Diaphorina citri psyllid: psy9998

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------29

MSFFGFGQSADIEIKLDGTDTRKLADIKSDDGKKERFYLYYDGESVTGQVNIVLKKHGSKLEHQGIKIEFIGQIELYYDRGNHHEFVSLVKELARPGELIQNTTYKFEFLNVEKPYESYTGSNVFTPRPNVFNENETIAKYEIMDGAPVRGESIPIRVFLAGYDLAPTMRDINKKFSVKYFLNLVLMDEEDRRYFKQQVFTPNLIKELDIIVHTLSSYPEMNSPIKMEVGIEDCLHIEFEYNKCNTWNLKDVIVGKIYFLLVRIKIKHMEIAIIKRETTGTGIFLSLY

cccccccccEEEEEEEccccccCEEEEEcccccEEEEEEEEcccEEEEEEEEEEcccccEEEEEEEEEEEEEEEEEEcccccCEEEEEEEEcccccccEEccEEEEEEEcccccccEEECcccEEcccccEEEEEEEEEEEEEEcccccccccEEEEEEEEEECcccccccccccEEEEEEEEEEEEcHHHHcEEECcEEccccEEEEEEEEEEccccccccccEEEEEEccEEEEEEEEEccccccccccEEEEEEEEEEEEEEEEEEEEEEEEEEEEcccEEEccc

MSFFGFGQSADIEIKLDGTDT*************ERFYLYYDGESVTGQVNIVLKKHGSKLEHQGIKIEFIGQIELYYDRGNHHEFVSLVKELARPGELIQNTTYKFEFLNVEKPYESYTGSNVFTPRPNVFNENETIAKYEIMDGAPVRGESIPIRVFLAGYDLAPTMRDINKKFSVKYFLNLVLMDEEDRRYFKQQVFTPNLIKELDIIVHTLSSYPEMNSPIKMEVGIEDCLHIEFEYNKCNTWNLKDVIVGKIYFLLVRIKIKHMEIAIIKRETTGTGIFLSLY

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Vacuolar protein sorting-associated protein 26B	Probable component of the retromer complex, a complex required to retrieve lysosomal enzyme receptors (IGF2R and M6PR) from endosomes to the trans-Golgi network.	confident	Q8C0E2
Vacuolar protein sorting-associated protein 26B	Probable component of the retromer complex, a complex required to retrieve lysosomal enzyme receptors (IGF2R and M6PR) from endosomes to the trans-Golgi network.	confident	Q5BKM4
Vacuolar protein sorting-associated protein 26B	Probable component of the retromer complex, a complex required to retrieve lysosomal enzyme receptors (IGF2R and M6PR) from endosomes to the trans-Golgi network.	confident	Q4G0F5

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0031982 [CC]	vesicle	probable	GO:0005575, GO:0043226
GO:0005829 [CC]	cytosol	probable	GO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0042147 [BP]	retrograde transport, endosome to Golgi	probable	GO:0016197, GO:0009987, GO:0016192, GO:0046907, GO:0006810, GO:0044765, GO:0008150, GO:0051649, GO:0044763, GO:0051234, GO:0051179, GO:0044699, GO:0051641
GO:0005768 [CC]	endosome	probable	GO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2R51, chain A
Confidence level:very confident
Coverage over the Query: 9-125,156-157,180-285
View the alignment between query and template
View the model in PyMOL

Template: 2R51, chain A
Confidence level:very confident
Coverage over the Query: 7-206
View the alignment between query and template
View the model in PyMOL