthesis, translation; HET: GDP; 1.80A {Sulfolobus solfataricus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1skq_A* 3agj_A* Back     alignment and structure
>2iwr_A Centaurin gamma 1; ANK repeat, zinc-finger, GTP-binding, polymorphism, nucleotide-binding, alternative splicing, protein transport; HET: CAF; 1.5A {Homo sapiens} PDB: 2bmj_A Back     alignment and structure
>3oes_A GTPase rhebl1; small GTPase, structural genomics, structural genomics conso SGC, hydrolase; HET: GNP; 2.30A {Homo sapiens} Back     alignment and structure
>2ywe_A GTP-binding protein LEPA; G domain, beta-barrel, ferredoxin-like domain, structural GE NPPSFA; 2.05A {Aquifex aeolicus} PDB: 2ywf_A* 2ywg_A* 2ywh_A* Back     alignment and structure
>1z0j_A RAB-22, RAS-related protein RAB-22A; RAB GTPase, RAB22 GTPase, rabenosyn, endosomal trafficking; HET: GTP; 1.32A {Mus musculus} SCOP: c.37.1.8 PDB: 1yvd_A* Back     alignment and structure
>1s0u_A EIF-2-gamma, translation initiation factor 2 gamma subunit; GTPase, EF-1A, tRNA; 2.40A {Methanocaldococcus jannaschii} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 Back     alignment and structure
>1d2e_A Elongation factor TU (EF-TU); G-protein, beta-barrel, RNA binding protein; HET: GDP; 1.94A {Bos taurus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1xb2_A* 2hcj_A* 2hdn_A* Back     alignment and structure
>2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ... Back     alignment and structure
>1jwy_B Dynamin A GTPase domain; dynamin, GTPase, GDP, myosin, fusion-protein, hydrolase; HET: BGC ADP GDP; 2.30A {Dictyostelium discoideum} SCOP: c.37.1.8 PDB: 1jx2_B* Back     alignment and structure
>1ni3_A YCHF GTPase, YCHF GTP-binding protein; structural genomics, GTP1OBG, PSI, protein structure initiative; 2.80A {Schizosaccharomyces pombe} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>2x2e_A Dynamin-1; nitration, hydrolase, membrane fission, nucleotide-binding, endocytosis, motor protein; HET: GDP; 2.00A {Homo sapiens} PDB: 2x2f_A* 3zyc_A* 3zys_A Back     alignment and structure
>1ek0_A Protein (GTP-binding protein YPT51); vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase; HET: MHO GNP GDP; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans} Back     alignment and structure
>2p67_A LAO/AO transport system kinase; ARGK, structural GEN PSI-2, protein structure initiative, NEW YORK SGX research for structural genomics; 1.80A {Escherichia coli} SCOP: c.37.1.10 Back     alignment and structure
>3mca_A HBS1, elongation factor 1 alpha-like protein; protein protein complex, translation regulation; 2.74A {Schizosaccharomyces pombe} Back     alignment and structure
>2q3h_A RAS homolog gene family, member U; GTPase, structural genomics, structural genomics consortium,; HET: GDP; 1.73A {Homo sapiens} Back     alignment and structure
>2elf_A Protein translation elongation factor 1A; tRNA, pyrrolysine, structural genomics, NPPSFA; HET: CIT; 1.70A {Methanosarcina mazei} Back     alignment and structure
>2atx_A Small GTP binding protein TC10; GTPase, P-loop, alpha-beta, hydrolase; HET: GNP; 2.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3r7w_A Gtpase1, GTP-binding protein GTR1; RAG gtpases, GTR1P, GTR2P, MTOR, protein transport; HET: GNP; 2.77A {Saccharomyces cerevisiae} PDB: 4arz_A* Back     alignment and structure
>3c5c_A RAS-like protein 12; GDP, GTPase, structural genomics consortium, SGC, limited proteolysis, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.85A {Homo sapiens} Back     alignment and structure
>3izy_P Translation initiation factor IF-2, mitochondrial; E coli, RNA, ribosomal; 10.80A {Bos taurus} Back     alignment and structure
>2fh5_B SR-beta, signal recognition particle receptor beta subunit; endomembrane targeting, GTPase, GAP, longin domain, SEDL, transport protein; HET: GTP; 2.45A {Mus musculus} SCOP: c.37.1.8 PDB: 2go5_2 Back     alignment and structure
>2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>2j69_A Bacterial dynamin-like protein; FZO, FZL, GTPase, hydrolase; 3.0A {Nostoc punctiforme} PDB: 2j68_A 2w6d_A* Back     alignment and structure
>1moz_A ARL1, ADP-ribosylation factor-like protein 1; GTP-binding, protein binding; HET: GDP; 3.17A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>2lkc_A Translation initiation factor IF-2; NMR {Geobacillus stearothermophilus} PDB: 2lkd_A* Back     alignment and structure
>1zj6_A ADP-ribosylation factor-like protein 5; ARL, GTP-binding, transport protein; HET: G3D; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1fzq_A ADP-ribosylation factor-like protein 3; protein-GDP complex without magnesium, ARF family, RAS superfamily, G-domain, signaling protein; HET: MES GDP; 1.70A {Mus musculus} SCOP: c.37.1.8 PDB: 3bh7_A* 3bh6_A* Back     alignment and structure
>2x77_A ADP-ribosylation factor; GTP-binding protein, small GTPase, nucleotide-binding; HET: GDP; 2.10A {Leishmania major} Back     alignment and structure
>1upt_A ARL1, ADP-ribosylation factor-like protein 1; hydrolase/protein-binding, complex (GTPase/golgin), golgin-245, GRIP, golgin, GTPase, G-protein; HET: GTP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1r4a_A* Back     alignment and structure
>2fg5_A RAB-22B, RAS-related protein RAB-31; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.80A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2h17_A ADP-ribosylation factor-like protein 5A; GDP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GDP; 1.70A {Homo sapiens} PDB: 2h16_A* 1z6y_A* 1yzg_A* Back     alignment and structure
>1wms_A RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, protein transport; HET: GDP; 1.25A {Homo sapiens} SCOP: c.37.1.8 PDB: 1s8f_A* 1yzl_A* 2ocb_A* Back     alignment and structure
>1kao_A RAP2A; GTP-binding protein, small G protein, GDP, RAS; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2rap_A* 3rap_R* Back     alignment and structure
>1r5b_A Eukaryotic peptide chain release factor GTP-bindi subunit; translation termination, peptide release, GTPase, translatio; 2.35A {Schizosaccharomyces pombe} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1r5n_A* 1r5o_A* 3e20_A Back     alignment and structure
>2j69_A Bacterial dynamin-like protein; FZO, FZL, GTPase, hydrolase; 3.0A {Nostoc punctiforme} PDB: 2j68_A 2w6d_A* Back     alignment and structure
>1g16_A RAS-related protein SEC4; G protein RAB, signaling protein, endocytosis/exocytosis complex; HET: GDP; 1.80A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1g17_A* 2ocy_C 2eqb_A Back     alignment and structure
>3gj0_A GTP-binding nuclear protein RAN; G protein, GDP, acetylation, cytoplasm, HOST- virus interaction, nucleotide-binding, nucleus, phosphoprotein; HET: GDP; 1.48A {Homo sapiens} SCOP: c.37.1.8 PDB: 3gj3_A* 3gj5_A* 3gj4_A* 3gj6_A* 3gj7_A* 3gj8_A* 1i2m_A 1a2k_C 1ibr_A* 1k5d_A* 1k5g_A* 1qbk_C* 3a6p_C* 3ch5_A* 4gmx_A* 4gpt_A* 4hat_A* 4hau_A* 4hav_A* 4haw_A* ... Back     alignment and structure
>3zvr_A Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mitochondrial fission, GT stalk, PH, BSE, membrane fission; HET: 1PE; 3.10A {Rattus norvegicus} PDB: 3snh_A Back     alignment and structure
>1z0f_A RAB14, member RAS oncogene family; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 2.15A {Homo sapiens} SCOP: c.37.1.8 PDB: 2aed_A* 4drz_A* Back     alignment and structure
>2qpt_A EH domain-containing protein-2; protein-nucleotide complex, membrane protein, endocytosis; HET: ANP; 3.10A {Mus musculus} Back     alignment and structure
>2p5s_A RAS and EF-hand domain containing; G-protein, RAB, GDP, structural genomics, SGC, structural genomics consortium, signaling protein; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>2j0v_A RAC-like GTP-binding protein ARAC7; nucleotide-binding protein, ROP9, atrac7, membrane, palmitate, RHO GTPase; HET: GDP; 1.78A {Arabidopsis thaliana} Back     alignment and structure
>3cph_A RAS-related protein SEC4; RAB GTPase, prenylation, vesicular transport, cytoplasm, cytoplasmic vesicle, exocytosis, GTP-binding; HET: GDP; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>1ksh_A ARF-like protein 2; small GTPase, small GTP-binding protein, ARF family; HET: CME GDP; 1.80A {Mus musculus} SCOP: c.37.1.8 PDB: 1ksg_A* 1ksj_A* 3doe_A* 3dof_A* Back     alignment and structure
>3l0i_B RAS-related protein RAB-1A; GEF-GDF-RAB complex, GTP-binding, guanine-nucleotide exchang GDI-displacement factor; 2.85A {Homo sapiens} Back     alignment and structure
>3cbq_A GTP-binding protein REM 2; FLJ38964A, structural genomics consortium, SGC, GDP, membrane, nucleotide-binding, nucleotide binding protein; HET: GDP; 1.82A {Homo sapiens} Back     alignment and structure
>2g6b_A RAS-related protein RAB-26; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, unknown function; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans} Back     alignment and structure
>1r2q_A RAS-related protein RAB-5A; GTPase, GNP, atomic resolution, protein transport; HET: GNP; 1.05A {Homo sapiens} SCOP: c.37.1.8 PDB: 1n6h_A* 1tu4_A* 1tu3_A* 1n6k_A* 1n6i_A* 1n6l_A* 1n6o_A* 1n6p_A* 1n6n_A* 1n6r_A* 3mjh_A* 1z0d_A* 1huq_A* 2hei_A* 1z07_A* Back     alignment and structure
>3llu_A RAS-related GTP-binding protein C; structural genomics consortium, SGC, cytoplasm, nucleotide-binding, nucleus, phosphoprotein; HET: GNP; 1.40A {Homo sapiens} PDB: 2q3f_A* Back     alignment and structure
>1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A* Back     alignment and structure
>2www_A Methylmalonic aciduria type A protein, mitochondrial; transport protein, nucleotide-binding; HET: GDP 2PE; 2.64A {Homo sapiens} Back     alignment and structure
>3tw8_B RAS-related protein RAB-35; longin domain, RAB GTPase, guanine exchange factor; 2.10A {Homo sapiens} Back     alignment and structure
>1m7b_A RND3/RHOE small GTP-binding protein; small GTPase, signaling protein; HET: GTP; 2.00A {Homo sapiens} SCOP: c.37.1.8 PDB: 2v55_B* Back     alignment and structure
>3dpu_A RAB family protein; roccor, G-domain, COR, GTP-binding, nucleotide-binding, SIGN protein; 2.90A {Chlorobaculum tepidum} Back     alignment and structure
>2dby_A GTP-binding protein; GDP, structural genomics, NPPSFA, natio project on protein structural and functional analyses; HET: GDP; 1.76A {Thermus thermophilus} PDB: 2dwq_A Back     alignment and structure
>2wkq_A NPH1-1, RAS-related C3 botulinum toxin substrate 1; transferase, cell adhesion, nucleotide-binding, protein engineering, RAS superfamily LOV2; HET: GTP FMN; 1.60A {Avena sativa} PDB: 2wkr_A* 2wkp_A* Back     alignment and structure
