254780135

254780135

hypothetical protein CLIBASIA_00070

GeneID in NCBI database:8209110Locus tag:CLIBASIA_00070
Protein GI in NCBI database:254780135Protein Accession:YP_003064548.1
Gene range:-(9787, 11013)Protein Length:408aa
Gene description:hypothetical protein
COG prediction:none
KEGG prediction:hypothetical protein
SEED prediction:hypothetical protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM1 TM-Helix
TOPPRED2 TM-Helix
HMMTOP1 TM-Helix
MEMSAT1 TM-Helix
MEMSAT_SVM1 TM-Helix
PHOBIUS1 TM-Helix
SignalP_HMMyes
SignalP_NNyes
COILScoiled coil
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------41
MFQNKNFLLGVLRLKKCTRGVFLVITAILLSSFVAIVDVVVDQVTVMQKTALLQEVLDHVIYRTSPKNLYDLREAGRDNFIRHQIEKALNTYNSRDLSNIGSIESIVKDAVILTKNVNSLPLQFTVDIALSTTVQLRGSLLQMFSQSKGKVDISRRKKVMYKQNIGLMIMPFAWDGYWLASRGKVADSQVHRPKYLEYSHYYQQYLNRNTLVKNFLSQIPYKNFCMAPYHYKSIFYWAFENFQYHQDNNMLIFYSHRDFYRITWDHFPYSFIKNVFDMTSNQFGDGQVLTNTNHCFPHGASHSKYMLMFAIGNQLSRSSVGKETIDRILQDCYYMHKHHRTGRGAITIFSVGFSPDQDTRYTLRQCASDPSKYYEINSDENVMPIAKSLARNVITNWFSQFTITVVDS
ccccccEEEEEEEHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHccHHHHHHHHHHHHHHccccccHHHcccHHHHHHHHHEEEcccccccEEEEEEEEEEEEEEEHHHHHHHHHHccccEEHHHHHHHHHHccccEEEEEEccccEEEEcccccccccccccccccHHHHHHHHHcHHHHHHHHHHHccccccccccccccEEEEEEEcccEEEccccEEEEEEcccEEEEEHHHccHHHHHHHHHHHcccccccEEEEcccccccccccccEEEEEEEEcccHHHHHccHHHHHHHHHHHHHHHHHccccccEEEEEEEEccccccHHHHHHHHHcccHHEEEEcccccHHHHHHHHHHHHHHHHHHEEEEEEEcc
ccccHHHHHHHHHHHHHcHHHHHHHHHHHHHHHEEEEEEEHHHHHHHHHHHHHHHHHcHEEEEcccccHHHHHHHcccHHHHHHHHHHHHHccccccHccccHHHHHHHHEEEEccccccccEEEEEEEHHHHHHHHHHHHHHHccccccEEccHHHHHHHHHHHHHEEcccccccEEEEccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHcccccEEEEEcccccEEEEcccccHHHHHcHccccccccccccEEEcccccccccccHHHHHHHHHHccHcccccccHHHHHHHHHHHHHHHHcccccccEEEEEEccccccccccHHHHHcccccccEEEEcccccHHHHHHHHHHHHHHHHHHccEEEEEcc
MFQNKNFLLGVLRLKKCTRGVFLVITAILLSSFVAIVDVVVDQVTVMQKTALLQEVLDHViyrtspknlydLREAGRDNFIRHQIEKALNTynsrdlsnigsieSIVKDAVILTknvnslplqfTVDIALSTTVQLRGSLLQMFsqskgkvdisRRKKVMYKQNIGLmimpfawdgywlasrgkvadsqvhrpkyleYSHYYQQYLNRNTLVKNFLsqipyknfcmapyhykSIFYWAFEnfqyhqdnnmlifyshrdfyritwdhfpysfiknvfdmtsnqfgdgqvltntnhcfphgashSKYMLMFAIGnqlsrssvgKETIDRILQDCYYmhkhhrtgrgaitifsvgfspdqdtrytlrqcasdpskyyeinsdenvMPIAKSLARNVITNWFSQFTITVVDS
