254780122

254780122

hypothetical protein CLIBASIA_00005

GeneID in NCBI database:8210255Locus tag:CLIBASIA_00005
Protein GI in NCBI database:254780122Protein Accession:YP_003064535.1
Gene range:+(36, 407)Protein Length:123aa
Gene description:hypothetical protein
COG prediction:none
KEGG prediction:hypothetical protein
SEED prediction:hypothetical protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120---
MGALKNHFHDEINENFYFHSHPNADPDISIEMQISENQRYLDEEISQCNAVVDVFKRSDSTILDKLDAMDDLKTYISLLQATAKNLKSLLKEYWEESLDGEDDEEIYEHPDQEHREDYYANQI
ccHHHHHHHHHHHccEEEccccccccccEEEEEEccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHcccHHHHHHHHHHcc
cccHHHcccHHHHcccEEccccccccccEEEEEEcccccccHHHHHHcccEEEHEcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHccccHHHHHHHHHccc
mgalknhfhdeinenfyfhshpnadpdisieMQISENQRYLDEEISQCNAVVDVfkrsdstildKLDAMDDLKTYISLLQATAKNLKSLLKEYWEesldgeddeeiyehpdqehreDYYANQI
MGALKNHFHDEINENFYFHSHPNADPDISIEMQISENQRYLDEEISQCNAVVDVFKRSDSTILDKLDAMDDLKTYISLLQATAKNLKSLLKEYWEESLdgeddeeiyehpdqehredyyanqi
MGALKNHFHDEINENFYFHSHPNADPDISIEMQISENQRYLDEEISQCNAVVDVFKRSDSTILDKLDAMDDLKTYISLLQATAKNLKSLLKEYWEESLDGEDDEEIYEHPDQEHREDYYANQI
******HFHDEINENFYFHSHPNADPD*SI**QISENQRYLDEEISQCNAVVDVFKRSDSTILDKLDAMDDLKTYISLLQATAKNLKSLLKE**************************YA***
MGALKNHFHDEINENFYFHSHPNADPDISIEMQISENQRYLDEEISQCNAVVDVFKRSDSTILDKLDAMDDLKTYISLLQATAKNLKSLLKEYWEESLDGEDDEEIYEHPDQEHREDYYANQI
*GALKNHFHDEINENFYFHSHPNADPDISIEMQISENQRYLDEEISQCNAVVDVFKRSDSTILDKLDAMDDLKTYISLLQATAKNLKSLLKEYWEESLDGEDDEEIYEHPDQEHREDYY*NQI
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGALKNHFHDEINENFYFHSHPNADPDISIEMQISENQRYLDEEISQCNAVVDVFKRSDSTILDKLDAMDDLKTYISLLQATAKNLKSLLKEYWEESLDGEDDEEIYEHPDQEHREDYYANQI
MGALKNHFHDEINENFYFHSHPNADPDISIEMQISENQRYLDEEISQCNAVVDVFKRSDSTILDKLDAMDDLKTYISLLQATAKNLKSLLKEYWEESLDGEDDEEIYEHPDQEHREDYYANQI
MGALKNHFHDEINENFYFHSHPNADPDISIEMQISENQRYLDEEISQCNAVVDVFKRSDSTILDKLDAMDDLKTYISLLQATAKNLKSLLKEYWEESLDGEDDEEIYEHPDQEHREDYYANQI

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target123 hypothetical protein CLIBASIA_00005 [Candidatus Liberib
254781220130 hypothetical protein CLIBASIA_05635 [Candidatus Li 7e-09
>gi|254781220|ref|YP_003065633.1| hypothetical protein CLIBASIA_05635 [Candidatus Liberibacter asiaticus str. psy62] Length = 130 Back     alignment
 Score = 50.8 bits (120), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 43/135 (31%), Positives = 69/135 (51%), Gaps = 17/135 (12%)

Query: 1   MGALKNHFHDEINENFYFHSHPNA----DPDISIEMQISENQRYLDEEISQCNAVVDVFK 56
           MG LK ++ +EI  N+ F S  N     +P+ + E+++ E    L+  +     ++    
Sbjct: 1   MGQLKQYYLEEIEANYEFLSAVNPRMGIEPESNYEVEVIEK---LERALKTSKKLIHFRD 57

Query: 57  RSDST-ILDKLDAMDDLKTYISLLQATAKNLKSLL---KEYW----EESLDGEDDEEIYE 108
           R+  T IL+  D ++++   I L +A  + L+  +    E W    E   D E  E   E
Sbjct: 58  RTIRTHILE--DLIEEVNRIIVLAKAHKRRLELKIFEDNEVWRLLDEAREDCEGCENCSE 115

Query: 109 HPDQEHREDYYANQI 123
           HPDQEH+EDYYA+QI
Sbjct: 116 HPDQEHKEDYYASQI 130

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target123 hypothetical protein CLIBASIA_00005 [Candidatus Liberib
317120693123 hypothetical protein SC1_gp185 [Liberibacter phage SC1] 1 3e-65
315121961128 hypothetical protein CKC_01055 [Candidatus Liberibacter 1 5e-13
254781220130 hypothetical protein CLIBASIA_05635 [Candidatus Liberib 1 6e-05
>gi|317120693|gb|ADV02516.1| hypothetical protein SC1_gp185 [Liberibacter phage SC1] Length = 123 Back     alignment and organism information
 Score =  251 bits (640), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 122/123 (99%), Positives = 123/123 (100%)

Query: 1   MGALKNHFHDEINENFYFHSHPNADPDISIEMQISENQRYLDEEISQCNAVVDVFKRSDS 60
           MGALKNHFHDEINENFYFHSHPNADPDISIEMQISENQRYLDEEISQCNAVVDVFKRSDS
Sbjct: 1   MGALKNHFHDEINENFYFHSHPNADPDISIEMQISENQRYLDEEISQCNAVVDVFKRSDS 60

Query: 61  TILDKLDAMDDLKTYISLLQATAKNLKSLLKEYWEESLDGEDDEEIYEHPDQEHREDYYA 120
           TILDKLDA+DDLKTYISLLQATAKNLKSLLKEYWEESLDGEDDEEIYEHPDQEHREDYYA
Sbjct: 61  TILDKLDAVDDLKTYISLLQATAKNLKSLLKEYWEESLDGEDDEEIYEHPDQEHREDYYA 120

Query: 121 NQI 123
           NQI
Sbjct: 121 NQI 123


Species: Liberibacter phage SC1
Genus: 
Family: Podoviridae
Order: Caudovirales
Class: 
Phylum: 
Superkingdom: Viruses
>gi|315121961|ref|YP_004062450.1| hypothetical protein CKC_01055 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 128 Back     alignment and organism information
>gi|254781220|ref|YP_003065633.1| hypothetical protein CLIBASIA_05635 [Candidatus Liberibacter asiaticus str. psy62] Length = 130 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

No hit with e-value below 0.005

Conserved Domains in CDD Database Detected by HHsearch

No hit with probability above 90.00


Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

No hit with probability above 90.00


Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

No hit with probability higher than 90.00