>2qpt_A EH domain-containing protein-2; protein-nucleotide complex, membrane protein, endocytosis; HET: ANP; 3.10A {Mus musculus} Back     alignment and structure
>3r7w_A Gtpase1, GTP-binding protein GTR1; RAG gtpases, GTR1P, GTR2P, MTOR, protein transport; HET: GNP; 2.77A {Saccharomyces cerevisiae} PDB: 4arz_A* Back     alignment and structure
>1lnz_A SPO0B-associated GTP-binding protein; GTPase, OBG, stringent factor, stress response, sporulation, large G-protein, structural genomics, PSI; HET: G4P; 2.60A {Bacillus subtilis} SCOP: b.117.1.1 c.37.1.8 Back     alignment and structure
>2efe_B Small GTP-binding protein-like; GEF, GTPase, VPS9, nucleotide, transport protein; HET: GNH; 2.08A {Arabidopsis thaliana} PDB: 2efd_B 2efc_B* 2efh_B* Back     alignment and structure
>3qq5_A Small GTP-binding protein; hydrogenase, H-cluster, HYDA maturation, GTP-binding domain, maturation enzyme, oxidoreductase; 2.99A {Thermotoga neapolitana} Back     alignment and structure
>2cxx_A Probable GTP-binding protein ENGB; structural genomics, NPPSFA, national P protein structural and functional analyses; HET: GDP; 1.70A {Pyrococcus horikoshii} SCOP: c.37.1.8 Back     alignment and structure
>2il1_A RAB12; G-protein, GDP, GTPase, predicted, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.10A {Homo sapiens} Back     alignment and structure
>4dsu_A GTPase KRAS, isoform 2B; small G-protein, signaling, hydrolase; HET: GDP; 1.70A {Homo sapiens} PDB: 4dsn_A* 4dst_A* 4dso_A* Back     alignment and structure
>1gwn_A RHO-related GTP-binding protein RHOE; GTPase, inactive GTPase, signal transduction; HET: GTP; 2.1A {Mus musculus} SCOP: c.37.1.8 Back     alignment and structure
>2gf9_A RAS-related protein RAB-3D; G-protein, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.53A {Homo sapiens} PDB: 3rab_A* Back     alignment and structure
>1zbd_A Rabphilin-3A; G protein, effector, RABCDR, synaptic exocytosis, RAB protein, RAB3A; HET: GTP; 2.60A {Rattus norvegicus} SCOP: c.37.1.8 Back     alignment and structure
>1u8z_A RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNHP, GDP, GTPase, signaling protein; HET: GDP; 1.50A {Saguinus oedipus} SCOP: c.37.1.8 PDB: 1u8y_A* 1u90_A* 1uad_A* 1zc3_A* 1zc4_A* 2kwi_A* 2ke5_A* Back     alignment and structure
>3t34_A Dynamin-related protein 1A, linker, dynamin-relat 1A; dynamin-like protein 1A, GTPase, membrane fission, motor Pro; HET: GDP; 2.40A {Arabidopsis thaliana} PDB: 3t35_A* Back     alignment and structure
>4djt_A GTP-binding nuclear protein GSP1; structural genomics, seattle structural genomics center for infectious disease, ssgcid, RAN family; HET: GDP; 1.80A {Encephalitozoon cuniculi} Back     alignment and structure
>3clv_A RAB5 protein, putative; malaria, GTPase, structural genomics, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.89A {Plasmodium falciparum} Back     alignment and structure
>1z08_A RAS-related protein RAB-21; RAB GTPase, vesicular trafficking, protein transport; HET: GNP; 1.80A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ot3_B 1yzu_A* 1z0i_A 1yzt_A* Back     alignment and structure
>3t5g_A GTP-binding protein RHEB; immunoglobulin-like beta sandwitch, PDE delta, RHEB; HET: GDP FAR; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 1xtq_A* 1xtr_A* 1xts_A* 2l0x_A* 3sea_A* Back     alignment and structure
>1nrj_B SR-beta, signal recognition particle receptor beta subunit; transmembrane, endoplasmic reticulum, GTP-binding; HET: GTP; 1.70A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>3avx_A Elongation factor TS, elongation factor TU, linke replicase; RNA polymerase, translation, transferase-RNA complex; HET: GH3; 2.41A {Escherichia coli O157} PDB: 3agq_A 3agp_A* 3avu_A 3avv_A 3avt_A* 3avw_A* 3avy_A* 3mmp_A* 3mmp_G* 1efu_B Back     alignment and structure
>1x3s_A RAS-related protein RAB-18; GTPase, GNP, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GNP; 1.32A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1z06_A RAS-related protein RAB-33B; RAB GTPase, RAB33B GTPase, vesicular trafficking, protein transport; HET: GNP; 1.81A {Mus musculus} SCOP: c.37.1.8 PDB: 2g77_B* Back     alignment and structure
>4bas_A ADP-ribosylation factor, putative (small GTPase, putative); hydrolase; HET: GNP; 2.00A {Trypanosoma brucei TREU927} Back     alignment and structure
>2h57_A ADP-ribosylation factor-like protein 6; GTP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GTP; 2.00A {Homo sapiens} Back     alignment and structure
>2y8e_A RAB-protein 6, GH09086P, RAB6; hydrolase, nucleotide binding, GTP binding; HET: GNP; 1.39A {Drosophila melanogaster} PDB: 3cwz_A* 1yzq_A* 2gil_A* 2e9s_A* 2fe4_A* 2ffq_A* 1d5c_A* Back     alignment and structure
>3tkl_A RAS-related protein RAB-1A; vesicle trafficking, protein transport-protein binding compl; HET: GTP; 2.18A {Homo sapiens} Back     alignment and structure
>1m2o_B GTP-binding protein SAR1, GTP binding protein; zinc-finger, beta barrel, VWA domain, gelsolin domain,; HET: GNP; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 2qtv_B* Back     alignment and structure
>1f6b_A SAR1; gtpases, N-terminal helix, Mg-containing complex, protein transport; HET: GDP; 1.70A {Cricetulus griseus} SCOP: c.37.1.8 PDB: 2fmx_A* 2fa9_A* 2gao_A* Back     alignment and structure
>2fh5_B SR-beta, signal recognition particle receptor beta subunit; endomembrane targeting, GTPase, GAP, longin domain, SEDL, transport protein; HET: GTP; 2.45A {Mus musculus} SCOP: c.37.1.8 PDB: 2go5_2 Back     alignment and structure
>1ky3_A GTP-binding protein YPT7P; vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase, endocytosis/exocytosis complex; HET: GDP; 1.35A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ky2_A* Back     alignment and structure
>2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ... Back     alignment and structure
>1vg8_A RAS-related protein RAB-7; GTP-binding protein, protein transport; HET: GNP; 1.70A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 1vg0_B* 3law_A* 1t91_A* 1yhn_A* 1vg1_A* 1vg9_B* Back     alignment and structure
>2oil_A CATX-8, RAS-related protein RAB-25; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.30A {Homo sapiens} Back     alignment and structure
>1r8s_A ADP-ribosylation factor 1; protein transport/exchange factor, protein transport-exchang complex; HET: GDP; 1.46A {Bos taurus} SCOP: c.37.1.8 PDB: 1re0_A* 1s9d_A* 1u81_A* 1r8q_A* 1rrf_A* 1rrg_A* 1hur_A* 1o3y_A* 1j2j_A* 2j59_A* 1mr3_F* 2k5u_A* 3lrp_A* 3tjz_A* 3rd1_A* 2ksq_A* 2a5d_A* 2a5f_A* 2j5x_A* 1e0s_A* ... Back     alignment and structure
>1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8 Back     alignment and structure
>1c1y_A RAS-related protein RAP-1A; GTP-binding proteins, protein-protein complex, effectors, signaling protein; HET: GTP; 1.90A {Homo sapiens} SCOP: c.37.1.8 PDB: 3kuc_A* 1gua_A* 3cf6_R* 3brw_D* Back     alignment and structure
>1udx_A The GTP-binding protein OBG; TGS domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.07A {Thermus thermophilus} SCOP: b.117.1.1 c.37.1.8 d.242.1.1 Back     alignment and structure
>2a5j_A RAS-related protein RAB-2B; GTPase, signal transduction, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.50A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z0a_A* Back     alignment and structure
>2bme_A RAB4A, RAS-related protein RAB4A; GTP-binding protein, vesicular transport, endocytosis, prenylation, protein transport, transport; HET: GNP; 1.57A {Homo sapiens} SCOP: c.37.1.8 PDB: 2bmd_A* 1yu9_A* 1z0k_A* Back     alignment and structure
>1g7s_A Translation initiation factor IF2/EIF5B; translational GTPase; HET: GDP; 2.00A {Methanothermobacterthermautotrophicus} SCOP: b.43.3.1 b.43.3.1 c.20.1.1 c.37.1.8 PDB: 1g7r_A* 1g7t_A* Back     alignment and structure
>2xex_A Elongation factor G; GTPase, translation, biosynthetic protein; 1.90A {Staphylococcus aureus} Back     alignment and structure
>2erx_A GTP-binding protein DI-RAS2; GTP hydrolysis, transport protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2a9k_A RAS-related protein RAL-A; bacterial ADP-ribosyltransferase, RAL, RHO, GD binding; HET: GDP NAD; 1.73A {Homo sapiens} SCOP: c.37.1.8 PDB: 2a78_A* Back     alignment and structure
>2hxs_A RAB-26, RAS-related protein RAB-28; GTPase, signaling protein; HET: G3D; 1.10A {Homo sapiens} PDB: 2hy4_A* 3e5h_A* Back     alignment and structure
>2o52_A RAS-related protein RAB-4B; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.20A {Homo sapiens} Back     alignment and structure
>2iwr_A Centaurin gamma 1; ANK repeat, zinc-finger, GTP-binding, polymorphism, nucleotide-binding, alternative splicing, protein transport; HET: CAF; 1.5A {Homo sapiens} PDB: 2bmj_A Back     alignment and structure
>3con_A GTPase NRAS; structural genomics consortium, SGC, GDP, oncogene, disease mutation, golgi apparatus, GTP-binding, lipoprotein membrane, methylation; HET: GDP; 1.65A {Homo sapiens} PDB: 2pmx_A* 3gft_A* 4q21_A* Back     alignment and structure
>3l0i_B RAS-related protein RAB-1A; GEF-GDF-RAB complex, GTP-binding, guanine-nucleotide exchang GDI-displacement factor; 2.85A {Homo sapiens} Back     alignment and structure
>2bcg_Y Protein YP2, GTP-binding protein YPT1; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ukv_Y* 3cue_F* 1yzn_A* 3sfv_A* 2wwx_A 2fol_A* 3nkv_A* 3jza_A* 2rhd_A* Back     alignment and structure
>2b6h_A ADP-ribosylation factor 5; membrane trafficking, GDP, structural genomics, structural G consortium, SGC, protein transport; HET: GDP; 1.76A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z6x_A* 3aq4_A* Back     alignment and structure
>2yc2_C IFT27, small RAB-related GTPase; transport protein, cilium, IFT complex; 2.59A {Chlamydomonas reinhardtii} PDB: 2yc4_C Back     alignment and structure
>2h5e_A Peptide chain release factor RF-3; beta barrel, translation; HET: GDP; 2.80A {Escherichia coli} PDB: 2o0f_A 3sfs_W* 3zvo_Y* 3uoq_W* Back     alignment and structure
>2zej_A Dardarin, leucine-rich repeat kinase 2; parkinson'S disease, LRRK2, ROC, GTPase, ROCO, ATP-B disease mutation, GTP-binding, GTPase activation; HET: GDP; 2.00A {Homo sapiens} PDB: 3d6t_B* Back     alignment and structure
>3bc1_A RAS-related protein RAB-27A; RAB27, GTPase, RAB, signaling protein, GDPNP, SLP2A, exophil GTP-binding, lipoprotein, membrane, methylation; HET: GNP; 1.80A {Mus musculus} PDB: 2iey_A* 2if0_A* 2zet_A* Back     alignment and structure
>3q85_A GTP-binding protein REM 2; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.76A {Mus musculus} SCOP: c.37.1.8 PDB: 4aii_A* Back     alignment and structure