MFQNKNFLLGVLRLKKCTRGVFLVITAILLSSFVAIVDVVVDQVTVMQKTALLQEVLDHVIYRTSPKNLYDLREAGRDNFIRHQIEKALntynsrdlsnIGSIESIVKDAVILTKNVNSLPLQFTVDIALSTTVQLRGSLLQmfsqskgkvdisrrKKVMYKQNIGLMIMPFAWDGYWLASRGKVADSQVHRPKYLEYSHYYQQYLNRNTLVKNFLSQIPYKNFCMAPYHYKSIFYWAFENFQYHQDNNMLIFYSHRDFYRITWDHFPYSFIKNVFDMTSNQFGDGQVLTNTNHCFPHGASHSKYMLMFAIGNQLSRSSVGKETIDRILQDCYYMHKHHRTGRGAITIFSVGFSPDQDTRYTLRQCasdpskyyeinsdeNVMPIAKSLARNVITNWFSQftitvvds
MFQNKNFLLGVLRLKKCTRGVFLVITAILLSSFvaivdvvvdqvtvMQKTALLQEVLDHVIYRTSPKNLYDLREAGRDNFIRHQIEKALNTYNSRDLSNIGSIESIVKDAVILTKNVNSLPLQFTVDIALSTTVQLRGSLLQMFSQSKGKVDISRRKKVMYKQNIGLMIMPFAWDGYWLASRGKVADSQVHRPKYLEYSHYYQQYLNRNTLVKNFLSQIPYKNFCMAPYHYKSIFYWAFENFQYHQDNNMLIFYSHRDFYRITWDHFPYSFIKNVFDMTSNQFGDGQVLTNTNHCFPHGASHSKYMLMFAIGNQLSRSSVGKETIDRILQDCYYMHKHHRTGRGAITIFSVGFSPDQDTRYTLRQCASDPSKYYEINSDENVMPIAKSLARNVITNWFSQFTITVVDS
**QNKNFLLGVLRLKKCTRGVFLVITAILLSSFVAIVDVVVDQVTVMQKTALLQEVLDHVIYRTSPKNLYDLREAGRDNFIRHQIEKALNTYNSRDLSNIGSIESIVKDAVILTKNVNSLPLQFTVDIALSTTVQLRGSLLQM****************MYKQNIGLMIMPFAWDGYWLASRGKVADSQVHRPKYLEYSHYYQQYLNRNTLVKNFLSQIPYKNFCMAPYHYKSIFYWAFENFQYHQDNNMLIFYSHRDFYRITWDHFPYSFIKNVFDMTSNQFGDGQVLTNTNHCFPHGASHSKYMLMFAIGN************DRILQDCYYMHKHHRTGRGAITIFSVGFSPDQDTRYTLRQCASDPSKYYEINSDENVMPIAKSLARNVITNWFSQFTITVVD*
MFQNKNFLLGVLRLKKCTRGVFLVITAILLSSFVAIVDVVVDQVTVMQKTALLQEVLDHVIYRTSPKNLYDLREAGRDNFIRHQIEKALNTYNSRDLSNIGSIESIVKDAVILTKNVNSLPLQFTVDIALSTTVQLRGSLLQMFSQSKGKVDISRRKKVMYKQNIGLMIMPFAWDGYWLASRGKVADSQVHRPKYLEYSHYYQQYLNRNTLVKNFLSQIPYKNFCMAPYHYKSIFYWAFENFQYHQDNNMLIFYSHRDFYRITWDHFPYSFIKNVFDMTSNQFGDGQVLTNTNHCFPHGASHSKYMLMFAIGNQLSRSSVGKETIDRILQDCYYMHKHHRTGRGAITIFSVGFSPDQDTRYTLRQCASDPSKYYEINSDENVMPIAKSLARNVITNWFSQFTITVVDS
MFQNKNFLLGVLRLKKCTRGVFLVITAILLSSFVAIVDVVVDQVTVMQKTALLQEVLDHVIYRTSPKNLYDLREAGRDNFIRHQIEKALNTYNSRDLSNIGSIESIVKDAVILTKNVNSLPLQFTVDIALSTTVQLRGSLLQMFSQSKGKVDISRRKKVMYKQNIGLMIMPFAWDGYWLASRGKVADSQVHRPKYLEYSHYYQQYLNRNTLVKNFLSQIPYKNFCMAPYHYKSIFYWAFENFQYHQDNNMLIFYSHRDFYRITWDHFPYSFIKNVFDMTSNQFGDGQVLTNTNHCFPHGASHSKYMLMFAIGNQLSRSSVGKETIDRILQDCYYMHKHHRTGRGAITIFSVGFSPDQDTRYTLRQCASDPSKYYEINSDENVMPIAKSLARNVITNWFSQFTITVVDS
iiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
MFQNKNFLLGVLRLKKCTRGVFLVITAILLSSFVAIVDVVVDQVTVMQKTALLQEVLDHVIYRTSPKNLYDLREAGRDNFIRHQIEKALNTYNSRDLSNIGSIESIVKDAVILTKNVNSLPLQFTVDIALSTTVQLRGSLLQMFSQSKGKVDISRRKKVMYKQNIGLMIMPFAWDGYWLASRGKVADSQVHRPKYLEYSHYYQQYLNRNTLVKNFLSQIPYKNFCMAPYHYKSIFYWAFENFQYHQDNNMLIFYSHRDFYRITWDHFPYSFIKNVFDMTSNQFGDGQVLTNTNHCFPHGASHSKYMLMFAIGNQLSRSSVGKETIDRILQDCYYMHKHHRTGRGAITIFSVGFSPDQDTRYTLRQCASDPSKYYEINSDENVMPIAKSLARNVITNWFSQFTITVVDS

