254780153

254780153

phosphoserine aminotransferase

GeneID in NCBI database:8209130Locus tag:CLIBASIA_00180
Protein GI in NCBI database:254780153Protein Accession:YP_003064566.1
Gene range:-(36130, 37305)Protein Length:391aa
Gene description:phosphoserine aminotransferase
COG prediction:none
KEGG prediction:phosphoserine aminotransferase (EC:2.6.1.52); K00831 phosphoserine aminotransferase [EC:2.6.1.52]
SEED prediction:Phosphoserine aminotransferase (EC 2.6.1.52)
Pathway involved in KEGG:Methane metabolism [PATH:las00680]
Glycine, serine and threonine metabolism [PATH:las00260]
Vitamin B6 metabolism [PATH:las00750]
Subsystem involved in SEED:Glycine and Serine Utilization;
Serine Biosynthesis;
Pyridoxin (Vitamin B6) Biosynthesis
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED2 TM-Helix
HMMTOP1 TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-
MLDMRKPTRKPKRPFFSSGPCAKRPGWSLGILEGALLGRSHRCVLGKERINKAIQLTRKVLEVPENYRIAIVPASDTGAVEMALWSLLGYRGVDVLAWESFGLGWMSDIRQLSLQDVREFTAPYGSLPDFSKVDFDRDVVFVWNGTTSGVCVPDVGFIPESREGLVICDATSAVFARHIDFNKLDVVTFSAQKVLGGEAGFGIIILSPASVERLEKYVPSWPLPKIFRMVKGGRVMEGLFCGETINTPSLLCIEDYIDALLWLKKMGGLSACVERCNANAAVLFQFIQENDWIENLAVDETTRSNTSICMKIVDSDIASLDINSQKSFCKSMLSFLEKEEIAYDIGSYRDAPLGLRVWVGVTVEKEDLLLLCDWLRWVFYFQKISFLRAIS
ccccccccccccccccccccccccHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHccccccEEEEEcccHHHHHHHHHHHccccccEEEEEccHHHHHHHHHHHHcccccEEEEcccccccccHHHccccccEEEEEccccccEEcccHHHHHHHcccEEEEccccccccEEccHHHccEEEEcccccccccccEEEEEEcHHHHHHHHHcccccccHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHcccEEEEEEccccccHHHHHHHHHHHHHHHHHHHHcccEEEcccccccccEEEEEccccccHHHHHHHHHHHHHHHHHHHHHHHHccc
cccccccccccccccccccccccccHHHHHHHcccHccccccHHHHHHHHHHHHHHHHHHHccccccEEEEEEcccccHHHHHHHHHcccccccEEcccHHHHHHHHHHHHHcccccEEEcccccccccHHHccccccEEEEEccccccEEcccccccccccccEEEEEccHHHHcccccHHHccEEEEEHHHccccccccEEEEEcHHHHHHHHHccccccccHHHHHcccccEHHccccccccccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHcccccccccccHHHcccccccEEEccHHHHcccHHHHHHHHHHHHHHHHHccccEccccccccccccEEEEEccccHHHHHHHHHHHHHHHHHHHHHHHHHcc
mldmrkptrkpkrpffssgpcakrpgwslgiLEGAllgrshrcvlgkERINKAIQLTRKVlevpenyriaivpasdtGAVEMALWSLLGYRGVDVLAWESFGLGWMSDIRQLSLQDVreftapygslpdfskvdfdrdVVFVWNGttsgvcvpdvgfipesreglvicdaTSAVFArhidfnkldvVTFSaqkvlggeagfGIIILSPASVERLekyvpswplpkifrmvkggrvmeglfcgetintpsllCIEDYIDALLWLKKMGGLSACVERCNANAAVLFQFIQEndwienlavdettrsnTSICMKIVdsdiasldinSQKSFCKSMLSFLEKEEIaydigsyrdaplglRVWVGVTVEKEDLLLLCDWLRWVFYFQKISFLRAIS
mldmrkptrkpkrpffssgpcakrpgWSLGILEGALLGRSHRCVLGKERINKAIQLtrkvlevpenYRIAIVPASDTGAVEMALWSLLGYRGVDVLAWESFGLGWMSDIRQLSLQDVREFTAPygslpdfskvdFDRDVVFVWNGTTSGVCVPDVGFIPESREGLVICDATSAVFARHIDFNKLDVVTFSAQKVLGGEAGFGIIILSPASVERLEKYVPSWPLPKIFRMVKGGRVMEGLFCGETINTPSLLCIEDYIDALLWLKKMGGLSACVERCNANAAVLFQFIQENDWIENLAVDETTRSNTSICMKIVDSDIASLDINSQKSFCKSMLSFLEKEEIAYDIGSYRDAPLGLRVWVGVTVEKEDLLLLCDWLRWVFYFQKISFLRAIS
MLDMRKPTRKPKRPFFSSGPCAKRPGWSLGILEGALLGRSHRCVLGKERINKAIQLTRKVLEVPENYRIAIVPASDTGAVEMALWSLLGYRGVDVLAWESFGLGWMSDIRQLSLQDVREFTAPYGSLPDFSKVDFDRDVVFVWNGTTSGVCVPDVGFIPESREGLVICDATSAVFARHIDFNKLDVVTFSAQKVLGGEAGFGIIILSPASVERLEKYVPSWPLPKIFRMVKGGRVMEGLFCGETINTPSLLCIEDYIDALLWLKKMGGLSACVERCNANAAVLFQFIQENDWIENLAVDETTRSNTSICMKIVDSDIASLDINSQKSFCKSMLSFLEKEEIAYDIGSYRDAPLGLRVWVGVTVEKEDLLLLCDWLRWVFYFQKISFLRAIS
*********KPKRPFFSSGPCAKRPGWSLGILEGALLGRSHRCVLGKERINKAIQLTRKVLEVPENYRIAIVPASDTGAVEMALWSLLGYRGVDVLAWESFGLGWMSDIRQLSLQDVREFTAPYGSLPDFSKVDFDRDVVFVWNGTTSGVCVPDVGFIPESREGLVICDATSAVFARHIDFNKLDVVTFSAQKVLGGEAGFGIIILSPASVERLEKYVPSWPLPKIFRMVKGGRVMEGLFCGETINTPSLLCIEDYIDALLWLKKMGGLSACVERCNANAAVLFQFIQENDWIENLAVDETTRSNTSICMKIVDSDIASLDINSQKSFCKSMLSFLEKEEIAYDIGSYRDAPLGLRVWVGVTVEKEDLLLLCDWLRWVFYFQKIS******
**************FFSSGPCAKRPGWSLGILEGALLGRSHRCVLGKERINKAIQLTRKVLEVPENYRIAIVPASDTGAVEMALWSLLGYRGVDVLAWESFGLGWMSDIRQLSLQDVREFTAPYGSLPDFSKVDFDRDVVFVWNGTTSGVCVPDVGFIPESREGLVICDATSAVFARHIDFNKLDVVTFSAQKVLGGEAGFGIIILSPASVERLEKYVPSWPLPKIFRMVKGGRVMEGLFCGETINTPSLLCIEDYIDALLWLKKMGGLSACVERCNANAAVLFQFIQENDWIENLAVDETTRSNTSICMKIVDSDIASLDINSQKSFCKSMLSFLEKEEIAYDIGSYRDAPLGLRVWVGVTVEKEDLLLLCDWLRWVFYFQKISFLRAIS
*********KPKRPFFSSGPCAKRPGWSLGILEGALLGRSHRCVLGKERINKAIQLTRKVLEVPENYRIAIVPASDTGAVEMALWSLLGYRGVDVLAWESFGLGWMSDIRQLSLQDVREFTAPYGSLPDFSKVDFDRDVVFVWNGTTSGVCVPDVGFIPESREGLVICDATSAVFARHIDFNKLDVVTFSAQKVLGGEAGFGIIILSPASVERLEKYVPSWPLPKIFRMVKGGRVMEGLFCGETINTPSLLCIEDYIDALLWLKKMGGLSACVERCNANAAVLFQFIQENDWIENLAVDETTRSNTSICMKIVDSDIASLDINSQKSFCKSMLSFLEKEEIAYDIGSYRDAPLGLRVWVGVTVEKEDLLLLCDWLRWVFYFQKISFLR***
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLDMRKPTRKPKRPFFSSGPCAKRPGWSLGILEGALLGRSHRCVLGKERINKAIQLTRKVLEVPENYRIAIVPASDTGAVEMALWSLLGYRGVDVLAWESFGLGWMSDIRQLSLQDVREFTAPYGSLPDFSKVDFDRDVVFVWNGTTSGVCVPDVGFIPESREGLVICDATSAVFARHIDFNKLDVVTFSAQKVLGGEAGFGIIILSPASVERLEKYVPSWPLPKIFRMVKGGRVMEGLFCGETINTPSLLCIEDYIDALLWLKKMGGLSACVERCNANAAVLFQFIQENDWIENLAVDETTRSNTSICMKIVDSDIASLDINSQKSFCKSMLSFLEKEEIAYDIGSYRDAPLGLRVWVGVTVEKEDLLLLCDWLRWVFYFQKISFLRAIS
MLDMRKPTRKPKRPFFSSGPCAKRPGWSLGILEGALLGRSHRCVLGKERINKAIQLTRKVLEVPENYRIAIVPASDTGAVEMALWSLLGYRGVDVLAWESFGLGWMSDIRQLSLQDVREFTAPYGSLPDFSKVDFDRDVVFVWNGTTSGVCVPDVGFIPESREGLVICDATSAVFARHIDFNKLDVVTFSAQKVLGGEAGFGIIILSPASVERLEKYVPSWPLPKIFRMVKGGRVMEGLFCGETINTPSLLCIEDYIDALLWLKKMGGLSACVERCNANAAVLFQFIQENDWIENLAVDETTRSNTSICMKIVDSDIASLDINSQKSFCKSMLSFLEKEEIAYDIGSYRDAPLGLRVWVGVTVEKEDLLLLCDWLRWVFYFQKISFLRAIS