>2fu5_C RAS-related protein RAB-8A; MSS4:RAB8 protein complex, GEF:GTPase nucleotide free complex; 2.00A {Mus musculus} SCOP: c.37.1.8 PDB: 3qbt_A* 3tnf_A* Back     alignment and structure
>3dz8_A RAS-related protein RAB-3B; GDP, GTPase, structural genomics consortium, SGC, cell GTP-binding, lipoprotein, membrane, methylation; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2bov_A RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, RAla, GTPase, ribosylating toxin, GTP-binding, lipoprotein, prenylation; HET: GDP; 2.66A {Homo sapiens} Back     alignment and structure
>1h65_A Chloroplast outer envelope protein OEP34; GTPase, translocon; HET: GDP; 2.0A {Pisum sativum} SCOP: c.37.1.8 PDB: 3bb1_A* Back     alignment and structure
>3kkq_A RAS-related protein M-RAS; GTP-binding, GTPase, signaling protein; HET: GDP; 1.20A {Mus musculus} SCOP: c.37.1.8 PDB: 3kkp_A* 3kko_A* 3pit_A* 3pir_A* 1x1r_A* 1x1s_A* Back     alignment and structure
>2fn4_A P23, RAS-related protein R-RAS; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ery_A* Back     alignment and structure
>3cpj_B GTP-binding protein YPT31/YPT8; RAB GTPase, prenylation, vesicular transport, acetylation, golgi apparatus, lipoprotein, membrane; HET: GDP; 2.35A {Saccharomyces cerevisiae} Back     alignment and structure
>3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* Back     alignment and structure
>3cbq_A GTP-binding protein REM 2; FLJ38964A, structural genomics consortium, SGC, GDP, membrane, nucleotide-binding, nucleotide binding protein; HET: GDP; 1.82A {Homo sapiens} Back     alignment and structure
>2atv_A RERG, RAS-like estrogen-regulated growth inhibitor; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3j2k_7 ERF3, eukaryotic polypeptide chain release factor 3; rabbit 80S ribosome, ribosome-translation complex; 17.00A {Oryctolagus cuniculus} Back     alignment and structure
>4dkx_A RAS-related protein RAB-6A; GTP binding fold, membrane trafficking, GTP, cytosol, protei transport; HET: GDP; 1.90A {Homo sapiens} PDB: 3bbp_A* Back     alignment and structure
>1zd9_A ADP-ribosylation factor-like 10B; transport protein, GDP-binding, membrane trafficking, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2al7_A* 2h18_A* Back     alignment and structure
>2gco_A H9, RHO-related GTP-binding protein RHOC; GTPase,signaling protein, signaling Pro; HET: GNP; 1.40A {Homo sapiens} PDB: 2gcn_A* 2gcp_A* 1z2c_A* 1x86_B 2rgn_C* 1lb1_B 1s1c_A* 3kz1_E* 3lxr_A* 3lwn_A* 3lw8_A* 1cxz_A* 1a2b_A* 1ow3_B* 1ftn_A* 1cc0_A* 3msx_A* 1xcg_B 3t06_B 1tx4_B* ... Back     alignment and structure
>2ew1_A RAS-related protein RAB-30; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* Back     alignment and structure
>2q3h_A RAS homolog gene family, member U; GTPase, structural genomics, structural genomics consortium,; HET: GDP; 1.73A {Homo sapiens} Back     alignment and structure
>2hup_A RAS-related protein RAB-43; G-protein, GDP, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.05A {Homo sapiens} Back     alignment and structure
>2j1l_A RHO-related GTP-binding protein RHOD; GTPase, membrane, prenylation, hydrolase, nucleotide-binding, methylation, lipoprotein, endosome DYNA; HET: GDP; 2.5A {Homo sapiens} Back     alignment and structure
>2gf0_A GTP-binding protein DI-RAS1; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, transport protein; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2fv8_A H6, RHO-related GTP-binding protein RHOB; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1nrj_B SR-beta, signal recognition particle receptor beta subunit; transmembrane, endoplasmic reticulum, GTP-binding; HET: GTP; 1.70A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>3izq_1 HBS1P, elongation factor 1 alpha-like protein; NO-GO mRNA decay, ribosomal protein,hydrolase; 9.50A {Saccharomyces cerevisiae} Back     alignment and structure
>2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>2cjw_A GTP-binding protein GEM; nucleotide-binding, small GTPase, conformational change, cysteine-modified, G-protein hydrolase; HET: GDP; 2.10A {Homo sapiens} PDB: 2cjw_B* 2ht6_A* Back     alignment and structure
>1dar_A EF-G, elongation factor G; ribosomal translocase, translational GTPase; HET: GDP; 2.40A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 PDB: 1elo_A 1ktv_A 2om7_L* 2wri_Y* 2wrk_Y* 2xsy_Y* 2xuy_Y* 2j7k_A* 2efg_A* 1jqm_B 1efg_A* 1fnm_A* 1pn6_A 2bm1_A* 2bm0_A* 2bv3_A* 3izp_E 1zn0_B 1jqs_C 2bcw_C ... Back     alignment and structure
>3oes_A GTPase rhebl1; small GTPase, structural genomics, structural genomics conso SGC, hydrolase; HET: GNP; 2.30A {Homo sapiens} Back     alignment and structure
>2g3y_A GTP-binding protein GEM; small GTPase, GDP, inactive state, RGK family, structur genomics, structural genomics consortium, SGC, signaling PR; HET: GDP; 2.40A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2zej_A Dardarin, leucine-rich repeat kinase 2; parkinson'S disease, LRRK2, ROC, GTPase, ROCO, ATP-B disease mutation, GTP-binding, GTPase activation; HET: GDP; 2.00A {Homo sapiens} PDB: 3d6t_B* Back     alignment and structure
>3qf4_B Uncharacterized ABC transporter ATP-binding prote TM_0288; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Back     alignment and structure
>1zo1_I IF2, translation initiation factor 2; E. coli, ribosome, initiation of protein synthesis, cryo-eletron microscopy, translation/RNA complex; 13.80A {Escherichia coli} Back     alignment and structure
>3mca_A HBS1, elongation factor 1 alpha-like protein; protein protein complex, translation regulation; 2.74A {Schizosaccharomyces pombe} Back     alignment and structure
>3def_A T7I23.11 protein; chloroplast, TOC33, GTPase, hydrolase; HET: GDP; 1.96A {Arabidopsis thaliana} PDB: 3bb3_A* 3bb4_A* 2j3e_A* Back     alignment and structure
>3vqt_A RF-3, peptide chain release factor 3; translation, GTPase; HET: GDP; 1.80A {Desulfovibrio vulgaris} PDB: 3vr1_A* Back     alignment and structure
>4gzl_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTP binding, membrane, hydrolase; HET: GNP; 2.00A {Homo sapiens} PDB: 3th5_A* 4gzm_A* Back     alignment and structure
>3c5c_A RAS-like protein 12; GDP, GTPase, structural genomics consortium, SGC, limited proteolysis, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.85A {Homo sapiens} Back     alignment and structure
>3llu_A RAS-related GTP-binding protein C; structural genomics consortium, SGC, cytoplasm, nucleotide-binding, nucleus, phosphoprotein; HET: GNP; 1.40A {Homo sapiens} PDB: 2q3f_A* Back     alignment and structure
>1mh1_A RAC1; GTP-binding, GTPase, small G-protein, RHO family, RAS super family; HET: GNP; 1.38A {Homo sapiens} SCOP: c.37.1.8 PDB: 1hh4_A* 2p2l_A* 2h7v_A* 1g4u_R* 1i4d_D* 1i4l_D* 2vrw_A 1e96_A* 1i4t_D* 2rmk_A* 2yin_C 1ryf_A* 1ryh_A* 3su8_A* 3sua_A* 2fju_A* 1he1_C* 2nz8_A 1foe_B 3bji_C ... Back     alignment and structure
>2x2e_A Dynamin-1; nitration, hydrolase, membrane fission, nucleotide-binding, endocytosis, motor protein; HET: GDP; 2.00A {Homo sapiens} PDB: 2x2f_A* 3zyc_A* 3zys_A Back     alignment and structure
>3p26_A Elongation factor 1 alpha-like protein; GTP/GDP binding domain, beta-barrel, translational GTPase, D structural genomics; 2.50A {Saccharomyces cerevisiae} PDB: 3p27_A* Back     alignment and structure
>2cjw_A GTP-binding protein GEM; nucleotide-binding, small GTPase, conformational change, cysteine-modified, G-protein hydrolase; HET: GDP; 2.10A {Homo sapiens} PDB: 2cjw_B* 2ht6_A* Back     alignment and structure
>2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A* Back     alignment and structure
>2f7s_A C25KG, RAS-related protein RAB-27B; G-protein, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2iez_A* Back     alignment and structure
>3reg_A RHO-like small GTPase; cytoskeleton, nucleotide-binding, GTP-binding, signaling Pro lipoprotein, prenylation; HET: GSP; 1.80A {Entamoeba histolytica} PDB: 3ref_B* 4dvg_A* Back     alignment and structure
>2dby_A GTP-binding protein; GDP, structural genomics, NPPSFA, natio project on protein structural and functional analyses; HET: GDP; 1.76A {Thermus thermophilus} PDB: 2dwq_A Back     alignment and structure
>2rdo_7 EF-G, elongation factor G; elongation factor G, EF-G, RRF, GDPNP, 50S subunit, cryo-EM, REAL-space refinement, ribonucleoprotein; 9.10A {Escherichia coli} PDB: 3j0e_H Back     alignment and structure
>1udx_A The GTP-binding protein OBG; TGS domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.07A {Thermus thermophilus} SCOP: b.117.1.1 c.37.1.8 d.242.1.1 Back     alignment and structure
>1m7b_A RND3/RHOE small GTP-binding protein; small GTPase, signaling protein; HET: GTP; 2.00A {Homo sapiens} SCOP: c.37.1.8 PDB: 2v55_B* Back     alignment and structure
>2g3y_A GTP-binding protein GEM; small GTPase, GDP, inactive state, RGK family, structur genomics, structural genomics consortium, SGC, signaling PR; HET: GDP; 2.40A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1n0u_A EF-2, elongation factor 2; G-protein, CIS-proline, translation; HET: SO1; 2.12A {Saccharomyces cerevisiae} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1n0v_C 1s1h_T 2e1r_A* 2npf_A* 2p8w_T* 3dny_T 3b82_A* 1zm2_A* 1zm3_A* 1zm4_A* 1zm9_A* 2p8x_T* 2p8y_T* 2p8z_T* 2zit_A* 1u2r_A* 3b78_A* 3b8h_A* Back     alignment and structure
>3ihw_A Centg3; RAS, centaurin, GTPase, structural genomics, structural genomics consortium, SGC, alternative splicing, ANK repeat, cytoplasm, GTP-binding; 1.92A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>3qf4_A ABC transporter, ATP-binding protein; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Back     alignment and structure
>2atx_A Small GTP binding protein TC10; GTPase, P-loop, alpha-beta, hydrolase; HET: GNP; 2.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3b5x_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; 5.50A {Vibrio cholerae} Back     alignment and structure
>1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* Back     alignment and structure
>3bwd_D RAC-like GTP-binding protein ARAC6; G domain, cytoplasm, lipoprotein, membrane, methylation, nucleotide-binding, prenylation, ----; HET: GDP; 1.53A {Arabidopsis thaliana} PDB: 2nty_C* 2wbl_C Back     alignment and structure
>2j0v_A RAC-like GTP-binding protein ARAC7; nucleotide-binding protein, ROP9, atrac7, membrane, palmitate, RHO GTPase; HET: GDP; 1.78A {Arabidopsis thaliana} Back     alignment and structure