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target408 hypothetical protein CLIBASIA_00070 [Candidatus Liberib
254780929408 hypothetical protein CLIBASIA_04140 [Candidatus Li 0.0
254780914408 hypothetical protein CLIBASIA_04065 [Candidatus Li 0.0
254781007411 hypothetical protein CLIBASIA_04540 [Candidatus Li 0.0
254781108398 von Willebrand factor type A [Candidatus Liberibac 0.045
>gi|254780929|ref|YP_003065342.1| hypothetical protein CLIBASIA_04140 [Candidatus Liberibacter asiaticus str. psy62] Length = 408 Back     alignment
 Score =  744 bits (1921), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 373/408 (91%), Positives = 381/408 (93%)

Query: 1   MFQNKNFLLGVLRLKKCTRGVFLVITAILLSSFVAIVDVVVDQVTVMQKTALLQEVLDHV 60
           MFQNKNFLLGVLRLKKCTRGVFLVITAILLSSFVAIVDVVVDQVTVMQKTA LQEVLDHV
Sbjct: 1   MFQNKNFLLGVLRLKKCTRGVFLVITAILLSSFVAIVDVVVDQVTVMQKTAWLQEVLDHV 60

Query: 61  IYRTSPKNLYDLREAGRDNFIRHQIEKALNTYNSRDLSNIGSIESIVKDAVILTKNVNSL 120
           IYRTSPKNLYDLREAGRDNFIRHQIEKALNTYNSRDLSNIGSIESIVKDAVILTKNVNSL
Sbjct: 61  IYRTSPKNLYDLREAGRDNFIRHQIEKALNTYNSRDLSNIGSIESIVKDAVILTKNVNSL 120

Query: 121 PLQFTVDIALSTTVQLRGSLLQMFSQSKGKVDISRRKKVMYKQNIGLMIMPFAWDGYWLA 180
           PLQFTVDIALSTTVQLRGSLLQMFSQSKGKVDISRRKKVMYKQNIGLMIMPFAWDGYWLA
Sbjct: 121 PLQFTVDIALSTTVQLRGSLLQMFSQSKGKVDISRRKKVMYKQNIGLMIMPFAWDGYWLA 180

Query: 181 SRGKVADSQVHRPKYLEYSHYYQQYLNRNTLVKNFLSQIPYKNFCMAPYHYKSIFYWAFE 240
           SRGKVADS+VH PKYLEYSHYYQQYLNRNTLVKNFLSQIPYKNFCMAPYHY SI YWA  
Sbjct: 181 SRGKVADSKVHPPKYLEYSHYYQQYLNRNTLVKNFLSQIPYKNFCMAPYHYSSILYWAVG 240