MLDMRKPTRKPKRPFFSSGPCAKRPGWSLGILEGALLGRSHRCVLGKERINKAIQLTRKVLEVPENYRIAIVPASDTGAVEMALWSLLGYRGVDVLAWESFGLGWMSDIRQLSLQDVREFTAPYGSLPDFSKVDFDRDVVFVWNGTTSGVCVPDVGFIPESREGLVICDATSAVFARHIDFNKLDVVTFSAQKVLGGEAGFGIIILSPASVERLEKYVPSWPLPKIFRMVKGGRVMEGLFCGETINTPSLLCIEDYIDALLWLKKMGGLSACVERCNANAAVLFQFIQENDWIENLAVDETTRSNTSICMKIVDSDIASLDINSQKSFCKSMLSFLEKEEIAYDIGSYRDAPLGLRVWVGVTVEKEDLLLLCDWLRWVFYFQKISFLRAIS

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target391 phosphoserine aminotransferase [Candidatus Liberibacter
170785438391 phosphoserine aminotransferase [Candidatus Liberibacter 1 0.0
315122755391 phosphoserine aminotransferase [Candidatus Liberibacter 1 0.0
15966484392 phosphoserine aminotransferase [Sinorhizobium meliloti 1 1e-149
150397817392 phosphoserine aminotransferase [Sinorhizobium medicae W 1 1e-148
241206176392 phosphoserine aminotransferase [Rhizobium leguminosarum 1 1e-147
190893268392 phosphoserine aminotransferase protein [Rhizobium etli 1 1e-147
327193459392 phosphoserine aminotransferase [Rhizobium etli CNPAF512 1 1e-146
116253701392 phosphoserine aminotransferase [Rhizobium leguminosarum 1 1e-146
306841406391 phosphoserine aminotransferase [Brucella sp. BO2] Lengt 1 1e-146
254719690391 phosphoserine aminotransferase [Brucella sp. 83/13] Len 1 1e-146
>gi|170785438|gb|ACB37716.1| phosphoserine aminotransferase [Candidatus Liberibacter asiaticus] Length = 391 Back     alignment and organism information
 Score =  796 bits (2057), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 390/391 (99%), Positives = 391/391 (100%)

Query: 1   MLDMRKPTRKPKRPFFSSGPCAKRPGWSLGILEGALLGRSHRCVLGKERINKAIQLTRKV 60
           MLDMRKPTRKPKRPFFSSGPCAKRPGWSLGILEGALLGRSHRCVLGKERINKAIQLTRKV
Sbjct: 1   MLDMRKPTRKPKRPFFSSGPCAKRPGWSLGILEGALLGRSHRCVLGKERINKAIQLTRKV 60

Query: 61  LEVPENYRIAIVPASDTGAVEMALWSLLGYRGVDVLAWESFGLGWMSDIRQLSLQDVREF 120
           LEVPENYRIA+VPASDTGAVEMALWSLLGYRGVDVLAWESFGLGWMSDIRQLSLQDVREF
Sbjct: 61  LEVPENYRIAVVPASDTGAVEMALWSLLGYRGVDVLAWESFGLGWMSDIRQLSLQDVREF 120

Query: 121 TAPYGSLPDFSKVDFDRDVVFVWNGTTSGVCVPDVGFIPESREGLVICDATSAVFARHID 180
           TAPYGSLPDFSKVDFDRDVVFVWNGTTSGVCVPDVGFIPESREGLVICDATSAVFARHID
Sbjct: 121 TAPYGSLPDFSKVDFDRDVVFVWNGTTSGVCVPDVGFIPESREGLVICDATSAVFARHID 180

Query: 181 FNKLDVVTFSAQKVLGGEAGFGIIILSPASVERLEKYVPSWPLPKIFRMVKGGRVMEGLF 240
           FNKLDVVTFSAQKVLGGEAGFGIIILSPASVERLEKYVPSWPLPKIFRMVKGGRVMEGLF
Sbjct: 181 FNKLDVVTFSAQKVLGGEAGFGIIILSPASVERLEKYVPSWPLPKIFRMVKGGRVMEGLF 240

Query: 241 CGETINTPSLLCIEDYIDALLWLKKMGGLSACVERCNANAAVLFQFIQENDWIENLAVDE 300
           CGETINTPSLLCIEDYIDALLWLKKMGGLSACVERCNANAAVLFQFIQENDWIENLAVDE
Sbjct: 241 CGETINTPSLLCIEDYIDALLWLKKMGGLSACVERCNANAAVLFQFIQENDWIENLAVDE 300

Query: 301 TTRSNTSICMKIVDSDIASLDINSQKSFCKSMLSFLEKEEIAYDIGSYRDAPLGLRVWVG 360
           TTRSNTSICMKIVDSDIASLDINSQKSFCKSMLSFLEKEEIAYDIGSYRDAPLGLRVWVG
Sbjct: 301 TTRSNTSICMKIVDSDIASLDINSQKSFCKSMLSFLEKEEIAYDIGSYRDAPLGLRVWVG 360

Query: 361 VTVEKEDLLLLCDWLRWVFYFQKISFLRAIS 391
           VTVEKEDLLLLCDWLRWVFYFQKISFLRAIS
Sbjct: 361 VTVEKEDLLLLCDWLRWVFYFQKISFLRAIS 391


Species: Candidatus Liberibacter asiaticus
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|315122755|ref|YP_004063244.1| phosphoserine aminotransferase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 391 Back     alignment and organism information
>gi|15966484|ref|NP_386837.1| phosphoserine aminotransferase [Sinorhizobium meliloti 1021] Length = 392 Back     alignment and organism information
>gi|150397817|ref|YP_001328284.1| phosphoserine aminotransferase [Sinorhizobium medicae WSM419] Length = 392 Back     alignment and organism information
>gi|241206176|ref|YP_002977272.1| phosphoserine aminotransferase [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 392 Back     alignment and organism information
>gi|190893268|ref|YP_001979810.1| phosphoserine aminotransferase protein [Rhizobium etli CIAT 652] Length = 392 Back     alignment and organism information
>gi|327193459|gb|EGE60355.1| phosphoserine aminotransferase [Rhizobium etli CNPAF512] Length = 392 Back     alignment and organism information
>gi|116253701|ref|YP_769539.1| phosphoserine aminotransferase [Rhizobium leguminosarum bv. viciae 3841] Length = 392 Back     alignment and organism information
>gi|306841406|ref|ZP_07474108.1| phosphoserine aminotransferase [Brucella sp. BO2] Length = 391 Back     alignment and organism information
>gi|254719690|ref|ZP_05181501.1| phosphoserine aminotransferase [Brucella sp. 83/13] Length = 391 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target391 phosphoserine aminotransferase [Candidatus Liberibacter
PRK03080378 PRK03080, PRK03080, phosphoserine aminotransferase; Pro 1e-173
TIGR01365374 TIGR01365, serC_2, phosphoserine aminotransferase, Meth 1e-153
COG1932365 COG1932, SerC, Phosphoserine aminotransferase [Coenzyme 1e-90
cd01494170 cd01494, AAT_I, Aspartate aminotransferase (AAT) superf 7e-20
TIGR03301355 TIGR03301, PhnW-AepZ, 2-aminoethylphosphonate aminotran 2e-07
PLN02409401 PLN02409, PLN02409, serine--glyoxylate aminotransaminas 0.001