>4a82_A Cystic fibrosis transmembrane conductance regulat; CFTR, ION channel, transport protein, casse protein; 2.00A {Homo sapiens} PDB: 2onj_A* 2hyd_A Back     alignment and structure
>3izy_P Translation initiation factor IF-2, mitochondrial; E coli, RNA, ribosomal; 10.80A {Bos taurus} Back     alignment and structure
>3o47_A ADP-ribosylation factor GTPase-activating protein ribosylation factor 1; structural genomics consortium, GTPase activation; HET: GDP; 2.80A {Homo sapiens} Back     alignment and structure
>2dy1_A Elongation factor G; translocation, GTP complex, structural genomics, NPPSFA; HET: GTP; 1.60A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1wdt_A* Back     alignment and structure
>3t1o_A Gliding protein MGLA; G domain containing protein, bacterial GTPase, bacterial POL motility, POLE localisation, alpha/beta protein; HET: GDP; 1.90A {Thermus thermophilus} PDB: 3t12_A* 3t1q_A* 3t1t_A* 3t1v_A* Back     alignment and structure
>1gwn_A RHO-related GTP-binding protein RHOE; GTPase, inactive GTPase, signal transduction; HET: GTP; 2.1A {Mus musculus} SCOP: c.37.1.8 Back     alignment and structure
>3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* Back     alignment and structure
>3zvr_A Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mitochondrial fission, GT stalk, PH, BSE, membrane fission; HET: 1PE; 3.10A {Rattus norvegicus} PDB: 3snh_A Back     alignment and structure
>2qag_A Septin-2, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>1jal_A YCHF protein; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; 2.40A {Haemophilus influenzae} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>3t34_A Dynamin-related protein 1A, linker, dynamin-relat 1A; dynamin-like protein 1A, GTPase, membrane fission, motor Pro; HET: GDP; 2.40A {Arabidopsis thaliana} PDB: 3t35_A* Back     alignment and structure
>3dpu_A RAB family protein; roccor, G-domain, COR, GTP-binding, nucleotide-binding, SIGN protein; 2.90A {Chlorobaculum tepidum} Back     alignment and structure
>2qag_A Septin-2, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>3b60_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; HET: ANP; 3.70A {Salmonella typhimurium} SCOP: c.37.1.12 f.37.1.1 PDB: 3b5y_A* 3b5z_A* 3b5w_A Back     alignment and structure
>1zo1_I IF2, translation initiation factor 2; E. coli, ribosome, initiation of protein synthesis, cryo-eletron microscopy, translation/RNA complex; 13.80A {Escherichia coli} Back     alignment and structure
>3q5d_A Atlastin-1; G protein, GTPase, GDP/GTP binding, hydrolase; HET: GDP; 2.70A {Homo sapiens} PDB: 3q5e_A* 3qnu_A* 3qof_A* Back     alignment and structure
>3q3j_B RHO-related GTP-binding protein RHO6; RAS-binding domain, plexin, small GTPase, structural genomic consortium, SGC; HET: GNP; 1.97A {Homo sapiens} PDB: 2rex_B* 2cls_A* Back     alignment and structure
>1yrb_A ATP(GTP)binding protein; GTPase, P-loop, rossman fold, GDP, HYDR; HET: GDP; 1.75A {Pyrococcus abyssi} SCOP: c.37.1.10 PDB: 1yr6_A* 1yr8_A* 1yr9_A* 1yra_A* 1yr7_A* 2oxr_A* Back     alignment and structure
>3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A* Back     alignment and structure
>2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* Back     alignment and structure
>2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus} Back     alignment and structure
>2p67_A LAO/AO transport system kinase; ARGK, structural GEN PSI-2, protein structure initiative, NEW YORK SGX research for structural genomics; 1.80A {Escherichia coli} SCOP: c.37.1.10 Back     alignment and structure
>1f60_A Elongation factor EEF1A; protein-protein complex, translation; 1.67A {Saccharomyces cerevisiae} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1g7c_A* 1ije_A* 1ijf_A* 2b7b_A* 2b7c_A Back     alignment and structure
>1wb1_A Translation elongation factor SELB; selenocysteine, protein synthesis, selenium, ribosome; HET: GDP DXC; 3.0A {Methanococcus maripaludis} SCOP: b.43.3.1 b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1wb2_A* 1wb3_A* Back     alignment and structure
>3th5_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTPase, GTP binding, protein binding, signali protein; HET: GNP; 2.30A {Homo sapiens} Back     alignment and structure
>2c78_A Elongation factor TU-A; hydrolase, GTPase, translation elongation factor, protein synthesis, antibiotic, GTP-binding, nucleotide-binding; HET: GNP PUL; 1.4A {Thermus thermophilus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 2y0u_Z* 2y0w_Z* 2y0y_Z* 2y10_Z* 2y12_Z* 2y14_Z* 2y16_Z* 2y18_Z* 2wrn_Z* 2wrq_Z* 2c77_A* 1aip_A 1exm_A* 1ha3_A* 2xqd_Z* 3fic_Z* 4abr_Z* 1b23_P* 1ob5_A* 1ttt_A* ... Back     alignment and structure
>1kk1_A EIF2gamma; initiation of translation; HET: GNP; 1.80A {Pyrococcus abyssi} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1kjz_A* 1kk2_A* 1kk3_A* 1kk0_A* 2d74_A 2dcu_A* Back     alignment and structure
>2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A* Back     alignment and structure
>2elf_A Protein translation elongation factor 1A; tRNA, pyrrolysine, structural genomics, NPPSFA; HET: CIT; 1.70A {Methanosarcina mazei} Back     alignment and structure
>3c5h_A Glucocorticoid receptor DNA-binding factor 1; RAS, GTPase, glucorticoid receptor, structural genomics consortium, SGC, alternative splicing; HET: GNP; 1.80A {Homo sapiens} Back     alignment and structure
>1d2e_A Elongation factor TU (EF-TU); G-protein, beta-barrel, RNA binding protein; HET: GDP; 1.94A {Bos taurus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1xb2_A* 2hcj_A* 2hdn_A* Back     alignment and structure
>1zun_B Sulfate adenylate transferase, subunit 1/adenylylsulfate kinase; beta barrel, switch domain, heterodimer, pyrophosphate, G protein; HET: GDP AGS; 2.70A {Pseudomonas syringae PV} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 Back     alignment and structure
>2wkq_A NPH1-1, RAS-related C3 botulinum toxin substrate 1; transferase, cell adhesion, nucleotide-binding, protein engineering, RAS superfamily LOV2; HET: GTP FMN; 1.60A {Avena sativa} PDB: 2wkr_A* 2wkp_A* Back     alignment and structure
>1s0u_A EIF-2-gamma, translation initiation factor 2 gamma subunit; GTPase, EF-1A, tRNA; 2.40A {Methanocaldococcus jannaschii} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 Back     alignment and structure
>3sop_A Neuronal-specific septin-3; hydrolase; HET: GDP; 2.88A {Homo sapiens} Back     alignment and structure
>4dkx_A RAS-related protein RAB-6A; GTP binding fold, membrane trafficking, GTP, cytosol, protei transport; HET: GDP; 1.90A {Homo sapiens} PDB: 3bbp_A* Back     alignment and structure
>3tr5_A RF-3, peptide chain release factor 3; protein synthesis, translation; HET: GDP; 2.11A {Coxiella burnetii} Back     alignment and structure
>2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus} Back     alignment and structure
>1jny_A EF-1-alpha, elongation factor 1-alpha, EF-TU, TUF-1; GTPase, alpha/beta structure, protein biosynthesis, translation; HET: GDP; 1.80A {Sulfolobus solfataricus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1skq_A* 3agj_A* Back     alignment and structure
>2h5e_A Peptide chain release factor RF-3; beta barrel, translation; HET: GDP; 2.80A {Escherichia coli} PDB: 2o0f_A 3sfs_W* 3zvo_Y* 3uoq_W* Back     alignment and structure
>3sjy_A Translation initiation factor 2 subunit gamma; zinc finger, initiate translation, tRNA binding, mRNA bindin binding; HET: GCP GDP; 2.00A {Sulfolobus solfataricus P2} PDB: 3pen_A* 3sjz_A* 2qn6_A* 2aho_A 2qmu_A* 2plf_A* 3v11_A* 3i1f_A* 3cw2_A 2pmd_A* 3p3m_A* 3qsy_A* Back     alignment and structure
>2qag_B Septin-6, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>3j25_A Tetracycline resistance protein TETM; antibiotic resistance, translation; HET: GCP; 7.20A {Enterococcus faecalis} Back     alignment and structure
>2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A Back     alignment and structure
>2xex_A Elongation factor G; GTPase, translation, biosynthetic protein; 1.90A {Staphylococcus aureus} Back     alignment and structure
>2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* Back     alignment and structure
>4fn5_A EF-G 1, elongation factor G 1; translation, translation-antibiotic compl; HET: 0UO; 2.90A {Pseudomonas aeruginosa} Back     alignment and structure
>2qnr_A Septin-2, protein NEDD5; structural genomics consortium, SGC, mitosis, GDP, C cycle, cell division, GTP-binding, nucleotide-binding; HET: GDP; 2.60A {Homo sapiens} PDB: 2qa5_A* 3ftq_A* Back     alignment and structure
>2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A* Back     alignment and structure
>1g7s_A Translation initiation factor IF2/EIF5B; translational GTPase; HET: GDP; 2.00A {Methanothermobacterthermautotrophicus} SCOP: b.43.3.1 b.43.3.1 c.20.1.1 c.37.1.8 PDB: 1g7r_A* 1g7t_A* Back     alignment and structure
>1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* Back     alignment and structure
>2qag_C Septin-7; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* Back     alignment and structure
>1r5b_A Eukaryotic peptide chain release factor GTP-bindi subunit; translation termination, peptide release, GTPase, translatio; 2.35A {Schizosaccharomyces pombe} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1r5n_A* 1r5o_A* 3e20_A Back     alignment and structure
>2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* Back     alignment and structure
>1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A* Back     alignment and structure
>1n0u_A EF-2, elongation factor 2; G-protein, CIS-proline, translation; HET: SO1; 2.12A {Saccharomyces cerevisiae} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1n0v_C 1s1h_T 2e1r_A* 2npf_A* 2p8w_T* 3dny_T 3b82_A* 1zm2_A* 1zm3_A* 1zm4_A* 1zm9_A* 2p8x_T* 2p8y_T* 2p8z_T* 2zit_A* 1u2r_A* 3b78_A* 3b8h_A* Back     alignment and structure
>1yrb_A ATP(GTP)binding protein; GTPase, P-loop, rossman fold, GDP, HYDR; HET: GDP; 1.75A {Pyrococcus abyssi} SCOP: c.37.1.10 PDB: 1yr6_A* 1yr8_A* 1yr9_A* 1yra_A* 1yr7_A* 2oxr_A* Back     alignment and structure
>3cb4_D GTP-binding protein LEPA; GTPase, OB-fold, membrane, nucleotide-binding, translation; 2.80A {Escherichia coli} PDB: 3deg_C* Back     alignment and structure
>1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 Back     alignment and structure
>3avx_A Elongation factor TS, elongation factor TU, linke replicase; RNA polymerase, translation, transferase-RNA complex; HET: GH3; 2.41A {Escherichia coli O157} PDB: 3agq_A 3agp_A* 3avu_A 3avv_A 3avt_A* 3avw_A* 3avy_A* 3mmp_A* 3mmp_G* 1efu_B Back     alignment and structure