Query: 241 NFQYHQDNNMLIFYSHRDFYRITWDHFPYSFIKNVFDMTSNQFGDGQVLTNTNHCFPHGA 300
              Y  DN       ++D Y  TWDHFPYSFIKNVFDMTSNQFGDGQVLTNTNHCFPHGA
Sbjct: 241 TLTYSVDNKTTTREYYKDPYYATWDHFPYSFIKNVFDMTSNQFGDGQVLTNTNHCFPHGA 300

Query: 301 SHSKYMLMFAIGNQLSRSSVGKETIDRILQDCYYMHKHHRTGRGAITIFSVGFSPDQDTR 360
           S +KYMLM AIGNQLSRSSV KE I+++LQDC+YMHK HRTGR AITIFSVGFSPDQDTR
Sbjct: 301 SQNKYMLMLAIGNQLSRSSVEKEKIEKVLQDCHYMHKRHRTGRDAITIFSVGFSPDQDTR 360

Query: 361 YTLRQCASDPSKYYEINSDENVMPIAKSLARNVITNWFSQFTITVVDS 408
           YTLRQCASDPSKYYEINSDENVMPIAKSLARNVITNWFSQFTITVVDS
Sbjct: 361 YTLRQCASDPSKYYEINSDENVMPIAKSLARNVITNWFSQFTITVVDS 408

>gi|254780914|ref|YP_003065327.1| hypothetical protein CLIBASIA_04065 [Candidatus Liberibacter asiaticus str. psy62] Length = 408 Back     alignment
 Score =  744 bits (1921), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 373/408 (91%), Positives = 381/408 (93%)

Query: 1   MFQNKNFLLGVLRLKKCTRGVFLVITAILLSSFVAIVDVVVDQVTVMQKTALLQEVLDHV 60
           MFQNKNFLLGVLRLKKCTRGVFLVITAILLSSFVAIVDVVVDQVTVMQKTA LQEVLDHV
Sbjct: 1   MFQNKNFLLGVLRLKKCTRGVFLVITAILLSSFVAIVDVVVDQVTVMQKTAWLQEVLDHV 60

Query: 61  IYRTSPKNLYDLREAGRDNFIRHQIEKALNTYNSRDLSNIGSIESIVKDAVILTKNVNSL 120
           IYRTSPKNLYDLREAGRDNFIRHQIEKALNTYNSRDLSNIGSIESIVKDAVILTKNVNSL
Sbjct: 61  IYRTSPKNLYDLREAGRDNFIRHQIEKALNTYNSRDLSNIGSIESIVKDAVILTKNVNSL 120

Query: 121 PLQFTVDIALSTTVQLRGSLLQMFSQSKGKVDISRRKKVMYKQNIGLMIMPFAWDGYWLA 180
           PLQFTVDIALSTTVQLRGSLLQMFSQSKGKVDISRRKKVMYKQNIGLMIMPFAWDGYWLA
Sbjct: 121 PLQFTVDIALSTTVQLRGSLLQMFSQSKGKVDISRRKKVMYKQNIGLMIMPFAWDGYWLA 180

Query: 181 SRGKVADSQVHRPKYLEYSHYYQQYLNRNTLVKNFLSQIPYKNFCMAPYHYKSIFYWAFE 240
           SRGKVADS+VH PKYLEYSHYYQQYLNRNTLVKNFLSQIPYKNFCMAPYHY SI YWA  
Sbjct: 181 SRGKVADSKVHPPKYLEYSHYYQQYLNRNTLVKNFLSQIPYKNFCMAPYHYSSILYWAVG 240

Query: 241 NFQYHQDNNMLIFYSHRDFYRITWDHFPYSFIKNVFDMTSNQFGDGQVLTNTNHCFPHGA 300
              Y  DN       ++D Y  TWDHFPYSFIKNVFDMTSNQFGDGQVLTNTNHCFPHGA
Sbjct: 241 TLTYSVDNKTTTREYYKDPYYATWDHFPYSFIKNVFDMTSNQFGDGQVLTNTNHCFPHGA 300