cd00611355 cd00611, PSAT_like, Phosphoserine aminotransferase (PSA 1e-18
KOG2790370 KOG2790, KOG2790, KOG2790, Phosphoserine aminotransfera 3e-17
TIGR01364349 TIGR01364, serC_1, phosphoserine aminotransferase 8e-17
TIGR01366361 TIGR01366, serC_3, phosphoserine aminotransferase, puta 2e-16
COG0075383 COG0075, COG0075, Serine-pyruvate aminotransferase/arch 2e-14
PRK05355360 PRK05355, PRK05355, 3-phosphoserine/phosphohydroxythreo 3e-14
PLN02452365 PLN02452, PLN02452, phosphoserine transaminase 1e-09
PRK12462364 PRK12462, PRK12462, phosphoserine aminotransferase; Pro 9e-06
KOG2862385 KOG2862, KOG2862, KOG2862, Alanine-glyoxylate aminotran 2e-04
cd06451356 cd06451, AGAT_like, Alanine-glyoxylate aminotransferase 1e-09
pfam00266371 pfam00266, Aminotran_5, Aminotransferase class-V 8e-08
COG0520405 COG0520, CsdB, Selenocysteine lyase [Amino acid transpo 9e-06
>gnl|CDD|179533 PRK03080, PRK03080, phosphoserine aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|130432 TIGR01365, serC_2, phosphoserine aminotransferase, Methanosarcina type Back     alignment and domain information
>gnl|CDD|32115 COG1932, SerC, Phosphoserine aminotransferase [Coenzyme metabolism / Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|99742 cd01494, AAT_I, Aspartate aminotransferase (AAT) superfamily (fold type I) of pyridoxal phosphate (PLP)-dependent enzymes Back     alignment and domain information
>gnl|CDD|132344 TIGR03301, PhnW-AepZ, 2-aminoethylphosphonate aminotransferase Back     alignment and domain information
>gnl|CDD|178031 PLN02409, PLN02409, serine--glyoxylate aminotransaminase Back     alignment and domain information
>gnl|CDD|99736 cd00611, PSAT_like, Phosphoserine aminotransferase (PSAT) family Back     alignment and domain information
>gnl|CDD|38001 KOG2790, KOG2790, KOG2790, Phosphoserine aminotransferase [Coenzyme transport and metabolism, Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|130431 TIGR01364, serC_1, phosphoserine aminotransferase Back     alignment and domain information
>gnl|CDD|130433 TIGR01366, serC_3, phosphoserine aminotransferase, putative Back     alignment and domain information
>gnl|CDD|30424 COG0075, COG0075, Serine-pyruvate aminotransferase/archaeal aspartate aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|180036 PRK05355, PRK05355, 3-phosphoserine/phosphohydroxythreonine aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|178071 PLN02452, PLN02452, phosphoserine transaminase Back     alignment and domain information
>gnl|CDD|183540 PRK12462, PRK12462, phosphoserine aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|38073 KOG2862, KOG2862, KOG2862, Alanine-glyoxylate aminotransferase AGT1 [General function prediction only] Back     alignment and domain information
>gnl|CDD|99744 cd06451, AGAT_like, Alanine-glyoxylate aminotransferase (AGAT) family Back     alignment and domain information
>gnl|CDD|144011 pfam00266, Aminotran_5, Aminotransferase class-V Back     alignment and domain information
>gnl|CDD|30866 COG0520, CsdB, Selenocysteine lyase [Amino acid transport and metabolism] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 391 phosphoserine aminotransferase [Candidatus Liberibacter
PRK03080381 phosphoserine aminotransferase; Provisional 100.0
TIGR01364391 serC_1 phosphoserine aminotransferase; InterPro: IPR003 100.0
cd00611355 PSAT_like Phosphoserine aminotransferase (PSAT) family. 100.0
PRK05355360 phosphoserine aminotransferase; Provisional 100.0
TIGR03301355 PhnW-AepZ 2-aminoethylphosphonate aminotransferase. Thi 100.0
PRK12462364 phosphoserine aminotransferase; Provisional 100.0
COG1932365 SerC Phosphoserine aminotransferase [Coenzyme metabolis 100.0
COG0075383 Serine-pyruvate aminotransferase/archaeal aspartate ami 100.0
PRK13479368 2-aminoethylphosphonate--pyruvate transaminase; Provisi 100.0
cd06451356 AGAT_like Alanine-glyoxylate aminotransferase (AGAT) fa 100.0
KOG2862385 consensus 100.0
KOG2790370 consensus 100.0
TIGR01365379 serC_2 phosphoserine aminotransferase; InterPro: IPR006 100.0
TIGR02326366 transamin_PhnW 2-aminoethylphosphonate--pyruvate transa 100.0
TIGR01366362 serC_3 phosphoserine aminotransferase, putative; InterP 100.0
TIGR01979409 sufS cysteine desulfurases, SufS subfamily; InterPro: I 100.0
pfam00266371 Aminotran_5 Aminotransferase class-V. This domain is fo 100.0
PRK09295406 selenocysteine lyase; Validated 100.0
PRK10874401 cysteine sulfinate desulfinase; Provisional 100.0
TIGR03392398 FeS_syn_CsdA cysteine desulfurase, catalytic subunit Cs 100.0
COG0520405 csdA Selenocysteine lyase/Cysteine desulfurase [Posttra 100.0
cd06453373 SufS_like Cysteine desulfurase (SufS)-like. This family 100.0
TIGR01977384 am_tr_V_EF2568 cysteine desulfurase family protein; Int 99.97
PRK02948381 cysteine desulfurase; Provisional 99.97
TIGR03402379 FeS_nifS cysteine desulfurase NifS. Members of this pro 99.97
TIGR03403382 nifS_epsilon cysteine desulfurase, NifS family, epsilon 99.96
COG1104386 NifS Cysteine sulfinate desulfinase/cysteine desulfuras 99.92
KOG1549428 consensus 99.8
TIGR01976410 am_tr_V_VC1184 cysteine desulfurase family protein; Int 99.78