>3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens} Back     alignment and structure
>1dar_A EF-G, elongation factor G; ribosomal translocase, translational GTPase; HET: GDP; 2.40A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 PDB: 1elo_A 1ktv_A 2om7_L* 2wri_Y* 2wrk_Y* 2xsy_Y* 2xuy_Y* 2j7k_A* 2efg_A* 1jqm_B 1efg_A* 1fnm_A* 1pn6_A 2bm1_A* 2bm0_A* 2bv3_A* 3izp_E 1zn0_B 1jqs_C 2bcw_C ... Back     alignment and structure
>4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} Back     alignment and structure
>3ec1_A YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase, signaling protein; HET: GDP; 2.36A {Geobacillus stearothermophilus} Back     alignment and structure
>2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} Back     alignment and structure
>2ywe_A GTP-binding protein LEPA; G domain, beta-barrel, ferredoxin-like domain, structural GE NPPSFA; 2.05A {Aquifex aeolicus} PDB: 2ywf_A* 2ywg_A* 2ywh_A* Back     alignment and structure
>2rdo_7 EF-G, elongation factor G; elongation factor G, EF-G, RRF, GDPNP, 50S subunit, cryo-EM, REAL-space refinement, ribonucleoprotein; 9.10A {Escherichia coli} PDB: 3j0e_H Back     alignment and structure
>3c5h_A Glucocorticoid receptor DNA-binding factor 1; RAS, GTPase, glucorticoid receptor, structural genomics consortium, SGC, alternative splicing; HET: GNP; 1.80A {Homo sapiens} Back     alignment and structure
>2qag_B Septin-6, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* Back     alignment and structure
>2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C Back     alignment and structure
>3h2y_A GTPase family protein; GTP-binding protein YQEH, possibly involved in replication initiation, csgid, IDP90222; HET: DGI; 1.80A {Bacillus anthracis str} Back     alignment and structure
>2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A Back     alignment and structure
>2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} PDB: 3ndb_B Back     alignment and structure
>1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C Back     alignment and structure
>3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron TRA ATP-binding, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} Back     alignment and structure
>2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} PDB: 3ndb_B Back     alignment and structure
>1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* Back     alignment and structure
>3r7w_B Gtpase2, GTP-binding protein GTR2; RAG gtpases, GTR1P, GTR2P, MTOR, protein transport; HET: GNP; 2.77A {Saccharomyces cerevisiae} PDB: 4arz_B* Back     alignment and structure
>1cip_A Protein (guanine nucleotide-binding protein alpha-1 subunit); GTPase, hydrolase; HET: GNP; 1.50A {Rattus norvegicus} SCOP: a.66.1.1 c.37.1.8 PDB: 1agr_A* 1bof_A* 1gdd_A* 1gfi_A* 1gia_A* 1gp2_A* 3ffa_A* 3ffb_A* 1gg2_A* 1git_A* 1svs_A* 1svk_A* 2zjz_A* 2zjy_A* 3ums_A* 2pz2_A* 2pz3_A* 1as0_A* 1as2_A* 1as3_A* ... Back     alignment and structure
>2dy1_A Elongation factor G; translocation, GTP complex, structural genomics, NPPSFA; HET: GTP; 1.60A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1wdt_A* Back     alignment and structure
>2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima} Back     alignment and structure
>3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A Back     alignment and structure
>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} Back     alignment and structure
>1zcb_A G alpha I/13; GTP-binding, lipoprotein, membrane, transducer, signaling PR; HET: GDP; 2.00A {Mus musculus} SCOP: a.66.1.1 c.37.1.8 PDB: 3ab3_A* 3cx8_A* 3cx7_A* 3cx6_A* 1zca_A* Back     alignment and structure
>3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>2qag_C Septin-7; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>3r7w_B Gtpase2, GTP-binding protein GTR2; RAG gtpases, GTR1P, GTR2P, MTOR, protein transport; HET: GNP; 2.77A {Saccharomyces cerevisiae} PDB: 4arz_B* Back     alignment and structure
>2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A* Back     alignment and structure
>4ido_A Atlastin-1; GTPase, GTP/GDP binding, hydrolase; HET: GDP; 2.09A {Homo sapiens} PDB: 4idn_A* 3q5d_A* 3q5e_A* 4idq_A* 4idp_A* 3qnu_A* 3qof_A* Back     alignment and structure
>3szr_A Interferon-induced GTP-binding protein MX1; interferon-induced antiviral GTPase, membrane associated, PR binding; 3.50A {Homo sapiens} PDB: 3zys_B Back     alignment and structure
>1azs_C GS-alpha; complex (lyase/hydrolase), hydrolase, signal transducing protein, cyclase, effector enzyme; HET: GSP FKP; 2.30A {Bos taurus} SCOP: a.66.1.1 c.37.1.8 PDB: 1azt_A* 3c14_C* 3c15_C* 3c16_C* 1cjt_C* 1cjk_C* 1cju_C* 1cjv_C* 1tl7_C* 1cs4_C* 1u0h_C* 2gvd_C* 2gvz_C* 3e8a_C* 3g82_C* 3maa_C* 1cul_C* 3sn6_A* Back     alignment and structure
>3ohm_A Guanine nucleotide-binding protein G(Q) subunit A; PH domain, EF hand, TIM barrel, C2 domain, GTPase, lipase, C binding, GTP binding; HET: GDP; 2.70A {Mus musculus} PDB: 2bcj_Q* 2rgn_A* 3ah8_A* Back     alignment and structure
>1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 Back     alignment and structure
>3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} Back     alignment and structure
>2qnr_A Septin-2, protein NEDD5; structural genomics consortium, SGC, mitosis, GDP, C cycle, cell division, GTP-binding, nucleotide-binding; HET: GDP; 2.60A {Homo sapiens} PDB: 2qa5_A* 3ftq_A* Back     alignment and structure
>1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F Back     alignment and structure
>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 Back     alignment and structure
>1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 Back     alignment and structure
>4fid_A G protein alpha subunit; RAS-like domain, all-helical domain, GTP binding, nucleotide signaling protein, transducer, lipoprotein; HET: MLY MSE GDP; 2.62A {Entamoeba histolytica} Back     alignment and structure
>2xtz_A Guanine nucleotide-binding protein alpha-1 subuni; hydrolase, G-protein signaling, SELF-activation, RAS-like DO; HET: GSP; 2.34A {Arabidopsis thaliana} Back     alignment and structure
>1ko7_A HPR kinase/phosphatase; protein kinase, phosphotransfer, protein phosphatase, dual activity, product, substrate, transferase, hydrolase; 1.95A {Staphylococcus xylosus} SCOP: c.98.2.1 c.91.1.2 Back     alignment and structure
>2ohf_A Protein OLA1, GTP-binding protein 9; ATPase, GTPase, P-loop, OBG-like, hydrolase; HET: ACP; 2.70A {Homo sapiens} Back     alignment and structure
>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A Back     alignment and structure
>3sop_A Neuronal-specific septin-3; hydrolase; HET: GDP; 2.88A {Homo sapiens} Back     alignment and structure
>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} Back     alignment and structure
>3l82_B F-box only protein 4; TRFH domain, helix, GTPase domain, acetylation, ADP- ribosylation, alternative splicing, cell cycle, cell division; 2.40A {Homo sapiens} Back     alignment and structure
>1np6_A Molybdopterin-guanine dinucleotide biosynthesis protein B; mixed alpha-beta fold, elongated beta-sheet, walker A motif, P-loop structural motif; 1.90A {Escherichia coli} SCOP: c.37.1.10 PDB: 1p9n_A Back     alignment and structure
>3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} Back     alignment and structure
>2xxa_A Signal recognition particle protein; protein transport, RNA/RNA binding protein, hydrolase, gtpas; HET: GCP; 3.94A {Escherichia coli} PDB: 2j28_9 Back     alignment and structure
>1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A Back     alignment and structure
>3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} Back     alignment and structure
>2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A Back     alignment and structure
>3vqt_A RF-3, peptide chain release factor 3; translation, GTPase; HET: GDP; 1.80A {Desulfovibrio vulgaris} PDB: 3vr1_A* Back     alignment and structure
>3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* Back     alignment and structure
>2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} Back     alignment and structure
>3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A Back     alignment and structure
>4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* Back     alignment and structure
>1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 Back     alignment and structure
>2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A Back     alignment and structure
>2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 Back     alignment and structure
>2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} Back     alignment and structure
>2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} Back     alignment and structure
>3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} Back     alignment and structure
>1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* Back     alignment and structure
>1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* Back     alignment and structure
>1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 Back     alignment and structure
>4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} Back     alignment and structure
>1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 Back     alignment and structure
>3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 Back     alignment and structure
>3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} Back     alignment and structure
>2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A Back     alignment and structure
>1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 Back     alignment and structure
>1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 Back     alignment and structure
>2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* Back     alignment and structure
>1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* Back     alignment and structure
>2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} Back     alignment and structure
>2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* Back     alignment and structure
>1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 Back     alignment and structure
>2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* Back     alignment and structure
>1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* Back     alignment and structure
>2f1r_A Molybdopterin-guanine dinucleotide biosynthesis protein B (MOBB); structural genomics, PSI, protein structure initiative; 2.10A {Archaeoglobus fulgidus} Back     alignment and structure