Query: 301 SHSKYMLMFAIGNQLSRSSVGKETIDRILQDCYYMHKHHRTGRGAITIFSVGFSPDQDTR 360
           S +KYMLM AIGNQLSRSSV KE I+++LQDC+YMHK HRTGR AITIFSVGFSPDQDTR
Sbjct: 301 SQNKYMLMLAIGNQLSRSSVEKEKIEKVLQDCHYMHKRHRTGRDAITIFSVGFSPDQDTR 360

Query: 361 YTLRQCASDPSKYYEINSDENVMPIAKSLARNVITNWFSQFTITVVDS 408
           YTLRQCASDPSKYYEINSDENVMPIAKSLARNVITNWFSQFTITVVDS
Sbjct: 361 YTLRQCASDPSKYYEINSDENVMPIAKSLARNVITNWFSQFTITVVDS 408

>gi|254781007|ref|YP_003065420.1| hypothetical protein CLIBASIA_04540 [Candidatus Liberibacter asiaticus str. psy62] Length = 411 Back     alignment
 Score =  743 bits (1917), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 372/408 (91%), Positives = 380/408 (93%)

Query: 1   MFQNKNFLLGVLRLKKCTRGVFLVITAILLSSFVAIVDVVVDQVTVMQKTALLQEVLDHV 60
           MFQNKNFLLGVLRLKKCTRGVFLVITAILLSSFVAIVDVVVDQVTVMQKTA LQEVLDHV
Sbjct: 1   MFQNKNFLLGVLRLKKCTRGVFLVITAILLSSFVAIVDVVVDQVTVMQKTAWLQEVLDHV 60

Query: 61  IYRTSPKNLYDLREAGRDNFIRHQIEKALNTYNSRDLSNIGSIESIVKDAVILTKNVNSL 120
           IYRTSPKNLYDLREAGRDNFIRHQIEKALNTYNSRDLSN GSIESIVKDAVILTKNVNSL
Sbjct: 61  IYRTSPKNLYDLREAGRDNFIRHQIEKALNTYNSRDLSNTGSIESIVKDAVILTKNVNSL 120

Query: 121 PLQFTVDIALSTTVQLRGSLLQMFSQSKGKVDISRRKKVMYKQNIGLMIMPFAWDGYWLA 180
           PLQFTVDIALSTTVQLRGSLLQMFSQSKGKVDISRRKKVMYKQNIGLMIMPFAWDGYWLA
Sbjct: 121 PLQFTVDIALSTTVQLRGSLLQMFSQSKGKVDISRRKKVMYKQNIGLMIMPFAWDGYWLA 180

Query: 181 SRGKVADSQVHRPKYLEYSHYYQQYLNRNTLVKNFLSQIPYKNFCMAPYHYKSIFYWAFE 240
           SRGKVADS+VH PKYLEYSHYYQQYLNRNTLVKNFLSQIPYKNFCMAPYHY SI YWA  
Sbjct: 181 SRGKVADSKVHPPKYLEYSHYYQQYLNRNTLVKNFLSQIPYKNFCMAPYHYSSILYWAVG 240

Query: 241 NFQYHQDNNMLIFYSHRDFYRITWDHFPYSFIKNVFDMTSNQFGDGQVLTNTNHCFPHGA 300
              Y  DN       ++D Y  TWDHFPYSFIKNVFDMTSNQFGDGQVLTNTNHCFPHGA
Sbjct: 241 TLTYSVDNKTTTREYYKDPYYATWDHFPYSFIKNVFDMTSNQFGDGQVLTNTNHCFPHGA 300

Query: 301 SHSKYMLMFAIGNQLSRSSVGKETIDRILQDCYYMHKHHRTGRGAITIFSVGFSPDQDTR 360
           S +KYMLM AIGNQLSRSSV KE I+++LQDC+YMHK HRTGR AITIFSVGFSPDQDTR
Sbjct: 301 SQNKYMLMLAIGNQLSRSSVEKEKIEKVLQDCHYMHKRHRTGRDAITIFSVGFSPDQDTR 360

