254780123

254780123

hypothetical protein CLIBASIA_00010

GeneID in NCBI database:8209098Locus tag:CLIBASIA_00010
Protein GI in NCBI database:254780123Protein Accession:YP_003064536.1
Gene range:+(497, 820)Protein Length:107aa
Gene description:hypothetical protein
COG prediction:none
KEGG prediction:hypothetical protein
SEED prediction:hypothetical protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED1 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------
MSVHFIEEAVKAKDIPQLLTFLSLITQGLQEALITQDVKAVEAVDPDLKKRVTVLAISYMKRCGDKGKSQFLSEILVPALGTHKTFVDCTDEDFRLVEAKLLEQSDA
ccHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHcccccHHHHHHHHHHHHHccc
cccHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHccccEEEEccHcHHHHHHHHHHHHHHHcccccHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHcccc
MSVHFIEEAvkakdipqLLTFLSLITQGLQEALITQDVKAVEAVDPDLKKRVTVLAISYMKrcgdkgksqFLSEILVPalgthktfvdctdEDFRLVEAKLLEQSDA
MSVHFIEEavkakdipqLLTFLSLITQGLQEALITQDvkaveavdpdlkKRVTVLAISYMkrcgdkgksQFLSEILVPALGTHKTFVDCTDEDFRLVEAKLLEQSDA
MSVHFIEEAVKAKDIPQLLTFLSLITQGLQEALITQDVKAVEAVDPDLKKRVTVLAISYMKRCGDKGKSQFLSEILVPALGTHKTFVDCTDEDFRLVEAKLLEQSDA
****F**EAVKAKDIPQLLTFLSLITQGLQEALI***********PDLKKRVTVLAISYMKRCGDKGKSQFLSEILVPALGTHKTFVDCTDEDFRLVEAKLLE****
MSVHFIEEAVKAKDIPQLLTFLSLITQGLQEALITQDVKAVEAVDPDLKKRVTVLAISYMKRCGDKGKSQFLSEILVPALGTHKTFVDCTDEDFRLVEAKLLEQSDA
*SVHFIEEAVKAKDIPQLLTFLSLITQGLQEALITQDVKAVEAVDPDLKKRVTVLAISYMKRCGDKGKSQFLSEILVPALGTHKTFVDCTDEDFRLVEAKLLEQ***
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSVHFIEEAVKAKDIPQLLTFLSLITQGLQEALITQDVKAVEAVDPDLKKRVTVLAISYMKRCGDKGKSQFLSEILVPALGTHKTFVDCTDEDFRLVEAKLLEQSDA

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target107 hypothetical protein CLIBASIA_00010 [Candidatus Liberib
31512196272 hypothetical protein CKC_01060 [Candidatus Liberibacter 1 9e-08
>gi|315121962|ref|YP_004062451.1| hypothetical protein CKC_01060 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 72 Back     alignment and organism information
 Score = 60.1 bits (144), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 34/71 (47%), Positives = 46/71 (64%), Gaps = 6/71 (8%)

Query: 1  MSVHFIEEAVKAKDIPQLLTFLSLITQGLQEALITQDVKAVEAV---DPDLKKRVTVLAI 57
          MSV  I+EA++AKD+ +L  FL+LIT GL+E   +   +   A    DPDLK RVTVLA+
Sbjct: 1  MSVQAIKEAIRAKDVAKLCEFLALITNGLKEITHSSKPQTTTAPLQGDPDLKHRVTVLAL 60

Query: 58 SY---MKRCGD 65
          S     +RCG+
Sbjct: 61 SLHEEARRCGE 71


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

No hit with e-value below 0.005

Conserved Domains in CDD Database Detected by HHsearch

No hit with probability above 90.00


Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

No hit with probability above 90.00


Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

No hit with probability higher than 90.00