>3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 595
d1puja_273 c.37.1.8 (A:) Probable GTPase YlqF {Bacillus subti 8e-41
d2cxxa1184 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyroc 3e-09
d1mkya1171 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal 1e-08
d1udxa2180 c.37.1.8 (A:157-336) Obg GTP-binding protein middl 4e-08
d1h65a_257 c.37.1.8 (A:) Chloroplast protein translocon GTPas 1e-07
d1lnza2185 c.37.1.8 (A:158-342) Obg GTP-binding protein middl 1e-07
d1egaa1179 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain { 2e-07
d1tq4a_400 c.37.1.8 (A:) Interferon-inducible GTPase {Mouse ( 2e-07
d1xzpa2160 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotog 2e-07
d1mkya2186 c.37.1.8 (A:173-358) Probable GTPase Der, N-termin 4e-07
d1wf3a1178 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain { 6e-07
d2gj8a1161 c.37.1.8 (A:216-376) Probable tRNA modification GT 8e-07
d1svia_195 c.37.1.8 (A:) Probable GTPase EngB {Bacillus subti 2e-06
d1ni3a1296 c.37.1.8 (A:11-306) YchF GTP-binding protein N-ter 2e-06
d1wxqa1319 c.37.1.8 (A:1-319) GTP-binding protein PH0525 {Pyr 1e-05
d1jala1278 c.37.1.8 (A:1-278) YchF GTP-binding protein N-term 7e-05
d1puia_188 c.37.1.8 (A:) Probable GTPase EngB {Escherichia co 2e-04
d1xjca_165 c.37.1.10 (A:) Molybdopterin-guanine dinucleotide 3e-04
d1u0la2225 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C 7e-04
d2fu5c1173 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [Ta 0.003
d1t9ha2231 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C 0.004
>d1puja_ c.37.1.8 (A:) Probable GTPase YlqF {Bacillus subtilis [TaxId: 1423]} Length = 273 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Probable GTPase YlqF
species: Bacillus subtilis [TaxId: 1423]

 Score =  147 bits (371), Expect = 8e-41
 Identities = 65/318 (20%), Positives = 112/318 (35%), Gaps = 60/318 (18%)

Query: 163 RQLWRVIERSDVIVQIVDARNPLLFRCEDLERYVKEVSPHKRNMILLNKADLLTRKQRCY 222
           R++   ++  D++ ++VDAR P+  R   +E  +K    +K  ++LLNKAD         
Sbjct: 7   REVTEKLKLIDIVYELVDARIPMSSRNPMIEDILK----NKPRIMLLNKADKADAAVTQQ 62

Query: 223 WTKYFNSVNVAVAFFSATNIYDDIPEGDEELEDEVVSEESESDESEWEDISEEEEEDDGQ 282
           W ++F                                                  E+ G 
Sbjct: 63  WKEHF--------------------------------------------------ENQGI 72

Query: 283 KVLENDLKIKSSPKLLNREELISLFKSFHDVNIPRMNPDVMTIGLVGYPNVGKSSTINAL 342
           + L  +         +       L + F  +    + P  +   ++G PNVGKS+ IN L
Sbjct: 73  RSLSINSVNGQGLNQIVPASKEILQEKFDRMRAKGVKPRAIRALIIGIPNVGKSTLINRL 132

Query: 343 LNAKKVSVSATPGKTKHFQTLFVDDELLLCDCPGLVMPSFVFSKADMILNGILPIDQMRD 402
                      PG T   Q + V  EL L D PG++ P F      + L        ++D
Sbjct: 133 AKKNIAKTGDRPGITTSQQWVKVGKELELLDTPGILWPKFEDELVGLRL---AVTGAIKD 189

Query: 403 HVPAVNMLCTLVPRHVLENIYGIMITQPDEGEDPNRPPFSEELCNAYGYNRGFMTSNGQP 462
            +  +  +     R  LE  Y   + +    ++   P    EL +A G  RG + S G  
Sbjct: 190 SIINLQDVAVFGLR-FLEEHYPERLKERYGLDEI--PEDIAELFDAIGEKRGCLMSGGLI 246

Query: 463 DNPRSARYILKDFVNGHL 480
           +  ++   I++D      
Sbjct: 247 NYDKTTEVIIRDIRTEKF 264
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Length = 184 Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Length = 171 Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Length = 180 Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Length = 257 Back     information, alignment and structure
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Length = 185 Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 179 Back     information, alignment and structure
>d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} Length = 400 Back     information, alignment and structure
>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Length = 160 Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Length = 186 Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Length = 178 Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Length = 161 Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Length = 195 Back     information, alignment and structure
>d1ni3a1 c.37.1.8 (A:11-306) YchF GTP-binding protein N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 296 Back     information, alignment and structure
>d1wxqa1 c.37.1.8 (A:1-319) GTP-binding protein PH0525 {Pyrococcus horikoshii [TaxId: 53953]} Length = 319 Back     information, alignment and structure
>d1jala1 c.37.1.8 (A:1-278) YchF GTP-binding protein N-terminal domain {Haemophilus influenzae [TaxId: 727]} Length = 278 Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Length = 188 Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Length = 165 Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Length = 225 Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Length = 173 Back     information, alignment and structure
>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Length = 231 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query595
d1puja_273 Probable GTPase YlqF {Bacillus subtilis [TaxId: 14 100.0
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 99.81
d1t9ha2231 Probable GTPase EngC (YjeQ), C-terminal domain {Ba 99.77
d1wf3a1178 GTPase Era, N-terminal domain {Thermus thermophilu 99.41
d1mkya1171 Probable GTPase Der, N-terminal and middle domains 99.23
d1wb1a4179 Elongation factor SelB, N-terminal domain {Methano 99.2
d1udxa2180 Obg GTP-binding protein middle domain {Thermus the 99.18
d1xzpa2160 TrmE GTPase domain {Thermotoga maritima [TaxId: 23 99.14
d2cxxa1184 GTP-binding protein engB {Pyrococcus horikoshii [T 99.13
d2gj8a1161 Probable tRNA modification GTPase TrmE (MnmE), G d 99.11
d1h65a_257 Chloroplast protein translocon GTPase Toc34 {Garde 99.09
d1svia_195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 99.03
d1lnza2185 Obg GTP-binding protein middle domain {Bacillus su 98.98
d1g7sa4227 Initiation factor IF2/eIF5b, N-terminal (G) domain 98.96
d1mkya2186 Probable GTPase Der, N-terminal and middle domains 98.95
d1xzpa2160 TrmE GTPase domain {Thermotoga maritima [TaxId: 23 98.93
d2cxxa1184 GTP-binding protein engB {Pyrococcus horikoshii [T 98.93
d1lnza2185 Obg GTP-binding protein middle domain {Bacillus su 98.83
d2gj8a1161 Probable tRNA modification GTPase TrmE (MnmE), G d 98.79
d1wf3a1178 GTPase Era, N-terminal domain {Thermus thermophilu 98.78
d1wxqa1319 GTP-binding protein PH0525 {Pyrococcus horikoshii 98.77
d1ni3a1296 YchF GTP-binding protein N-terminal domain {Fissio 98.74
d1udxa2180 Obg GTP-binding protein middle domain {Thermus the 98.72
d2c78a3204 Elongation factor Tu (EF-Tu), N-terminal (G) domai 98.7
d1d2ea3196 Elongation factor Tu (EF-Tu), N-terminal (G) domai 98.69
d1tq4a_400 Interferon-inducible GTPase {Mouse (Mus musculus) 98.67
d2qn6a3205 Initiation factor eIF2 gamma subunit, N-terminal ( 98.66
d1jala1278 YchF GTP-binding protein N-terminal domain {Haemop 98.65
d1mkya2186 Probable GTPase Der, N-terminal and middle domains 98.64
d1mkya1171 Probable GTPase Der, N-terminal and middle domains 98.63
d1svia_195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 98.61
d1kk1a3195 Initiation factor eIF2 gamma subunit, N-terminal ( 98.61
d1egaa1179 GTPase Era, N-terminal domain {Escherichia coli [T 98.51
d1zunb3222 Sulfate adenylate transferase subunit cysN/C, EF-T 98.44
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 98.43
d1nrjb_209 Signal recognition particle receptor beta-subunit 98.36
d1puia_188 Probable GTPase EngB {Escherichia coli [TaxId: 562 98.31
d1puia_188 Probable GTPase EngB {Escherichia coli [TaxId: 562 98.27
d1wb1a4179 Elongation factor SelB, N-terminal domain {Methano 98.25
d2hyda1255 Putative multidrug export ATP-binding/permease pro 98.25
d2pmka1241 Haemolysin B ATP-binding protein {Escherichia coli 98.17
d1tq4a_400 Interferon-inducible GTPase {Mouse (Mus musculus) 98.14
d1egaa1179 GTPase Era, N-terminal domain {Escherichia coli [T 98.14
d1z2aa1164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 98.12
d1zd9a1164 ADP-ribosylation factor {Human (Homo sapiens), ARL 98.12
d1moza_182 ADP-ribosylation factor {Baker's yeast (Saccharomy 98.11
d1nrjb_209 Signal recognition particle receptor beta-subunit 98.1
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 98.1
d2gjsa1168 Rad {Human (Homo sapiens) [TaxId: 9606]} 98.07
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 98.07
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 98.07
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 98.05
d3b60a1253 Multidrug resistance ABC transporter MsbA, C-termi 98.05
d1e0sa_173 ADP-ribosylation factor {Human (Homo sapiens), ARF 98.01
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 98.0
d1g7sa4227 Initiation factor IF2/eIF5b, N-terminal (G) domain 97.99
d1g16a_166 Rab-related protein Sec4 {Baker's yeast (Saccharom 97.99
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 97.97
d1ky3a_175 Rab-related protein ypt7p {Baker's yeast (Saccharo 97.95
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 97.95
d2fn4a1173 r-Ras {Human (Homo sapiens) [TaxId: 9606]} 97.95
d2erxa1171 di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 97.95
d1h65a_257 Chloroplast protein translocon GTPase Toc34 {Garde 97.94
d1z0ja1167 Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} 97.93
d2ew1a1171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 97.92
d1u8za_168 Ras-related protein RalA {Cotton-top tamarin (Sagu 97.9
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 97.89
d1i2ma_170 Ran {Human (Homo sapiens) [TaxId: 9606]} 97.88
d1moza_182 ADP-ribosylation factor {Baker's yeast (Saccharomy 97.88
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 97.88
d1mv5a_242 Multidrug resistance ABC transporter LmrA, C-termi 97.88
d2erya1171 r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 97.87
d1jj7a_251 Peptide transporter Tap1, C-terminal ABC domain {H 97.86
d1yzqa1164 Rab6 {Human (Homo sapiens) [TaxId: 9606]} 97.86
d2f7sa1186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 97.86
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 97.85
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 97.85
d2fh5b1207 Signal recognition particle receptor beta-subunit 97.85
d2c78a3204 Elongation factor Tu (EF-Tu), N-terminal (G) domai 97.84
d2f9la1175 Rab11b {Human (Homo sapiens) [TaxId: 9606]} 97.84
d2bv3a2276 Elongation factor G (EF-G), N-terminal (G) domain 97.84
d1z0fa1166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 97.84
d1e0sa_173 ADP-ribosylation factor {Human (Homo sapiens), ARF 97.84
d2ew1a1171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 97.83