Query: 361 YTLRQCASDPSKYYEINSDENVMPIAKSLARNVITNWFSQFTITVVDS 408
           YTLRQCASDPSKYYEINSDENVMPIAKSLARNVITNWFSQFTITVVDS
Sbjct: 361 YTLRQCASDPSKYYEINSDENVMPIAKSLARNVITNWFSQFTITVVDS 408

>gi|254781108|ref|YP_003065521.1| von Willebrand factor type A [Candidatus Liberibacter asiaticus str. psy62] Length = 398 Back     alignment
 Score = 30.8 bits (68), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 19/85 (22%), Positives = 39/85 (45%), Gaps = 7/85 (8%)

Query: 299 GASHSKYMLMFAIGNQLSRSSVGKETIDRILQDCYYMHKHHRTGRGAITIFSVGFSPDQD 358
           G++  K  ++F    + S +S  + T++  LQ C YM          + I+SV  S   +
Sbjct: 300 GSTRLKKFVIFITDGENSGASAYQNTLN-TLQICEYMR------NAGMKIYSVAVSAPPE 352

Query: 359 TRYTLRQCASDPSKYYEINSDENVM 383
            +  LR+C     +++ +N    ++
Sbjct: 353 GQDLLRKCTDSSGQFFAVNDSRELL 377

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target408 hypothetical protein CLIBASIA_00070 [Candidatus Liberib
254780914408 hypothetical protein CLIBASIA_04065 [Candidatus Liberib 1 0.0
254781007411 hypothetical protein CLIBASIA_04540 [Candidatus Liberib 1 0.0
315122409411 hypothetical protein CKC_03305 [Candidatus Liberibacter 1 5e-55
>gi|254780914|ref|YP_003065327.1| hypothetical protein CLIBASIA_04065 [Candidatus Liberibacter asiaticus str. psy62] Length = 408 Back     alignment and organism information
 Score =  744 bits (1921), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 373/408 (91%), Positives = 381/408 (93%)

Query: 1   MFQNKNFLLGVLRLKKCTRGVFLVITAILLSSFVAIVDVVVDQVTVMQKTALLQEVLDHV 60
           MFQNKNFLLGVLRLKKCTRGVFLVITAILLSSFVAIVDVVVDQVTVMQKTA LQEVLDHV
Sbjct: 1   MFQNKNFLLGVLRLKKCTRGVFLVITAILLSSFVAIVDVVVDQVTVMQKTAWLQEVLDHV 60

Query: 61  IYRTSPKNLYDLREAGRDNFIRHQIEKALNTYNSRDLSNIGSIESIVKDAVILTKNVNSL 120
           IYRTSPKNLYDLREAGRDNFIRHQIEKALNTYNSRDLSNIGSIESIVKDAVILTKNVNSL
Sbjct: 61  IYRTSPKNLYDLREAGRDNFIRHQIEKALNTYNSRDLSNIGSIESIVKDAVILTKNVNSL 120

Query: 121 PLQFTVDIALSTTVQLRGSLLQMFSQSKGKVDISRRKKVMYKQNIGLMIMPFAWDGYWLA 180
           PLQFTVDIALSTTVQLRGSLLQMFSQSKGKVDISRRKKVMYKQNIGLMIMPFAWDGYWLA
Sbjct: 121 PLQFTVDIALSTTVQLRGSLLQMFSQSKGKVDISRRKKVMYKQNIGLMIMPFAWDGYWLA 180

Query: 181 SRGKVADSQVHRPKYLEYSHYYQQYLNRNTLVKNFLSQIPYKNFCMAPYHYKSIFYWAFE 240
           SRGKVADS+VH PKYLEYSHYYQQYLNRNTLVKNFLSQIPYKNFCMAPYHY SI YWA  
Sbjct: 181 SRGKVADSKVHPPKYLEYSHYYQQYLNRNTLVKNFLSQIPYKNFCMAPYHYSSILYWAVG 240