cd06454349 KBL_like KBL_like; this family belongs to the pyridoxal 99.64
PRK05958387 8-amino-7-oxononanoate synthase; Reviewed 99.6
PRK10534333 L-threonine aldolase; Provisional 99.53
cd06502338 TA_like Low-specificity threonine aldolase (TA). This f 99.53
PRK13520375 L-tyrosine decarboxylase; Provisional 99.52
PRK06225375 aspartate aminotransferase; Provisional 99.51
pfam00155351 Aminotran_1_2 Aminotransferase class I and II. 99.5
PRK06939395 2-amino-3-ketobutyrate coenzyme A ligase; Provisional 99.49
PRK07179408 hypothetical protein; Provisional 99.49
PRK04870356 histidinol-phosphate aminotransferase; Provisional 99.48
cd06450345 DOPA_deC_like DOPA decarboxylase family. This family be 99.48
PRK13393404 5-aminolevulinate synthase; Provisional 99.48
PRK00950369 histidinol-phosphate aminotransferase; Validated 99.45
TIGR00858378 bioF 8-amino-7-oxononanoate synthase; InterPro: IPR0047 99.44
PRK09064406 5-aminolevulinate synthase; Validated 99.43
PRK05937370 8-amino-7-oxononanoate synthase; Provisional 99.43
PRK07310395 consensus 99.43
PRK13392410 5-aminolevulinate synthase; Provisional 99.42
PRK02731367 histidinol-phosphate aminotransferase; Validated 99.41
PRK09105374 putative aminotransferase; Provisional 99.4
PRK06207406 aspartate aminotransferase; Provisional 99.39
PRK05387353 histidinol-phosphate aminotransferase; Provisional 99.38
PRK05764389 aspartate aminotransferase; Provisional 99.37
PRK07505405 hypothetical protein; Provisional 99.37
PRK03566365 consensus 99.37
PRK08153370 histidinol-phosphate aminotransferase; Provisional 99.36
PRK05957389 aspartate aminotransferase; Provisional 99.33
PRK01533366 histidinol-phosphate aminotransferase; Validated 99.33
PRK06507400 consensus 99.33
PRK08362389 consensus 99.32
PRK07678451 aminotransferase; Validated 99.32
PRK00011415 glyA serine hydroxymethyltransferase; Reviewed 99.32
PRK06107402 aspartate aminotransferase; Provisional 99.32
PRK06917447 hypothetical protein; Provisional 99.3
PRK03244398 argD acetylornithine aminotransferase; Provisional 99.3
PRK07212378 consensus 99.3
PRK07543400 consensus 99.29
cd00610413 OAT_like Acetyl ornithine aminotransferase family. This 99.29
PRK07481448 hypothetical protein; Provisional 99.29
PRK07482461 hypothetical protein; Provisional 99.29
PRK08361390 aspartate aminotransferase; Provisional 99.28
PRK05965459 hypothetical protein; Provisional 99.28
PRK07036466 hypothetical protein; Provisional 99.28
PRK06056402 consensus 99.28
PRK07682378 hypothetical protein; Validated 99.27
PRK08069390 consensus 99.27
PRK05166374 histidinol-phosphate aminotransferase; Provisional 99.26
PRK08593448 4-aminobutyrate aminotransferase; Provisional 99.26
PRK061481015 hypothetical protein; Provisional 99.25
pfam00464380 SHMT Serine hydroxymethyltransferase. 99.25
PRK06105460 aminotransferase; Provisional 99.25
PRK03321352 putative aminotransferase; Provisional 99.24
PRK05942394 aspartate aminotransferase; Provisional 99.24
PRK06375381 consensus 99.24
PRK07683387 aminotransferase A; Validated 99.24
PRK11522468 putrescine--2-oxoglutarate aminotransferase; Provisiona 99.23
PRK06173429 adenosylmethionine--8-amino-7-oxononanoate transaminase 99.23
PRK08068389 transaminase; Reviewed 99.23
PRK07030467 adenosylmethionine--8-amino-7-oxononanoate transaminase 99.23
PRK12381406 bifunctional succinylornithine transaminase/acetylornit 99.23
PRK06938464 diaminobutyrate--2-oxoglutarate aminotransferase; Provi 99.23
PRK06108382 aspartate aminotransferase; Provisional 99.22
PRK05794397 consensus 99.22
TIGR03540383 DapC_direct LL-diaminopimelate aminotransferase. This c 99.22
PRK07550387 hypothetical protein; Provisional 99.21
PRK02627398 acetylornithine aminotransferase; Provisional 99.21
PRK07908346 hypothetical protein; Provisional 99.21
PRK06575399 consensus 99.21
PRK04152364 consensus 99.2
PRK05964421 adenosylmethionine--8-amino-7-oxononanoate transaminase 99.2
PRK08117429 4-aminobutyrate aminotransferase; Provisional 99.2
PRK08360443 4-aminobutyrate aminotransferase; Provisional 99.2
PRK06348383 aspartate aminotransferase; Provisional 99.19
PRK06916462 adenosylmethionine--8-amino-7-oxononanoate transaminase 99.19
PRK09044418 consensus 99.19
PRK06943452 adenosylmethionine--8-amino-7-oxononanoate transaminase 99.19
PRK02610369 histidinol-phosphate aminotransferase; Provisional 99.18
PRK09148406 aminotransferase; Validated 99.18
COG0079356 HisC Histidinol-phosphate/aromatic aminotransferase and 99.18
PRK08443388 consensus 99.17
PRK03158359 histidinol-phosphate aminotransferase; Provisional 99.17
PRK06082460 4-aminobutyrate aminotransferase; Provisional 99.17
PRK07367385 consensus 99.17
PRK06290411 aspartate aminotransferase; Provisional 99.17
PRK07046452 aminotransferase; Validated 99.16
PRK08912387 hypothetical protein; Provisional 99.16
PRK07483443 hypothetical protein; Provisional 99.16
PRK06541460 hypothetical protein; Provisional 99.16
PRK04612408 argD bifunctional N-succinyldiaminopimelate-aminotransf 99.15
PRK09276385 aspartate aminotransferase; Provisional 99.15
PRK07986428 adenosylmethionine--8-amino-7-oxononanoate transaminase 99.15
PRK08466430 consensus 99.15
PRK06149972 hypothetical protein; Provisional 99.14