d2bcgy1194 GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi 97.83
d2bmea1174 Rab4a {Human (Homo sapiens) [TaxId: 9606]} 97.82
d1z06a1165 Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} 97.82
d2fu5c1173 Rab8a {Mouse (Mus musculus) [TaxId: 10090]} 97.82
d2dy1a2267 Elongation factor G (EF-G), N-terminal (G) domain 97.81
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 97.8
d2fh5b1207 Signal recognition particle receptor beta-subunit 97.79
d1z2aa1164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 97.78
d1ctqa_166 cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 97.78
d1xtqa1167 GTP-binding protein RheB {Human (Homo sapiens) [Ta 97.78
d1x3sa1177 Rab18 {Human (Homo sapiens) [TaxId: 9606]} 97.77
d1kk1a3195 Initiation factor eIF2 gamma subunit, N-terminal ( 97.76
d2f9la1175 Rab11b {Human (Homo sapiens) [TaxId: 9606]} 97.76
d2a5ja1173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 97.75
d1jnya3224 Elongation factor eEF-1alpha, N-terminal (G) domai 97.71
d1kaoa_167 Rap2a {Human (Homo sapiens) [TaxId: 9606]} 97.71
d1vg8a_184 Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} 97.69
d1vg8a_184 Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} 97.68
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 97.68
d1kmqa_177 RhoA {Human (Homo sapiens) [TaxId: 9606]} 97.64
d1r5ba3245 Eukaryotic peptide chain release factor ERF2, G do 97.62
d1z0fa1166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 97.62
d2bmea1174 Rab4a {Human (Homo sapiens) [TaxId: 9606]} 97.62
d2g6ba1170 Rab26 {Human (Homo sapiens) [TaxId: 9606]} 97.62
d2akab1299 Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 97.61
d2fu5c1173 Rab8a {Mouse (Mus musculus) [TaxId: 10090]} 97.61
d1x3sa1177 Rab18 {Human (Homo sapiens) [TaxId: 9606]} 97.61
d2atxa1185 RhoQ {Human (Homo sapiens) [TaxId: 9606]} 97.6
d1d2ea3196 Elongation factor Tu (EF-Tu), N-terminal (G) domai 97.58
d2g6ba1170 Rab26 {Human (Homo sapiens) [TaxId: 9606]} 97.57
d1zd9a1164 ADP-ribosylation factor {Human (Homo sapiens), ARL 97.56
d1i2ma_170 Ran {Human (Homo sapiens) [TaxId: 9606]} 97.55
d1ky3a_175 Rab-related protein ypt7p {Baker's yeast (Saccharo 97.54
d1f60a3239 Elongation factor eEF-1alpha, N-terminal (G) domai 97.53
d1jwyb_306 Dynamin G domain {Dictyostelium discoideum [TaxId: 97.52
d1r2qa_170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 97.52
d1wmsa_174 Rab9a {Human (Homo sapiens) [TaxId: 9606]} 97.51
d2bcgy1194 GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi 97.51
d1wxqa1319 GTP-binding protein PH0525 {Pyrococcus horikoshii 97.49
d2gjsa1168 Rad {Human (Homo sapiens) [TaxId: 9606]} 97.49
d1ek0a_170 Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T 97.46
d2fn4a1173 r-Ras {Human (Homo sapiens) [TaxId: 9606]} 97.44
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 97.44
d1mh1a_183 Rac {Human (Homo sapiens) [TaxId: 9606]} 97.44
d1wmsa_174 Rab9a {Human (Homo sapiens) [TaxId: 9606]} 97.42
d2ngra_191 CDC42 {Human (Homo sapiens) [TaxId: 9606]} 97.41
d1x1ra1169 Ras-related protein M-Ras (XRas) {Mouse (Mus muscu 97.4
d1g16a_166 Rab-related protein Sec4 {Baker's yeast (Saccharom 97.4
d2a5ja1173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 97.37
d1z08a1167 Rab21 {Human (Homo sapiens) [TaxId: 9606]} 97.36
d1kaoa_167 Rap2a {Human (Homo sapiens) [TaxId: 9606]} 97.35
d2qn6a3205 Initiation factor eIF2 gamma subunit, N-terminal ( 97.34
d1z0ja1167 Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} 97.33
d1yzqa1164 Rab6 {Human (Homo sapiens) [TaxId: 9606]} 97.31
d1ek0a_170 Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T 97.25
d2f7sa1186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 97.24
d1z06a1165 Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} 97.23
d1ctqa_166 cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 97.22
d2atva1168 Ras-like estrogen-regulated growth inhibitor, RERG 97.22
d1xtqa1167 GTP-binding protein RheB {Human (Homo sapiens) [Ta 97.21
d1r2qa_170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 97.2
d2bmja1175 Centaurin gamma 1, G domain {Human (Homo sapiens) 97.2
d1z08a1167 Rab21 {Human (Homo sapiens) [TaxId: 9606]} 97.2
d1kmqa_177 RhoA {Human (Homo sapiens) [TaxId: 9606]} 97.18
d2atva1168 Ras-like estrogen-regulated growth inhibitor, RERG 97.17
d2bmja1175 Centaurin gamma 1, G domain {Human (Homo sapiens) 97.15
d2erya1171 r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 97.13
d1l2ta_230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 97.13
d2erxa1171 di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 97.12
d1mh1a_183 Rac {Human (Homo sapiens) [TaxId: 9606]} 97.05
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 97.05
d1n0ua2341 Elongation factor 2 (eEF-2), N-terminal (G) domain 97.01
d2g3ya1172 GTP-binding protein GEM {Human (Homo sapiens) [Tax 97.01
d1u8za_168 Ras-related protein RalA {Cotton-top tamarin (Sagu 97.0
d1c1ya_167 Rap1A {Human (Homo sapiens) [TaxId: 9606]} 96.99
d1zunb3222 Sulfate adenylate transferase subunit cysN/C, EF-T 96.98
d2atxa1185 RhoQ {Human (Homo sapiens) [TaxId: 9606]} 96.95
d1zcba2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 96.89
d2ngra_191 CDC42 {Human (Homo sapiens) [TaxId: 9606]} 96.87
d2g3ya1172 GTP-binding protein GEM {Human (Homo sapiens) [Tax 96.87
d1c1ya_167 Rap1A {Human (Homo sapiens) [TaxId: 9606]} 96.86
d1v43a3239 Hypothetical protein PH0022, N-terminal domain {Py 96.82
d1r0wa_281 Cystic fibrosis transmembrane conductance regulato 96.78
d3dhwc1240 Methionine import ATP-binding protein MetN {Escher 96.77
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 96.76
d2awna2232 Maltose transport protein MalK, N-terminal domain 96.76
d1x1ra1169 Ras-related protein M-Ras (XRas) {Mouse (Mus muscu 96.7
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 96.65
d1m7ba_179 RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} 96.54
d3d31a2229 Sulfate/molybdate ABC transporter, ATP-binding pro 96.52
d1m7ba_179 RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} 96.5
d1oxxk2242 Glucose transport protein GlcV, N-terminal domain 96.49
d2p67a1327 LAO/AO transport system kinase ArgK {Escherichia c 96.46
d2onka1240 Molybdate/tungstate import ATP-binding protein Wtp 96.44
d1f5na2277 Interferon-induced guanylate-binding protein 1 (GB 96.39
d1jala1278 YchF GTP-binding protein N-terminal domain {Haemop 96.36
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 96.35
d2p67a1327 LAO/AO transport system kinase ArgK {Escherichia c 96.26
d1ji0a_240 Branched chain aminoacid ABC transporter {Thermoto 96.24
d1svsa1195 Transducin (alpha subunit) {Rat (Rattus norvegicus 96.09
d1g2912240 Maltose transport protein MalK, N-terminal domain 95.85
d2qm8a1323 Metallochaperone MeaB {Methylobacterium extorquens 95.7
d2bcjq2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 95.68
d1n0ua2341 Elongation factor 2 (eEF-2), N-terminal (G) domain 95.45
d2dy1a2267 Elongation factor G (EF-G), N-terminal (G) domain 95.44
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 95.42
d1f60a3239 Elongation factor eEF-1alpha, N-terminal (G) domai 95.39
d2qm8a1323 Metallochaperone MeaB {Methylobacterium extorquens 95.35
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 95.29
d2bv3a2276 Elongation factor G (EF-G), N-terminal (G) domain 95.27
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 95.16
d1r5ba3245 Eukaryotic peptide chain release factor ERF2, G do 95.15
d1l7vc_231 ABC transporter involved in vitamin B12 uptake, Bt 95.05
d1jnya3224 Elongation factor eEF-1alpha, N-terminal (G) domai 94.97
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 94.59
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 94.5
d1azta2221 Transducin (alpha subunit) {Cow (Bos taurus) [TaxI 94.47
d2akab1299 Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 94.42
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 94.38
d1jwyb_306 Dynamin G domain {Dictyostelium discoideum [TaxId: 94.28
d1ni3a1296 YchF GTP-binding protein N-terminal domain {Fissio 94.1
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 93.91
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 93.54
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 93.38
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 92.91
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 92.66
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 92.64
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 92.43
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 92.37
d1zcba2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 92.15
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 92.11
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 91.77
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 91.68
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 91.65
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 91.61
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 91.43
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 91.42
d1b0ua_258 ATP-binding subunit of the histidine permease {Sal 91.35
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 91.33
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 91.31
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 91.29
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 91.2
d1vpla_238 Putative ABC transporter TM0544 {Thermotoga mariti 91.01
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 90.65
d1g6ha_254 MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 90.56
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 90.39
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 90.34
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 90.28
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 90.15
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 90.1
d1azta2221 Transducin (alpha subunit) {Cow (Bos taurus) [TaxI 89.83
d2fnaa2283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 89.8
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 89.61
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 89.58
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 89.27
d2vp4a1197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 89.26
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 88.98
d2qy9a2211 GTPase domain of the signal recognition particle r 88.91
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 88.85
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 88.62
d1uf9a_191 Dephospho-CoA kinase {Thermus thermophilus [TaxId: 88.21
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 87.87