Query: 241 NFQYHQDNNMLIFYSHRDFYRITWDHFPYSFIKNVFDMTSNQFGDGQVLTNTNHCFPHGA 300
              Y  DN       ++D Y  TWDHFPYSFIKNVFDMTSNQFGDGQVLTNTNHCFPHGA
Sbjct: 241 TLTYSVDNKTTTREYYKDPYYATWDHFPYSFIKNVFDMTSNQFGDGQVLTNTNHCFPHGA 300

Query: 301 SHSKYMLMFAIGNQLSRSSVGKETIDRILQDCYYMHKHHRTGRGAITIFSVGFSPDQDTR 360
           S +KYMLM AIGNQLSRSSV KE I+++LQDC+YMHK HRTGR AITIFSVGFSPDQDTR
Sbjct: 301 SQNKYMLMLAIGNQLSRSSVEKEKIEKVLQDCHYMHKRHRTGRDAITIFSVGFSPDQDTR 360

Query: 361 YTLRQCASDPSKYYEINSDENVMPIAKSLARNVITNWFSQFTITVVDS 408
           YTLRQCASDPSKYYEINSDENVMPIAKSLARNVITNWFSQFTITVVDS
Sbjct: 361 YTLRQCASDPSKYYEINSDENVMPIAKSLARNVITNWFSQFTITVVDS 408


Species: Candidatus Liberibacter asiaticus
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|254781007|ref|YP_003065420.1| hypothetical protein CLIBASIA_04540 [Candidatus Liberibacter asiaticus str. psy62] Length = 411 Back     alignment and organism information
>gi|315122409|ref|YP_004062898.1| hypothetical protein CKC_03305 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 411 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

No hit with e-value below 0.005

Conserved Domains in CDD Database Detected by HHsearch

No hit with probability above 90.00


Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

No hit with probability above 90.00


Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target408 hypothetical protein CLIBASIA_00070 [Candidatus Liberib
2ww8_A_221-279_318-447_506-585269 RRGA, cell WALL surface anchor family protein; IGG 95.76
>2ww8_A (A:221-279,A:318-447,A:506-585) RRGA, cell WALL surface anchor family protein; IGG, pilus, CNA_B, adhesin, integrin, cell adhesion; HET: EPE; 1.90A {Streptococcus pneumoniae} Back     alignment and structure
Probab=95.76  E-value=0.018  Score=37.03  Aligned_cols=59  Identities=17%  Similarity=0.253  Sum_probs=41.4

Q ss_pred             HHHHHHHHHHHHHCCCCCCEEEEEEEECCCCCC-------HHHHHHHHCCCCHHEEEECCCCCHHHHHHHHHHHH
Q ss_conf             999998898876313577418999841488743-------02678762059032044258765344789877777
Q gi|254780135|r  326 DRILQDCYYMHKHHRTGRGAITIFSVGFSPDQD-------TRYTLRQCASDPSKYYEINSDENVMPIAKSLARNV  393 (408)
Q Consensus       326 drilqdcyymhkhhrtgrgaitifsvgfspdqd-------trytlrqcasdpskyyeinsdenvmpiakslarnv  393 (408)
                      .+.+..|-.+.      ...|+||+|||..+-+       .++-|+.|||+|+.||+...   .-.+-+++|+..
T Consensus       202 ~~~~~~c~~~k------~~~i~i~ti~~~~~~~~~~~~~~~~~~l~~cas~~~~y~~~~~---~~~~f~~ia~~~  267 (269)
T 2ww8_A          202 PTRWYYNGNIA------PDGYDVFTVGIGINGDPGTDEATATSFMQSISSKPENYTNVTD---TTKILEQLNRYF  267 (269)
T ss_dssp             HHHHHHHHHTG------GGCCEEEEEEESCCCTTTSCHHHHHHHHHHTSSSGGGEEEESS---GGGHHHHHHHHH
T ss_pred             CEEEEEEEECC------CCCCEEEEEEEECCCCCCCCCCCCCEEEEEEECCCCCEEEECC---CCCEECCCCCCC
T ss_conf             30578875204------6763035776771564210023430577566116653264056---651111335541