PRK07568396 aspartate aminotransferase; Provisional 99.14
PRK06062434 hypothetical protein; Provisional 99.14
PTZ00125415 ornithine aminotransferase; Provisional 99.13
PRK07777386 aminotransferase; Validated 99.13
PRK05093403 argD bifunctional N-succinyldiaminopimelate-aminotransf 99.12
COG0156388 BioF 7-keto-8-aminopelargonate synthetase and related e 99.12
PRK12403460 putative aminotransferase; Provisional 99.12
cd00378402 SHMT Serine-glycine hydroxymethyltransferase (SHMT). Th 99.12
PRK03967337 histidinol-phosphate aminotransferase; Provisional 99.12
COG2008342 GLY1 Threonine aldolase [Amino acid transport and metab 99.11
PRK08088426 4-aminobutyrate aminotransferase; Validated 99.1
PRK07309390 aromatic amino acid aminotransferase; Validated 99.1
PRK06918454 4-aminobutyrate aminotransferase; Reviewed 99.1
PRK05630423 adenosylmethionine--8-amino-7-oxononanoate transaminase 99.09
PRK13360441 omega amino acid--pyruvate transaminase; Provisional 99.09
PRK07337388 aminotransferase; Validated 99.09
TIGR01821427 5aminolev_synth 5-aminolevulinic acid synthase; InterPr 99.09
PRK07681399 aspartate aminotransferase; Provisional 99.09
PRK07894430 consensus 99.09
PRK04260375 acetylornithine aminotransferase; Provisional 99.09
PRK07392358 threonine-phosphate decarboxylase; Validated 99.08
PRK09792421 PLP-dependent GABA aminotransferase; Provisional 99.08
PRK07495422 4-aminobutyrate aminotransferase; Provisional 99.08
PRK06220384 consensus 99.08
PRK07480459 putative aminotransferase; Validated 99.08
PRK06209431 glutamate-1-semialdehyde 2,1-aminomutase; Provisional 99.07
PRK09264426 diaminobutyrate--2-oxoglutarate aminotransferase; Valid 99.07
PRK02936377 argD acetylornithine aminotransferase; Provisional 99.06
PRK07366388 succinyldiaminopimelate transaminase; Validated 99.06
TIGR03246397 arg_catab_astC succinylornithine transaminase family. M 99.06
PRK06358354 threonine-phosphate decarboxylase; Provisional 99.05
PRK00854404 rocD ornithine--oxo-acid transaminase; Reviewed 99.05
PRK06777421 4-aminobutyrate aminotransferase; Provisional 99.04
PRK08636403 aspartate aminotransferase; Provisional 99.04
COG0436393 Aspartate/tyrosine/aromatic aminotransferase [Amino aci 99.04
TIGR02006404 IscS cysteine desulfurase IscS; InterPro: IPR010240 Thi 99.03
PRK07323443 consensus 99.03
PRK08363398 alanine aminotransferase; Validated 99.01
PRK06931454 diaminobutyrate--2-oxoglutarate aminotransferase; Provi 99.0
TIGR03372442 putres_am_tran putrescine aminotransferase. Members of 99.0
PRK06836396 aspartate aminotransferase; Provisional 98.99
TIGR03537350 DapC succinyldiaminopimelate transaminase. Note: the de 98.99
COG0160447 GabT 4-aminobutyrate aminotransferase and related amino 98.99
PRK03715395 argD bifunctional N-succinyldiaminopimelate-aminotransf 98.99
PRK00062429 glutamate-1-semialdehyde aminotransferase; Provisional 98.98
COG4992404 ArgD Ornithine/acetylornithine aminotransferase [Amino 98.97
PRK05639457 4-aminobutyrate aminotransferase; Provisional 98.97
PRK00615433 glutamate-1-semialdehyde aminotransferase; Provisional 98.97
cd00613398 GDC-P Glycine cleavage system P-protein, alpha- and bet 98.96
PRK05769442 4-aminobutyrate aminotransferase; Provisional 98.96
PRK09082386 putative aminotransferase; Validated 98.96
PRK08742472 adenosylmethionine--8-amino-7-oxononanoate transaminase 98.95
PRK08175395 aminotransferase; Validated 98.94
PRK12389429 glutamate-1-semialdehyde aminotransferase; Provisional 98.94
PRK06942425 glutamate-1-semialdehyde 2,1-aminomutase; Validated 98.91
PRK08960387 hypothetical protein; Provisional 98.9
PRK08056356 threonine-phosphate decarboxylase; Provisional 98.89
PRK01278389 argD bifunctional N-succinyldiaminopimelate-aminotransf 98.89
TIGR01141377 hisC histidinol-phosphate aminotransferase; InterPro: I 98.88
PRK04073396 rocD ornithine--oxo-acid transaminase; Provisional 98.88
PRK08555443 consensus 98.85
PRK07778386 consensus 98.8
TIGR01825392 gly_Cac_T_rel pyridoxal phosphate-dependent acyltransfe 98.79
PRK08354312 putative aminotransferase; Provisional 98.74
PRK09265404 aminotransferase AlaT; Validated 98.74
TIGR01885426 Orn_aminotrans ornithine--oxo-acid transaminase; InterP 98.74
TIGR01822395 2am3keto_CoA 2-amino-3-ketobutyrate coenzyme A ligase; 98.69
TIGR03539357 DapC_actino succinyldiaminopimelate transaminase. This 98.68
KOG1404442 consensus 98.63
PRK12414384 putative aminotransferase; Provisional 98.6
TIGR03538394 DapC_gpp succinyldiaminopimelate transaminase. This fam 98.58
KOG0257420 consensus 98.56
COG0161449 BioA Adenosylmethionine-8-amino-7-oxononanoate aminotra 98.51
PRK09147397 aminotransferase; Provisional 98.5
KOG1402427 consensus 98.45
KOG1360570 consensus 98.43
KOG1359417 consensus 98.42
TIGR03542402 DAPAT_plant LL-diaminopimelate aminotransferase. This c 98.42
COG1167459 ARO8 Transcriptional regulators containing a DNA-bindin 98.39
TIGR01437391 selA_rel pyridoxal phosphate-dependent enzyme, putative 98.35
PRK09440416 avtA valine--pyruvate transaminase; Provisional 98.33
KOG1401433 consensus 98.29
PRK04013364 argD acetylornithine/acetyl-lysine aminotransferase; Pr 98.24
KOG1357519 consensus 98.23
PRK09257397 aromatic amino acid aminotransferase; Provisional 98.22
PRK07590409 L,L-diaminopimelate aminotransferase; Validated 98.22
KOG1368384 consensus 98.21
TIGR00707402 argD acetylornithine and succinylornithine aminotransfe 98.21
PRK07865364 N-succinyldiaminopimelate aminotransferase; Reviewed 98.17
PRK05839376 hypothetical protein; Provisional 98.0
COG1168388 MalY Bifunctional PLP-dependent enzyme with beta-cystat 97.84
KOG0629510 consensus 95.81
TIGR03235354 DNA_S_dndA cysteine desulfurase DndA. This model descri 99.92
cd00609350 AAT_like Aspartate aminotransferase family. This family 99.21
PRK03262355 consensus 99.06
PRK01688355 histidinol-phosphate aminotransferase; Provisional 99.03
PRK02769380 histidine decarboxylase; Provisional 99.0
cd00616352 AHBA_syn 3-amino-5-hydroxybenzoic acid synthase family 98.99
pfam02347429 GDC-P Glycine cleavage system P-protein. This family co 98.25
TIGR00474448 selA L-seryl-tRNA selenium transferase; InterPro: IPR00 96.63
TIGR03576346 pyridox_MJ0158 pyridoxal phosphate enzyme, MJ0158 famil 92.06
cd01494170 AAT_I Aspartate aminotransferase (AAT) superfamily (fol 99.74
PRK04311465 selenocysteine synthase; Provisional 97.52
pfam05889389 SLA_LP_auto_ag Soluble liver antigen/liver pancreas ant 94.74
TIGR03531444 selenium_SpcS O-phosphoseryl-tRNA(Sec) selenium transfe 90.01
cd06452361 SepCysS Sep-tRNA:Cys-tRNA synthase. This family belongs 99.48
PRK08249398 cystathionine gamma-synthase; Provisional 99.42
PRK09331386 Sep-tRNA:Cys-tRNA synthetase; Provisional 99.42
PRK08776405 cystathionine gamma-synthase; Provisional 99.42
PRK09028394 cystathionine beta-lyase; Provisional 99.41
PRK07503403 methionine gamma-lyase; Provisional 99.4
PRK08045386 cystathionine gamma-synthase; Provisional 99.38
PRK05968389 hypothetical protein; Provisional 99.37
PRK07049427 methionine gamma-lyase; Validated 99.35
PRK08114395 cystathionine beta-lyase; Provisional 99.34
PRK05967392 cystathionine beta-lyase; Provisional 99.33
PRK06234399 methionine gamma-lyase; Provisional 99.32
PRK08064390 cystathionine beta-lyase; Provisional 99.32
PRK07811386 cystathionine gamma-synthase; Provisional 99.31
PRK08861388 cystathionine gamma-synthase; Provisional 99.3
PRK07504397 O-succinylhomoserine sulfhydrylase; Reviewed 99.29
PTZ00094450 serine hydroxymethyltransferase; Provisional 99.27
PRK08247366 cystathionine gamma-synthase; Reviewed 99.26
PRK06460375 hypothetical protein; Provisional 99.25
PRK07582370 cystathionine gamma-lyase; Validated 99.24
PRK03317369 histidinol-phosphate aminotransferase; Provisional 99.24
PRK07050394 cystathionine beta-lyase; Provisional 99.24
PRK06176379 cystathionine gamma-synthase/cystathionine beta-lyase; 99.21
PRK08574384 cystathionine gamma-synthase; Provisional 99.21
PRK13034422 serine hydroxymethyltransferase; Reviewed 99.2
PRK08134433 O-acetylhomoserine aminocarboxypropyltransferase; Valid 99.19
PRK07812436 O-acetylhomoserine aminocarboxypropyltransferase; Valid 99.19
PRK11658379 UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotran 99.18
PRK06702432 O-acetylhomoserine aminocarboxypropyltransferase; Valid 99.18
PRK07810406 O-succinylhomoserine sulfhydrylase; Provisional 99.17
PRK06767386 methionine gamma-lyase; Provisional 99.17
pfam01053381 Cys_Met_Meta_PP Cys/Met metabolism PLP-dependent enzyme 99.16
COG3844407 Kynureninase [Amino acid transport and metabolism] 99.15
PRK00451449 glycine dehydrogenase subunit 1; Validated 99.15
PRK08248431 O-acetylhomoserine aminocarboxypropyltransferase; Valid 99.14
PRK08133391 O-succinylhomoserine sulfhydrylase; Validated 99.13
PRK05994426 O-acetylhomoserine aminocarboxypropyltransferase; Valid 99.12
cd00614369 CGS_like CGS_like: Cystathionine gamma-synthase is a PL 99.12
PRK04635346 histidinol-phosphate aminotransferase; Provisional 99.12
PRK07324373 transaminase; Validated 99.11
PRK07671377 cystathionine beta-lyase; Provisional 99.11
COG0399374 WecE Predicted pyridoxal phosphate-dependent enzyme app 99.1
TIGR03588380 PseC UDP-4-keto-6-deoxy-N-acetylglucosamine 4-aminotran 99.09
PRK05613437 O-acetylhomoserine aminocarboxypropyltransferase; Valid 99.09
PRK06084424 O-acetylhomoserine aminocarboxypropyltransferase; Valid 99.07
PRK04781362 histidinol-phosphate aminotransferase; Provisional 99.04
pfam01041363 DegT_DnrJ_EryC1 DegT/DnrJ/EryC1/StrS aminotransferase f 99.03
PRK05939396 hypothetical protein; Provisional 99.03
TIGR02539381 SepCysS Sep-tRNA:Cys-tRNA synthase; InterPro: IPR013375 99.01
COG0112413 GlyA Glycine/serine hydroxymethyltransferase [Amino aci 99.01
PRK06434384 cystathionine gamma-lyase; Validated 99.0
PRK06058446 4-aminobutyrate aminotransferase; Provisional 98.96
PRK07269364 cystathionine gamma-synthase; Reviewed 98.96
PRK11706375 TDP-4-oxo-6-deoxy-D-glucose transaminase; Provisional 98.95
PRK06959339 putative threonine-phosphate decarboxylase; Provisional 98.95
COG0626396 MetC Cystathionine beta-lyases/cystathionine gamma-synt 98.91
PRK13580493 serine hydroxymethyltransferase; Provisional 98.89
PRK05664330 threonine-phosphate decarboxylase; Reviewed 98.89
PRK06425332 histidinol-phosphate aminotransferase; Validated 98.88
COG1103382 Archaea-specific pyridoxal phosphate-dependent enzymes 98.88
PRK08297449 L-lysine aminotransferase; Provisional 98.82
COG2873426 MET17 O-acetylhomoserine sulfhydrylase [Amino acid tran 98.6
TIGR03251431 LAT_fam L-lysine 6-transaminase. Characterized members 98.57
PRK08637386 hypothetical protein; Provisional 98.56
TIGR02407413 ectoine_ectB diaminobutyrate--2-oxoglutarate aminotrans 98.42
KOG2467477 consensus 98.37
COG0001432 HemL Glutamate-1-semialdehyde aminotransferase [Coenzym 98.35
COG1982 557 LdcC Arginine/lysine/ornithine decarboxylases [Amino ac 98.29
KOG3846465 consensus 98.12
COG0403450 GcvP Glycine cleavage system protein P (pyridoxal-bindi 98.03
COG1448396 TyrB Aspartate/tyrosine/aromatic aminotransferase [Amin 97.94
PRK13578 720 ornithine decarboxylase; Provisional 97.78
TIGR01814444 kynureninase kynureninase; InterPro: IPR010111 This ent 97.63
TIGR01265424 tyr_nico_aTase tyrosine/nicotianamine aminotransferases 97.45
PRK04366490 glycine dehydrogenase subunit 2; Validated 97.44
PRK13355518 bifunctional HTH-domain containing protein/aminotransfe 97.3
PRK12566 954 glycine dehydrogenase; Provisional 97.03
PRK05367 955 glycine dehydrogenase; Provisional 96.88
KOG0256471 consensus 96.86
TIGR00709445 dat 2,4-diaminobutyrate 4-transaminase; InterPro: IPR00 95.84
KOG1358467 consensus 95.41
KOG0259447 consensus 94.82
TIGR01324389 cysta_beta_ly_B cystathionine beta-lyase; InterPro: IPR 94.55
KOG2040 1001 consensus 93.96
TIGR02080383 O_succ_thio_ly O-succinylhomoserine (thiol)-lyase; Inte 92.87
KOG1383491 consensus 90.65
KOG1411427 consensus 90.12
COG0076460 GadB Glutamate decarboxylase and related PLP-dependent 99.24
pfam01212288 Beta_elim_lyase Beta-eliminating lyase. 99.17
pfam00282370 Pyridoxal_deC Pyridoxal-dependent decarboxylase conserv 98.97
PRK06855433 aminotransferase; Validated 98.31
TIGR01329415 cysta_beta_ly_E cystathionine beta-lyase; InterPro: IPR 98.25
pfam00202338 Aminotran_3 Aminotransferase class-III. 98.19
pfam06838405 Alum_res Aluminium resistance protein. This family repr 92.5
PRK09221445 beta alanine--pyruvate transaminase; Provisional 99.02
TIGR00713434 hemL glutamate-1-semialdehyde-2,1-aminomutase; InterPro 96.75
pfam01276417 OKR_DC_1 Orn/Lys/Arg decarboxylase, major domain. 98.84
cd00615294 Orn_deC_like Ornithine decarboxylase family. This famil 98.7
TIGR01326434 OAH_OAS_sulfhy O-acetylhomoserine aminocarboxypropyltra 98.65
KOG0053409 consensus 98.46
TIGR01328392 met_gam_lyase methionine gamma-lyase; InterPro: IPR0062 98.06
pfam03841367 SelA L-seryl-tRNA selenium transferase. 98.07
COG1921395 SelA Selenocysteine synthase [seryl-tRNASer selenium tr 98.06
TIGR01325386 O_suc_HS_sulf O-succinylhomoserine sulfhydrylase; Inter 97.4
>PRK03080 phosphoserine aminotransferase; Provisional Back     alignment and domain information
>TIGR01364 serC_1 phosphoserine aminotransferase; InterPro: IPR003248 Phosphoserine aminotransferases (2 Back     alignment and domain information
>cd00611 PSAT_like Phosphoserine aminotransferase (PSAT) family Back     alignment and domain information
>PRK05355 phosphoserine aminotransferase; Provisional Back     alignment and domain information
>TIGR03301 PhnW-AepZ 2-aminoethylphosphonate aminotransferase Back     alignment and domain information
>PRK12462 phosphoserine aminotransferase; Provisional Back     alignment and domain information
>COG1932 SerC Phosphoserine aminotransferase [Coenzyme metabolism / Amino acid transport and metabolism] Back     alignment and domain information
>COG0075 Serine-pyruvate aminotransferase/archaeal aspartate aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK13479 2-aminoethylphosphonate--pyruvate transaminase; Provisional Back     alignment and domain information
>cd06451 AGAT_like Alanine-glyoxylate aminotransferase (AGAT) family Back     alignment and domain information
>KOG2862 consensus Back     alignment and domain information
>KOG2790 consensus Back     alignment and domain information
>TIGR01365 serC_2 phosphoserine aminotransferase; InterPro: IPR006271 These sequences represent a variant form of the serine biosynthesis enzyme phosphoserine aminotransferase, as found in a small number of distantly related species, including Caulobacter crescentus, Mesorhizobium loti, and the archaeon Methanosarcina barkeri Back     alignment and domain information
>TIGR02326 transamin_PhnW 2-aminoethylphosphonate--pyruvate transaminase; InterPro: IPR012703 Phosphonates are a class of organophosphorus compounds, characterised by a stable C-P bond, which are found in a variety of biologically produced molecules including antiobiotics, lipids, proteins and polysaccharides Back     alignment and domain information
>TIGR01366 serC_3 phosphoserine aminotransferase, putative; InterPro: IPR006272 These sequences represent a putative variant form of the serine biosynthesis enzyme phosphoserine aminotransferase, as found in Mycobacterium tuberculosis and related high-GC Gram-positive bacteria Back     alignment and domain information
>TIGR01979 sufS cysteine desulfurases, SufS subfamily; InterPro: IPR010970 Cysteine desulphurases are pyridoxal-phosphate enzymes which catalyse the removal of sulphur from L-cysteine to form L-alanine and elemental sulphur Back     alignment and domain information
>pfam00266 Aminotran_5 Aminotransferase class-V Back     alignment and domain information
>PRK09295 selenocysteine lyase; Validated Back     alignment and domain information
>PRK10874 cysteine sulfinate desulfinase; Provisional Back     alignment and domain information
>TIGR03392 FeS_syn_CsdA cysteine desulfurase, catalytic subunit CsdA Back     alignment and domain information
>COG0520 csdA Selenocysteine lyase/Cysteine desulfurase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd06453 SufS_like Cysteine desulfurase (SufS)-like Back     alignment and domain information
>TIGR01977 am_tr_V_EF2568 cysteine desulfurase family protein; InterPro: IPR010969 This entry describes a subfamily of probable pyridoxal phosphate-dependent enzymes in the aminotransferase class V family Back     alignment and domain information
>PRK02948 cysteine desulfurase; Provisional Back     alignment and domain information
>TIGR03402 FeS_nifS cysteine desulfurase NifS Back     alignment and domain information
>TIGR03403 nifS_epsilon cysteine desulfurase, NifS family, epsilon proteobacteria type Back     alignment and domain information
>COG1104 NifS Cysteine sulfinate desulfinase/cysteine desulfurase and related enzymes [Amino acid transport and metabolism] Back     alignment and domain information
>KOG1549 consensus Back     alignment and domain information
>TIGR01976 am_tr_V_VC1184 cysteine desulfurase family protein; InterPro: IPR011340 This entry describes probable pyridoxal phosphate-dependent enzymes in the aminotransferase class V family Back     alignment and domain information
>cd06454 KBL_like KBL_like; this family belongs to the pyridoxal phosphate (PLP)-dependent aspartate aminotransferase superfamily (fold I) Back     alignment and domain information
>PRK05958 8-amino-7-oxononanoate synthase; Reviewed Back     alignment and domain information
>PRK10534 L-threonine aldolase; Provisional Back     alignment and domain information
>cd06502 TA_like Low-specificity threonine aldolase (TA) Back     alignment and domain information
>PRK13520 L-tyrosine decarboxylase; Provisional Back     alignment and domain information
>PRK06225 aspartate aminotransferase; Provisional Back     alignment and domain information
>pfam00155 Aminotran_1_2 Aminotransferase class I and II Back     alignment and domain information
>PRK06939 2-amino-3-ketobutyrate coenzyme A ligase; Provisional Back     alignment and domain information
>PRK07179 hypothetical protein; Provisional Back     alignment and domain information
>PRK04870 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>cd06450 DOPA_deC_like DOPA decarboxylase family Back     alignment and domain information
>PRK13393 5-aminolevulinate synthase; Provisional Back     alignment and domain information
>PRK00950 histidinol-phosphate aminotransferase; Validated Back     alignment and domain information
>TIGR00858 bioF 8-amino-7-oxononanoate synthase; InterPro: IPR004723 8-amino-7-oxononanoate synthase (2 Back     alignment and domain information
>PRK09064 5-aminolevulinate synthase; Validated Back     alignment and domain information
>PRK05937 8-amino-7-oxononanoate synthase; Provisional Back     alignment and domain information
>PRK07310 consensus Back     alignment and domain information
>PRK13392 5-aminolevulinate synthase; Provisional Back     alignment and domain information
>PRK02731 histidinol-phosphate aminotransferase; Validated Back     alignment and domain information
>PRK09105 putative aminotransferase; Provisional Back     alignment and domain information
>PRK06207 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK05387 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK05764 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK07505 hypothetical protein; Provisional Back     alignment and domain information
>PRK03566 consensus Back     alignment and domain information
>PRK08153 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK05957 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK01533 histidinol-phosphate aminotransferase; Validated Back     alignment and domain information
>PRK06507 consensus Back     alignment and domain information
>PRK08362 consensus Back     alignment and domain information
>PRK07678 aminotransferase; Validated Back     alignment and domain information
>PRK00011 glyA serine hydroxymethyltransferase; Reviewed Back     alignment and domain information
>PRK06107 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK06917 hypothetical protein; Provisional Back     alignment and domain information
>PRK03244 argD acetylornithine aminotransferase; Provisional Back     alignment and domain information
>PRK07212 consensus Back     alignment and domain information
>PRK07543 consensus Back     alignment and domain information
>cd00610 OAT_like Acetyl ornithine aminotransferase family Back     alignment and domain information
>PRK07481 hypothetical protein; Provisional Back     alignment and domain information
>PRK07482 hypothetical protein; Provisional Back     alignment and domain information