d1uj2a_213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 87.54
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 87.48
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 87.16
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 87.15
d1svsa1195 Transducin (alpha subunit) {Rat (Rattus norvegicus 86.85
d1ofha_309 HslU {Haemophilus influenzae [TaxId: 727]} 86.57
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 86.5
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 86.41
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 86.39
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 86.37
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 86.05
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 85.65
d1puja_273 Probable GTPase YlqF {Bacillus subtilis [TaxId: 14 84.64
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 84.49
d1j8yf2211 GTPase domain of the signal sequence recognition p 84.18
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 84.06
d1okkd2207 GTPase domain of the signal recognition particle r 83.81
g1f2t.1292 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 83.75
d2qy9a2211 GTPase domain of the signal recognition particle r 83.59
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 83.54
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 83.45
d1m7ga_208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fu 83.43
d1vmaa2213 GTPase domain of the signal recognition particle r 83.12
d1gsia_208 Thymidylate kinase {Mycobacterium tuberculosis [Ta 83.07
d4tmka_210 Thymidylate kinase {Escherichia coli [TaxId: 562]} 83.07
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 82.69
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 82.48
d1sq5a_308 Pantothenate kinase PanK {Escherichia coli [TaxId: 82.43
d1j8yf2211 GTPase domain of the signal sequence recognition p 82.12
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 80.41
d1tuea_205 Replication protein E1 helicase domain {Human papi 80.41
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 80.13
d1odfa_286 Hypothetical protein Ygr205W {Baker's yeast (Sacch 80.04
>d1puja_ c.37.1.8 (A:) Probable GTPase YlqF {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Probable GTPase YlqF
species: Bacillus subtilis [TaxId: 1423]

Probab=100.00  E-value=2.2e-45  Score=373.77  Aligned_cols=259  Identities=24%  Similarity=0.292  Sum_probs=187.0

Q ss_pred             HHHHHHHHHHhhcCeEEEEEeCCCCCCCCchHHHHHHHHhCCCCcEEEEEeCCCCCCHHHHHHHHHHHhhCCCeEEEEec
Q psy9995         160 DFWRQLWRVIERSDVIVQIVDARNPLLFRCEDLERYVKEVSPHKRNMILLNKADLLTRKQRCYWTKYFNSVNVAVAFFSA  239 (595)
Q Consensus       160 e~~rql~~vie~sDvVl~VvDAR~Pl~~~~~~Le~~lk~v~~~K~~ILVlNK~DLl~~~~~~~w~~~~~~~gi~vi~~SA  239 (595)
                      ...++++++++.+|+||+|+|||+|++++++.|+++++    +||.|+|+||+||++++..+.|.+||+..+..++++|+
T Consensus         4 ka~r~i~~~i~~~DvIl~V~DaR~P~ss~~~~l~~~~~----~Kp~IlVlNK~DLv~~~~~~~w~~~f~~~~~~~i~isa   79 (273)
T d1puja_           4 KARREVTEKLKLIDIVYELVDARIPMSSRNPMIEDILK----NKPRIMLLNKADKADAAVTQQWKEHFENQGIRSLSINS   79 (273)
T ss_dssp             HHHHHHHHHGGGCSEEEEEEETTSTTTTSCHHHHHHCS----SSCEEEEEECGGGSCHHHHHHHHHHHHTTTCCEEECCT
T ss_pred             HHHHHHHHHHHhCCEEEEEEECCCCCCCCCHHHHHHHc----CCCeEEEEECccCCchHHHHHHHHHHHhcCCccceeec
Confidence            35789999999999999999999999999999999875    79999999999999999999999999988889999999


Q ss_pred             ccCCCCCCCCccchhhhhhhccccccchhhhhhhhhhhccccchhhhhhccccCCccccCHHHHHHHhhhhcccCCCCCC
Q psy9995         240 TNIYDDIPEGDEELEDEVVSEESESDESEWEDISEEEEEDDGQKVLENDLKIKSSPKLLNREELISLFKSFHDVNIPRMN  319 (595)
Q Consensus       240 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~il~~~eL~e~~~~~~~~~~~~~~  319 (595)
                      .++.+....                    ...                          + .+-+.+.+.....   ....
T Consensus        80 ~~~~~~~~~--------------------~~~--------------------------~-~~~l~~~~~~~~~---~~~~  109 (273)
T d1puja_          80 VNGQGLNQI--------------------VPA--------------------------S-KEILQEKFDRMRA---KGVK  109 (273)
T ss_dssp             TTCTTGGGH--------------------HHH--------------------------H-HHHHHHHHHHHHH---TTCC
T ss_pred             ccCCCcccc--------------------chh--------------------------h-hhhhhhhhhhhhh---ccCC
Confidence            876551100                    000                          0 0111111111111   1223


Q ss_pred             CCceEEEEeecCCCCcchHhhhhcCcceeEecCCCCCceeeEEEEcCCceEEEeCCCCccCCcccchhH--HHHhcCCch
Q psy9995         320 PDVMTIGLVGYPNVGKSSTINALLNAKKVSVSATPGKTKHFQTLFVDDELLLCDCPGLVMPSFVFSKAD--MILNGILPI  397 (595)
Q Consensus       320 ~~~i~i~lvG~pnvGKSSliN~L~~~~kvsVs~tPG~TKh~Qti~~~~~~~liDtPGl~~p~f~~tk~e--li~~gil~i  397 (595)
                      ...++|++||+||||||||||+|.+.+.+.||++||+|||.|++.++..+.|+||||+++|.+.+....  +++.|.++-
T Consensus       110 ~~~~~v~vvG~PNvGKSsliN~L~~~~~~~~~~~pG~Tr~~~~i~~~~~~~l~DTPGi~~p~~~~~~~~~~la~~~~i~~  189 (273)
T d1puja_         110 PRAIRALIIGIPNVGKSTLINRLAKKNIAKTGDRPGITTSQQWVKVGKELELLDTPGILWPKFEDELVGLRLAVTGAIKD  189 (273)
T ss_dssp             CCCEEEEEEESTTSSHHHHHHHHHTSCCC------------CCEEETTTEEEEECCCCCCSCCCCHHHHHHHHHHTSSCT
T ss_pred             CCceEEEEEecCccchhhhhhhhhccceEEECCcccccccceEEECCCCeEEecCCCccccCCccHHHHhhhhhcCCcch
Confidence            457999999999999999999999999999999999999999999999999999999999998766544  344554431


Q ss_pred             hhhhhhhhhHHHHhh---hcChhHHHHHhCCCCCCCCCCCCCCCCCCHHHHHHHhhhhcCccccCCCCCHHHHHHHHHHH
Q psy9995         398 DQMRDHVPAVNMLCT---LVPRHVLENIYGIMITQPDEGEDPNRPPFSEELCNAYGYNRGFMTSNGQPDNPRSARYILKD  474 (595)
Q Consensus       398 d~lrd~~~~v~~l~~---~i~~~~le~~Y~i~~~~p~~~~~~~~~~~~~e~L~~~a~~rG~~~~gG~pD~~rAAr~iLkD  474 (595)
                      . +.+....+.++..   +.....+...|++..+.          .+.+|||+++|+++|++.+||.||..+||++||+|
T Consensus       190 ~-~~~~~~~~~~ll~~l~~~~~~~l~~~~~~~~~~----------~d~~~~l~~ia~~~g~~~kgg~~D~~~aa~~~l~d  258 (273)
T d1puja_         190 S-IINLQDVAVFGLRFLEEHYPERLKERYGLDEIP----------EDIAELFDAIGEKRGCLMSGGLINYDKTTEVIIRD  258 (273)
T ss_dssp             T-SSCHHHHHHHHHHHHHHHCHHHHHHHTTCSSCC----------SSHHHHHHHHHHHHTCBCSTTCBCHHHHHHHHHHH
T ss_pred             h-hcchhhHHHHHHHHHHHhChHhhhHhcCCCCCC----------CCHHHHHHHHHHHhCCcccCCccCHHHHHHHHHHH
Confidence            1 1111112222222   22333556678875321          14799999999999999999999999999999999


Q ss_pred             HHhCCceee
Q psy9995         475 FVNGHLLYC  483 (595)
Q Consensus       475 ~~~GKL~~~  483 (595)
                      |+.|+|+.+
T Consensus       259 ~r~G~lg~~  267 (273)
T d1puja_         259 IRTEKFGRL  267 (273)
T ss_dssp             HHTTTTCSC
T ss_pred             HHcCCCcee
Confidence            999999854
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1wxqa1 c.37.1.8 (A:1-319) GTP-binding protein PH0525 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1ni3a1 c.37.1.8 (A:11-306) YchF GTP-binding protein N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2c78a3 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1d2ea3 c.37.1.8 (A:55-250) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]} Back     information, alignment and structure
>d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2qn6a3 c.37.1.8 (A:2-206) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1jala1 c.37.1.8 (A:1-278) YchF GTP-binding protein N-terminal domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1kk1a3 c.37.1.8 (A:6-200) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Archaeon Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zunb3 c.37.1.8 (B:16-237) Sulfate adenylate transferase subunit cysN/C, EF-Tu domain G-like domain {Pseudomonas syringae pv. tomato [TaxId: 323]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2c78a3 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dy1a2 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus, EF-G-2 [TaxId: 274]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kk1a3 c.37.1.8 (A:6-200) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Archaeon Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jnya3 c.37.1.8 (A:4-227) Elongation factor eEF-1alpha, N-terminal (G) domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r5ba3 c.37.1.8 (A:215-459) Eukaryotic peptide chain release factor ERF2, G domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2akab1 c.37.1.8 (B:6-304) Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1d2ea3 c.37.1.8 (A:55-250) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]} Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1f60a3 c.37.1.8 (A:2-240) Elongation factor eEF-1alpha, N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jwyb_ c.37.1.8 (B:) Dynamin G domain {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wxqa1 c.37.1.8 (A:1-319) GTP-binding protein PH0525 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2qn6a3 c.37.1.8 (A:2-206) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1n0ua2 c.37.1.8 (A:3-343) Elongation factor 2 (eEF-2), N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Back     information, alignment and structure
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zunb3 c.37.1.8 (B:16-237) Sulfate adenylate transferase subunit cysN/C, EF-Tu domain G-like domain {Pseudomonas syringae pv. tomato [TaxId: 323]} Back     information, alignment and structure
>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1f5na2 c.37.1.8 (A:7-283) Interferon-induced guanylate-binding protein 1 (GBP1), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jala1 c.37.1.8 (A:1-278) YchF GTP-binding protein N-terminal domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1n0ua2 c.37.1.8 (A:3-343) Elongation factor 2 (eEF-2), N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2dy1a2 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus, EF-G-2 [TaxId: 274]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1f60a3 c.37.1.8 (A:2-240) Elongation factor eEF-1alpha, N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1r5ba3 c.37.1.8 (A:215-459) Eukaryotic peptide chain release factor ERF2, G domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jnya3 c.37.1.8 (A:4-227) Elongation factor eEF-1alpha, N-terminal (G) domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2akab1 c.37.1.8 (B:6-304) Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1jwyb_ c.37.1.8 (B:) Dynamin G domain {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1ni3a1 c.37.1.8 (A:11-306) YchF GTP-binding protein N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1puja_ c.37.1.8 (A:) Probable GTPase YlqF {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure