254780193

254780193

lipid A ABC exporter family, fused ATPase and inner membrane subunits

GeneID in NCBI database:8209173Locus tag:CLIBASIA_00390
Protein GI in NCBI database:254780193Protein Accession:YP_003064606.1
Gene range:-(81849, 83435)Protein Length:528aa
Gene description:lipid A ABC exporter family, fused ATPase and inner membrane subunits
COG prediction:[V] ABC-type multidrug transport system, ATPase and permease components
KEGG prediction:lipid A ABC exporter family, fused ATPase and inner membrane subunits; K06147 ATP-binding cassette, subfamily B, bacterial
SEED prediction:hypothetical protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM5 TM-Helix
TOPPRED6 TM-Helix
HMMTOP6 TM-Helix
MEMSAT5 TM-Helix
MEMSAT_SVM5 TM-Helix
PHOBIUS5 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------53
MTSVFLDKRDVSLYLWGMFVLLLLAVASSLRYYCATMLGERMILFMQRDVIAKIIKLSPSFFNSRGHGEIFSILVKDTERIKAIIGIGMSIVLRSLLMGFGAMCMMFVISIKLSLIVVSIVTLFLMVMIKFSRKKTNTLYADEKKLLNIFSDMIKSVMVLQSFNAGKEAIRLYDIQSQKTYKGFLRSALIRTCIACFVIFFVSCGIFIVFLIGAHYVATAEMPRGKLAEFVVYAFIFFASIRSCLGFIGGISQAIASLRRLRELIVCKLDISSPISSRTFPSPVLGSVSFRSVSFVYPGKSKRSILKNVNFTVQPGETIALVGDSGAGKTSIFSLILRFYDPCSGSVEIEGIDLRLLSLEEIRRFIAWVPQHPIMIAASVYDNIAIGCPHATRKEIQNAAMLAQAHEFIGCLENGYDTILGDGAVHLSTGQIQRIAIARAILKDSPILLLDEMGSALDIENEQKIWKVLREQRRGRTTIFASHRLSAIQDADMVFVLHDQVIVEKGVHEELLKKSGFYAHYHILGMSQ
ccEEEEccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccEEEEEEEEEcccccccEEEEcccEEEccccEEEEEccccccHHHHHHHHHccccccccEEEEccEEcccccHHHHcccEEEEccccccccccHHHHHHHHHHHcccccccHHHHHHHHHHHcccccccHHHHccccHHHccHHHHHHHHHHHHHHccccEEEEEcccccccHHHHHHHHHHHHHHHcccEEEEEEccHHHHHHccEEEEEEccEEEEEccHHHHHHcccHHHHHHHccccc
cccccHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccEEEEEEEEccccccccccEEEEEEEEccccEEEEEccccccHHHHHHHHcccccccEEEEEEccEEHHHEcHHHHHHHEEEEcccccccccEHHHHHHccccccccHHHHHHHHHHccHHHHHccccHHHcEcccccccccHHHHHHHHHHHHHcccccEEEEEcccccccHHHHHHHHHHHHcHHccccEEEEEEEHEHEccccEEEEEEccEEEEEccHHHHHHcccHHHHHHHHHHcc
mtsvfldkrdvSLYLWGMFVLLLLAVASSLRYYCATMLGERMILFMQRDVIAKIIKlspsffnsrghgEIFSILVKDTERIKAIIGIGMSIVLRSLLMGFGAMCMMFVISIKLSLIVVSIVTLFLMVMIKFSRKKTNTLYADEKKLLNIFSDMIKSVMVLQSFNAGKEAIRLYDIQSQKTYKGFLRSALIRTCIACFVIFFVSCGIFIVFLIGAHyvataemprgklAEFVVYAFIFFASIRSCLGFIGGISQAIASLRRLRELIVCKldisspissrtfpspvlgsvsfrsvsfvypgkskrsilknvnftvqpgetialvgdsgagktSIFSLILRfydpcsgsveiegIDLRLLSLEEIRRFIAWVPQHPIMIAASVYdniaigcphATRKEIQNAAMLAQAHEFIGClengydtilgdgavhlsTGQIQRIAIARAILKDSPILLLDEMGSALDIENEQKIWKVLREQRRGRTTIFASHRLSAIQDADMVFVLHDQVIVEKGVHEELLKKSGFYAHYHILGMSQ
mtsvfldkrdvsLYLWGMFVLLLLAVASSLRYYCATMLGERMILFMQRDVIAKIIKLspsffnsrghGEIFSILVKDTERIKAIIGIGMSIVLRSLLMGFGAMCMMFVISIKLSLIVVSIVTLFLMVMIKFsrkktntlyADEKKLLNIFSDMIKSVMVLQSFNAGKEAIRLYDIQSQKTYKGFLRSALIRTCIACFVIFFVSCGIFIVFLIGAHYVATAEMPRGKLAEFVVYAFIFFASIRSCLGFIGGISQAIASLRRLRELIVCKLdisspissrtfpspvlgsvSFRSVSFVYPGKSKRSILKNVNFTVQPGEtialvgdsgaGKTSIFSLILRFYDPCSGSVEIEGIDLRLLSLEEIRRFIAWVPQHPIMIAASVYDNIAIGCPHATRKEIQNAAMLAQAHEFIGCLENGYDTILGDGAVHLSTGQIQRIAIARAILKDSPILLLDEMGSALDIENEQKIWKVLREQRRGRTTIFASHRLSAIQDADMVFVLHDQVIVEKGVHEELLKKSGFYAHYHILGMSQ
MTSVFLDKRDVSLYLWGMFvllllavasslRYYCATMLGERMILFMQRDVIAKIIKLSPSFFNSRGHGEIFSILVKDTERIKAIIGIGMSIVLRSLLMGFGAMCMMFvisiklslivvsivtlflMVMIKFSRKKTNTLYADEKKLLNIFSDMIKSVMVLQSFNAGKEAIRLYDIQSQKTYKGFLRSALIRTCIACFVIFFVSCGIFIVFLIGAHYVATAEMPRGKLAEFVVYAFIFFASIRSCLGFIGGISQAIASLRRLRELIVCKLDISSPISSRTFPSPVLGSVSFRSVSFVYPGKSKRSILKNVNFTVQPGETIALVGDSGAGKTSIFSLILRFYDPCSGSVEIEGIDLRLLSLEEIRRFIAWVPQHPIMIAASVYDNIAIGCPHATRKEIQNAAMLAQAHEFIGCLENGYDTILGDGAVHLSTGqiqriaiaraiLKDSPILLLDEMGSALDIENEQKIWKVLREQRRGRTTIFASHRLSAIQDADMVFVLHDQVIVEKGVHEELLKKSGFYAHYHILGMSQ
*TSVFLDKRDVSLYLWGMFVLLLLAVASSLRYYCATMLGERMILFMQRDVIAKIIKLSPSFFNSRGHGEIFSILVKDTERIKAIIGIGMSIVLRSLLMGFGAMCMMFVISIKLSLIVVSIVTLFLMVMIKFSRKKTNTLYADEKKLLNIFSDMIKSVMVLQSFNAGKEAIRLYDIQSQKTYKGFLRSALIRTCIACFVIFFVSCGIFIVFLIGAHYVATAEMPRGKLAEFVVYAFIFFASIRSCLGFIGGISQAIASLRRLRELIVCKLD***********SPVLGSVSFRSVSFVYPGKSKRSILKNVNFTVQPGETIALVGDSGAGKTSIFSLILRFYDPCSGSVEIEGIDLRLLSLEEIRRFIAWVPQHPIMIAASVYDNIAIGCPHATRKEIQNAAMLAQAHEFIGCLENGYDTILGDGAVHLSTGQIQRIAIARAILKDSPILLLDEMGSALDIENEQKIWKVLREQRRGRTTIFASHRLSAIQDADMVFVLHDQVIVEKGVHEELLKKSGFYAHYHILGMS*
MTSVFLDKRDVSLYLWGMFVLLLLAVASSLRYYCATMLGERMILFMQRDVIAKIIKLSPSFFNSRGHGEIFSILVKDTERIKAIIGIGMSIVLRSLLMGFGAMCMMFVISIKLSLIVVSIVTLFLMVMIKFSRKKTNTLYADEKKLLNIFSDMIKSVMVLQSFNAGKEAIRLYDIQSQKTYKGFLRSALIRTCIACFVIFFVSCGIFIVFLIGAHYVATAEMPRGKLAEFVVYAFIFFASIRSCLGFIGGISQAIASLRRLRELIVCKLDISSPISSRTFPSPVLGSVSFRSVSFVYPGKSKRSILKNVNFTVQPGETIALVGDSGAGKTSIFSLILRFYDPCSGSVEIEGIDLRLLSLEEIRRFIAWVPQHPIMIAASVYDNIAIGCPHATRKEIQNAAMLAQAHEFIGCLENGYDTILGDGAVHLSTGQIQRIAIARAILKDSPILLLDEMGSALDIENEQKIWKVLREQRRGRTTIFASHRLSAIQDADMVFVLHDQVIVEKGVHEELLKKSGFYAHYHILGMSQ
*TSVFLDKRDVSLYLWGMFVLLLLAVASSLRYYCATMLGERMILFMQRDVIAKIIKLSPSFFNSRGHGEIFSILVKDTERIKAIIGIGMSIVLRSLLMGFGAMCMMFVISIKLSLIVVSIVTLFLMVMIKFSRKKTNTLYADEKKLLNIFSDMIKSVMVLQSFNAGKEAIRLYDIQSQKTYKGFLRSALIRTCIACFVIFFVSCGIFIVFLIGAHYVATAEMPRGKLAEFVVYAFIFFASIRSCLGFIGGISQAIASLRRLRELIVCKLDISSPISSRTFPSPVLGSVSFRSVSFVYPGKSKRSILKNVNFTVQPGETIALVGDSGAGKTSIFSLILRFYDPCSGSVEIEGIDLRLLSLEEIRRFIAWVPQHPIMIAASVYDNIAIGCPHATRKEIQNAAMLAQAHEFIGCLENGYDTILGDGAVHLSTGQIQRIAIARAILKDSPILLLDEMGSALDIENEQKIWKVLREQRRGRTTIFASHRLSAIQDADMVFVLHDQVIVEKGVHEELLKKSGFYAHYHILGMS*
ooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHoooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTSVFLDKRDVSLYLWGMFVLLLLAVASSLRYYCATMLGERMILFMQRDVIAKIIKLSPSFFNSRGHGEIFSILVKDTERIKAIIGIGMSIVLRSLLMGFGAMCMMFVISIKLSLIVVSIVTLFLMVMIKFSRKKTNTLYADEKKLLNIFSDMIKSVMVLQSFNAGKEAIRLYDIQSQKTYKGFLRSALIRTCIACFVIFFVSCGIFIVFLIGAHYVATAEMPRGKLAEFVVYAFIFFASIRSCLGFIGGISQAIASLRRLRELIVCKLDISSPISSRTFPSPVLGSVSFRSVSFVYPGKSKRSILKNVNFTVQPGETIALVGDSGAGKTSIFSLILRFYDPCSGSVEIEGIDLRLLSLEEIRRFIAWVPQHPIMIAASVYDNIAIGCPHATRKEIQNAAMLAQAHEFIGCLENGYDTILGDGAVHLSTGQIQRIAIARAILKDSPILLLDEMGSALDIENEQKIWKVLREQRRGRTTIFASHRLSAIQDADMVFVLHDQVIVEKGVHEELLKKSGFYAHYHILGMSQ
MTSVFLDKRDVSLYLWGMFVLLLLAVASSLRYYCATMLGERMILFMQRDVIAKIIKLSPSFFNSRGHGEIFSILVKDTERIKAIIGIGMSIVLRSLLMGFGAMCMMFVISIKLSLIVVSIVTLFLMVMIKFSRKKTNTLYADEKKLLNIFSDMIKSVMVLQSFNAGKEAIRLYDIQSQKTYKGFLRSALIRTCIACFVIFFVSCGIFIVFLIGAHYVATAEMPRGKLAEFVVYAFIFFASIRSCLGFIGGISQAIASLRRLRELIVCKLDISSPISSRTFPSPVLGSVSFRSVSFVYPGKSKRSILKNVNFTVQPGETIALVGDSGAGKTSIFSLILRFYDPCSGSVEIEGIDLRLLSLEEIRRFIAWVPQHPIMIAASVYDNIAIGCPHATRKEIQNAAMLAQAHEFIGCLENGYDTILGDGAVHLSTGQIQRIAIARAILKDSPILLLDEMGSALDIENEQKIWKVLREQRRGRTTIFASHRLSAIQDADMVFVLHDQVIVEKGVHEELLKKSGFYAHYHILGMSQ
MTSVFLDKRDVSLYLWGMFVLLLLAVASSLRYYCATMLGERMILFMQRDVIAKIIKLSPSFFNSRGHGEIFSILVKDTERIKAIIGIGMSIVLRSLLMGFGAMCMMFVISIKLSLIVVSIVTLFLMVMIKFSRKKTNTLYADEKKLLNIFSDMIKSVMVLQSFNAGKEAIRLYDIQSQKTYKGFLRSALIRTCIACFVIFFVSCGIFIVFLIGAHYVATAEMPRGKLAEFVVYAFIFFASIRSCLGFIGGISQAIASLRRLRELIVCKLDISSPISSRTFPSPVLGSVSFRSVSFVYPGKSKRSILKNVNFTVQPGETIALVGDSGAGKTSIFSLILRFYDPCSGSVEIEGIDLRLLSLEEIRRFIAWVPQHPIMIAASVYDNIAIGCPHATRKEIQNAAMLAQAHEFIGCLENGYDTILGDGAVHLSTGQIQRIAIARAILKDSPILLLDEMGSALDIENEQKIWKVLREQRRGRTTIFASHRLSAIQDADMVFVLHDQVIVEKGVHEELLKKSGFYAHYHILGMSQ

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target528 lipid A ABC exporter family, fused ATPase and inner mem
254780576597 ABC transporter related protein [Candidatus Liberi 3e-52
254780917596 ABC transporter, nucleotide binding/ATPase protein 1e-48
254780917596 ABC transporter, nucleotide binding/ATPase protein 0.002
255764467565 Type I secretion system ATPase, PrtD [Candidatus L 1e-14
254780559234 thiamine transporter ATP-binding subunit [Candidat 8e-14
254780704254 ABC transporter, nucleotide binding/ATPase protein 1e-11
254780718240 putative high-affinity zinc uptake system ATP-bind 2e-11
254780173257 ABC transporter related protein [Candidatus Liberi 2e-11
254780744262 ABC transporter nucleotide binding/ATPase protein 1e-10
254780871227 lipoprotein-releasing system ATP-binding protein l 3e-10
254780596 438 ABC transporter nucleotide binding/ATPase protein 2e-09
254780538280 ABC transporter, nucleotide binding/ATPase protein 2e-08
254780340348 proline/glycine betaine ABC transporter, ATP-bindi 1e-07
254780273539 putative ABC transporter ATP-binding protein [Cand 4e-06
254780273 539 putative ABC transporter ATP-binding protein [Cand 0.029
254780139257 putative ATP-binding component of ABC transporter 1e-05
254781123 610 putative ABC transporter, ATP-binding protein [Can 3e-05
254781123 610 putative ABC transporter, ATP-binding protein [Can 6e-05
254781060249 ABC transporter, nucleotide binding/ATPase protein 4e-05
254780184959 excinuclease ABC subunit A [Candidatus Liberibacte 0.005
>gi|254780576|ref|YP_003064989.1| ABC transporter related protein [Candidatus Liberibacter asiaticus str. psy62] Length = 597 Back     alignment
 Score =  197 bits (502), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 145/513 (28%), Positives = 252/513 (49%), Gaps = 37/513 (7%)

Query: 26  VASSLRYYCATMLGERMILFMQRDVIAKIIKLSPSFFNSRGHGEIFSILVKDTERIKAII 85
           +++ +R +    +G+     +   V++ + KLS  F  +   G++ S +      I+ II
Sbjct: 92  ISNHIRDFLYVEIGQGATCTLYHQVVSHVYKLSQRFHINYKVGKLSSAISNGIRSIEMII 151

Query: 86  GIGMSIVLRSLLMGFGAMCMMFVI----SIKLSLIVVSIVTLFLMVMIK------FSRKK 135
            I + + L   ++ F A+ M F+      I +S++ V+++      +I        S+K 
Sbjct: 152 RI-IVVHLIPTILEF-AISMAFLWYSYGDIYVSIMAVTVILYVWFTIITSNWRVGLSKKM 209

Query: 136 TNTLYADEKKLLNIFSDMIKSVMVLQSFNAGKEAIRLYDIQSQKTYKGFLRSALIRTCIA 195
            N L+    K+     D + +   +Q FN+ K     ++I   + Y    + + I    +
Sbjct: 210 NNLLHECHAKVF----DTLINFETIQYFNSEK-----FEINRLEKYISKYKESAISVATS 260

Query: 196 CFVIFF-----VSCGIFIVFLIGAHYVATAEMPRGKLAEFVVYAFIFFASIRSCLGFIGG 250
              + F      S G+ I  +I +H V   E   G      V+       +   L  +G 
Sbjct: 261 LGWLNFGQGLIFSIGMVITMIISSHAVYIGEQTVGDF----VFINTLLTQLAIPLNILGT 316

Query: 251 I----SQAIASLRRLRELIVCKLDISSPISSRTFPSPVLGSVSFRSVSFVYPGKSKRSIL 306
           I     Q+   +  L  ++  K++I + ++S+       G + F +VSF Y       I 
Sbjct: 317 IYRDSRQSFIEIEELLNILNEKIEIQNAVNSKDLKIKN-GHIVFNNVSFSY--NHHNCIF 373

Query: 307 KNVNFTVQPGETIALVGDSGAGKTSIFSLILRFYDPCSGSVEIEGIDLRLLSLEEIRRFI 366
           K ++F + P +  AL+G+SG GK+++  L+ R YD   G + I+G D++ ++ E +R+ I
Sbjct: 374 KGISFEIAPSKKTALIGESGVGKSTVAKLLYRLYDIKGGIITIDGQDIKKITKESLRQTI 433

Query: 367 AWVPQHPIMIAASVYDNIAIGCPHATRKEIQNAAMLAQAHEFIGCLENGYDTILGDGAVH 426
             +PQ  I+   ++  NI  G P+A+ +E+  A  +AQ   FI  L NGYDT++G+  + 
Sbjct: 434 GIIPQDTILFNDTLRYNILYGNPNASDQELCAAVEVAQLKSFIMKLPNGYDTVVGERGLK 493

Query: 427 LSTGQIQRIAIARAILKDSPILLLDEMGSALDIENEQKIWKVLREQRRGRTTIFASHRLS 486
           LS G+ QR++IARAILK+ PI++ DE  S+LDI  E+ I   L    + RTT+  +HRLS
Sbjct: 494 LSGGEKQRVSIARAILKNPPIIIFDEATSSLDIITERHIQTALATLSKNRTTLVIAHRLS 553

Query: 487 AIQDADMVFVLHDQVIVEKGVHEELLKKSGFYA 519
            I DAD + V     +VE G HE L+ + G Y 
Sbjct: 554 TITDADNIIVFDQGTVVESGSHENLISQGGIYT 586

>gi|254780917|ref|YP_003065330.1| ABC transporter, nucleotide binding/ATPase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 596 Back     alignment
 Score =  186 bits (471), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 98/229 (42%), Positives = 142/229 (62%), Gaps = 2/229 (0%)

Query: 286 GSVSFRSVSFVYPGKSKRSILKNVNFTVQPGETIALVGDSGAGKTSIFSLILRFYDPCSG 345
           G+  FR V F Y  K    +L  +N   + G+  ALVG SG+GK++I +L++R YDP SG
Sbjct: 351 GTTVFRDVFFSY--KQGHPVLSGINLCFKSGKMTALVGPSGSGKSTIINLLMRMYDPSSG 408

Query: 346 SVEIEGIDLRLLSLEEIRRFIAWVPQHPIMIAASVYDNIAIGCPHATRKEIQNAAMLAQA 405
           S+EI+GI++R ++   +R  I++V Q   + + +V  NI IG P AT +E+   A  A A
Sbjct: 409 SIEIDGINIRDITFSSLRERISYVGQDVFLFSNTVRYNILIGRPMATEEEMIEIAKSANA 468

Query: 406 HEFIGCLENGYDTILGDGAVHLSTGQIQRIAIARAILKDSPILLLDEMGSALDIENEQKI 465
           H+FI  L  GYDT +G+   +LS GQ QRIAIARA+L+D  IL+LDE  SALD   E  +
Sbjct: 469 HDFIMSLPQGYDTYVGENGSNLSGGQKQRIAIARAMLRDGHILVLDEATSALDTHTENLV 528

Query: 466 WKVLREQRRGRTTIFASHRLSAIQDADMVFVLHDQVIVEKGVHEELLKK 514
            + L    +GRTTI  +HR+S I +AD +  + D  + E G  + LL++
Sbjct: 529 RQALSRLMQGRTTIVIAHRISTIIEADHIIFIEDGKVSESGDQKYLLQQ 577

>gi|254780917|ref|YP_003065330.1| ABC transporter, nucleotide binding/ATPase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 596 Back     alignment
 Score = 35.4 bits (80), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/110 (23%), Positives = 55/110 (50%), Gaps = 2/110 (1%)

Query: 11  VSLYLWGMFVLLLLAVASSLRYYCATMLGERMILFMQRDVIAKIIKLSPSFFNSRGHGEI 70
           VS  + G+F++    +AS ++ Y  +  G  +I   QR +  ++++    F++S    E+
Sbjct: 75  VSSTVAGIFIVK--GIASFVQNYYLSCAGNSIIAEQQRKIYRRLLQYGMEFYDSNQSSEL 132

Query: 71  FSILVKDTERIKAIIGIGMSIVLRSLLMGFGAMCMMFVISIKLSLIVVSI 120
                  T+ +++++ I ++  LR  L   G + +MF+    LSL  + I
Sbjct: 133 QVRFTHATQSVRSVVDIFITSFLRDFLTLVGLIVVMFLQEPTLSLCTIII 182

>gi|255764467|ref|YP_003064798.2| Type I secretion system ATPase, PrtD [Candidatus Liberibacter asiaticus str. psy62] Length = 565 Back     alignment
 Score = 73.2 bits (178), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 54/203 (26%), Positives = 95/203 (46%), Gaps = 9/203 (4%)

Query: 300 KSKRSILKNVNFTVQPGETIALVGDSGAGKTSIFSLILRFYDPCSGSVEIEGIDLRLLSL 359
           K+ R I +N++FT+  G    + G SG GK++    +L       G++       R +S 
Sbjct: 342 KTSRLICQNLSFTIPEGSCCIIAGPSGCGKSNFLLCMLGLLTLEKGTISFGD---RQISR 398

Query: 360 EEIRRF---IAWVPQHPIMIAASVYDNIAIGCPHATRKEIQNAAMLAQAHEFIGCLENGY 416
           + I +F   I ++ QH  +   S+ +NI +     +    Q  A +   HE I  L+NGY
Sbjct: 399 DFIEKFSAQIGYLSQHCSLFPISITENIILSHDQNSLHIAQKTAKIVGCHEDILSLKNGY 458

Query: 417 DTILGDGAVHLSTGQIQRIAIARAILKDSPILLLDEMGSALDIENEQKIWKVLREQRRGR 476
            T      +  +   +Q+I ++R I  +  ILL+DE    LD E +   + +L++ +  +
Sbjct: 459 QTTYCSDEIPYNI--VQKIRLSRIIANNPAILLMDEPLYHLDNEAKNNFYTLLKQFKENK 516

Query: 477 TTI-FASHRLSAIQDADMVFVLH 498
            TI   SH  + I  +D   + H
Sbjct: 517 KTIVIISHDPTIISMSDFSLIFH 539

>gi|254780559|ref|YP_003064972.1| thiamine transporter ATP-binding subunit [Candidatus Liberibacter asiaticus str. psy62] Length = 234 Back     alignment
 Score = 70.1 bits (170), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 63/221 (28%), Positives = 105/221 (47%), Gaps = 11/221 (4%)

Query: 310 NFTVQPGETIALVGDSGAGKTSIFSLILRFYDPCSGSVEIEGIDLRLLSLEEIRRFIAWV 369
           +F V   E I ++G SGAGK+++ SL+  F  P  GS+ + G +    S    R      
Sbjct: 19  DFQVNKAERIVILGPSGAGKSTLLSLMAGFKYPTRGSIFLNGQN-HTRSSPSKRPLSILF 77

Query: 370 PQHPIMIAASVYDNIAIGCPHATRKEIQNAAMLAQAHEFIGCLENGYDTILGDGAVHLST 429
            ++ +    +V+ NIA+G     R +    A + Q  E +  LE+ ++         +S 
Sbjct: 78  QENNLFSHLTVWQNIALGIAPNLRLDHYQHAQVKQMLEKV-FLEDFFNRF----PSQMSG 132

Query: 430 GQIQRIAIARAILKDSPILLLDEMGSALDIENEQKIWKVLRE--QRRGRTTIFASHRL-S 486
           GQ QR+A+AR +++  PILLLDE  +  D     +I  +L++    R  T +  SH L  
Sbjct: 133 GQRQRVALARCLIRQKPILLLDEPFAVFDPALRHEILGLLKQVCDERQLTLLMISHNLED 192

Query: 487 AIQDADMVFVLHDQVIVEKGVHEELLKKSGFYAHYHILGMS 527
           ++Q A    V+    IV  G  + L+  +G      +LG+ 
Sbjct: 193 SMQIATRFIVIAGGQIVYDGDPDRLM--NGLIPESTLLGIP 231

>gi|254780704|ref|YP_003065117.1| ABC transporter, nucleotide binding/ATPase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 254 Back     alignment
 Score = 63.2 bits (152), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 53/194 (27%), Positives = 90/194 (46%), Gaps = 11/194 (5%)

Query: 301 SKRSILKNVNFTVQPGETIALVGDSGAGKTSIFSLILRFY---DPC--SGSVEIEGIDLR 355
            KR++  ++N  +      AL+G SG GK++    + R     D C  +G + ++G ++ 
Sbjct: 18  EKRALF-DINLKIPQNSVTALIGPSGCGKSTFLRCLNRMNETIDNCVFTGEIILDGKNIY 76

Query: 356 LLSLE--EIRRFIAWVPQHPIMIAASVYDNIAIGCP--HATRKEIQNAAMLAQAHEFIGC 411
             S++   +R  +  V Q P     S+YDN+A G P  H       +   + +       
Sbjct: 77  QSSVDVVRLRARVGMVFQRPNPFPKSIYDNVAYG-PRIHGLGNNKADIDQIVEMSLKKAS 135

Query: 412 LENGYDTILGDGAVHLSTGQIQRIAIARAILKDSPILLLDEMGSALDIENEQKIWKVLRE 471
           L N     L   A  LS GQ QR+ IARA+  +  ++L+DE  SALD      + +++ E
Sbjct: 136 LFNEVKDRLFHDASLLSGGQQQRVCIARALAVNPEVILMDEPCSALDPIATASVEELIHE 195

Query: 472 QRRGRTTIFASHRL 485
            R   T +  +H +
Sbjct: 196 LRESLTIVIVTHSM 209

>gi|254780718|ref|YP_003065131.1| putative high-affinity zinc uptake system ATP-binding component of ABC transporter protein [Candidatus Liberibacter asiaticus str. psy62] Length = 240 Back     alignment
 Score = 62.4 bits (150), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 55/220 (25%), Positives = 103/220 (46%), Gaps = 32/220 (14%)

Query: 288 VSFRSVSFVYPGKSKRSILKNVNFTVQPGETIALVGDSGAGKTSIFSLILRFYDPCSGSV 347
           +S  + SF    K+   IL+++NFT++P E + L+G +G+GK++I  LI     P  GSV
Sbjct: 11  ISLSNTSF---HKNGYKILQDINFTIKPNEIVTLIGPNGSGKSTIAKLITGIIKPTIGSV 67

Query: 348 EIEGIDLRLLSLEEIRRFIAWVPQHPIM---IAASVYDNIAIGCPHATRKEIQNAAMLAQ 404
           +              +  + +VPQ   +   +  S+   + +  P +    +Q    +  
Sbjct: 68  K-----------RHPQLIVGYVPQKVTIENTLPLSLMRFMTLSMPSSRDDVLQ----ILD 112

Query: 405 AHEFIGCLENGYDTILGDGAVHLSTGQIQRIAIARAILKDSPILLLDEMGSALDIENEQK 464
               IG     Y+  + D    LS G+ QR  +A+A+L+   +L+LDE    +D   E  
Sbjct: 113 RVNLIG----KYNRNIKD----LSGGEFQRALLAKALLRKPNLLVLDEPLQGIDFPGELS 164

Query: 465 IWKVLREQRR--GRTTIFASHRLSAIQ-DADMVFVLHDQV 501
           +++++   R+  G   +  SH L  +    D V  L++++
Sbjct: 165 LYELITSVRQSTGCGILLISHNLHMVMASTDTVICLNNRI 204

>gi|254780173|ref|YP_003064586.1| ABC transporter related protein [Candidatus Liberibacter asiaticus str. psy62] Length = 257 Back     alignment
 Score = 62.0 bits (149), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 69/253 (27%), Positives = 116/253 (45%), Gaps = 21/253 (8%)

Query: 272 SSPISSRTFPSPVLGSVSFRSVSFVYPGKSKRSILKNVNFTVQPGETIALVGDSGAGKTS 331
           ++PI+S+  P           + F+         L+++N  V  GE + + G SG+GK++
Sbjct: 3   NTPINSKNPPKNNFAV----EIKFLNKWYGNFHALRDINLNVLRGERVIIAGPSGSGKST 58

Query: 332 IFSLILRFYDPCSGSVEIEGIDLR--LLSLEEIRRFIAWVPQHPIMIAA-SVYDNIAIGC 388
           +   I       +G + I GI L   + ++ E+RR +  V QH  + +  SV +N  +G 
Sbjct: 59  LIRCINHIEKHQAGEIIINGIPLNDDIRNIHEVRRDVGMVFQHFNLFSNLSVLENCTLG- 117

Query: 389 PHATRKEIQNAAMLAQAHEFIGCLENGYDTILGDGA----VHLSTGQIQRIAIARAILKD 444
           P   RK  +  A     H ++  ++      + D +      LS G+ QR AIAR++   
Sbjct: 118 PIWVRKMPKKDAEELAMH-YLNKVK------IADKSHRSSSLLSGGESQRAAIARSLCMQ 170

Query: 445 SPILLLDEMGSALDIENEQKIWKVLRE-QRRGRTTIFASHRLS-AIQDADMVFVLHDQVI 502
             I+L DE  SALD E  +++  ++ E    G T +  +H +  A Q AD V  +    I
Sbjct: 171 PKIMLFDEPTSALDPEMVKEVLDIMIELAEEGMTMVCVTHEMGFARQVADRVVFMDQGQI 230

Query: 503 VEKGVHEELLKKS 515
           VE+   EE     
Sbjct: 231 VEQNSPEEFFNNP 243

>gi|254780744|ref|YP_003065157.1| ABC transporter nucleotide binding/ATPase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 262 Back     alignment
 Score = 59.7 bits (143), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 57/216 (26%), Positives = 108/216 (50%), Gaps = 11/216 (5%)

Query: 305 ILKNVNFTVQPGETIALVGDSGAGKTSIFSLILRFYDPCSGSVEIEGIDLRLLSLEEIRR 364
           ++K V+  V+PGE + L+G +GAGKT+ F ++       SGS++I+G D+  + +    R
Sbjct: 40  VVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKIDGNDITKMPMYRRAR 99

Query: 365 F-IAWVPQHP-IMIAASVYDNI-AIGCPHATRKEIQNAAMLAQAHEFIGCLENGYDTILG 421
             I+++PQ   I    +V +NI A+   +   K+ ++  + +   EF       +  +L 
Sbjct: 100 LGISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLKEFN---ITKWRHVL- 155

Query: 422 DGAVHLSTGQIQRIAIARAILKDSPILLLDEMGSALDIENEQKIWKVLRE-QRRGRTTIF 480
             A  LS GQ +R+ IAR+++     +LLDE  + +D      I  ++R+   RG   + 
Sbjct: 156 --APLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDLASRGIGILI 213

Query: 481 ASHRLSAIQDA-DMVFVLHDQVIVEKGVHEELLKKS 515
             H +  I    D  +++H   ++  G  +E++   
Sbjct: 214 TDHNVHEILTLIDRAYIIHAGGVLAHGTVQEIIDNQ 249

>gi|254780871|ref|YP_003065284.1| lipoprotein-releasing system ATP-binding protein lolD [Candidatus Liberibacter asiaticus str. psy62] Length = 227 Back     alignment
 Score = 58.2 bits (139), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 60/229 (26%), Positives = 104/229 (45%), Gaps = 30/229 (13%)

Query: 289 SFRSVSFVYPGKSKRSILKNVNFTVQPGETIALVGDSGAGKTSIFSLILRFYDPCSGSVE 348
           S+R V   +P      +L+NV+ +++ GE +ALV  SG GK++I  +      P  G+V 
Sbjct: 15  SYRQVGKPFP------VLENVHLSLKKGEIVALVSPSGTGKSTILHIAGLLEVPDQGNVI 68

Query: 349 IEGIDLRLLSLEEIRRF-----IAWVPQ-HPIMIAASVYDNIAI-----GCPHATRKEIQ 397
           I       LS ++ + F     I +V Q H +++  SV +NI       G  H T  +  
Sbjct: 69  IANQLCNKLS-DDKKSFLRCSKIGFVYQEHRLLMDFSVIENIIFPQIIAGINHKTAYQ-- 125

Query: 398 NAAMLAQAHEFIGCLENGYDTILGDGAVHLSTGQIQRIAIARAILKDSPILLLDEMGSAL 457
                 +A + +  ++          +  +S G+ QR+AI RAI     I+L DE    L
Sbjct: 126 ------RAMDLLSYMD--MSQYANRRSSDISGGEQQRVAICRAIANKPLIILADEPTGNL 177

Query: 458 DIENEQKIWKVLREQ--RRGRTTIFASHRLSAIQDADMVFVLHDQVIVE 504
           D++  Q+++ +L+    R G   + A+H        D    + D +I +
Sbjct: 178 DLKTAQQVFSILKYLVVRSGLAALIATHNHDLASQMDRQITIRDGMIAD 226

>gi|254780596|ref|YP_003065009.1| ABC transporter nucleotide binding/ATPase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 438 Back     alignment
 Score = 55.5 bits (132), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 44/156 (28%), Positives = 77/156 (49%), Gaps = 11/156 (7%)

Query: 305 ILKNVNFTVQPGETIALVGDSGAGKTSIFSLILRFYDPCSGSVEIEGIDLRLLSLEEIRR 364
           +L  VNF V  GE + L+G SG+GK+++  +I     P SG V  +G  ++     +  +
Sbjct: 32  VLDKVNFNVSSGEIVGLLGRSGSGKSTLLRIIAGLVSPSSGQVLFKGKKIK-----DPPK 86

Query: 365 FIAWVPQH-PIMIAASVYDNIAIGCPHATRKEIQNAAMLAQAHEFIGCLENGYDTILGDG 423
            I+ V Q   +    +V +N+ +G       + +       A + IG   +G+++     
Sbjct: 87  DISVVFQTFALFPWLTVLENVELGLKAKGIDKEERRKRALSAIDLIGL--DGFESA---H 141

Query: 424 AVHLSTGQIQRIAIARAILKDSPILLLDEMGSALDI 459
              +S G +QR+  ARA +    +LL+DE  SALD+
Sbjct: 142 TTEISGGMLQRVGFARAFVVFPSLLLMDEPFSALDV 177

>gi|254780538|ref|YP_003064951.1| ABC transporter, nucleotide binding/ATPase protein (iron) [Candidatus Liberibacter asiaticus str. psy62] Length = 280 Back     alignment
 Score = 52.4 bits (124), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 50/193 (25%), Positives = 95/193 (49%), Gaps = 29/193 (15%)

Query: 286 GSVSFRSVSFVYPGKSKRSILKNVNFTVQPGETIALVGDSGAGKTSIFSLILRFYDPCSG 345
           G +  + +S  YP  +    L++VN  +      AL+G +GAGK+++F  I+       G
Sbjct: 10  GGLELKDISVTYP--NGYCALEDVNLFIPENTITALIGLNGAGKSTLFQAIMGLIPLDKG 67

Query: 346 SVEI--EGIDLRLLSLEEIRRFIAWVPQH-------PIMIAASVYDNIAIGCPHATRKEI 396
           S+ I  + ++  L +       IA++PQ        PI+    V D + +G     R + 
Sbjct: 68  SISIFNQTVENALKA-----DLIAYIPQTESIDWTFPIL----VEDVVMMG-----RYKH 113

Query: 397 QNAAMLAQAHEF---IGCLEN-GYDTILGDGAVHLSTGQIQRIAIARAILKDSPILLLDE 452
            N   +A  +++      LEN G  ++       LS GQ +R+ +ARA+ + S ++++DE
Sbjct: 114 MNWRRVASNNDYRIVTEALENVGMSSMRQRQIGELSIGQQKRVFLARALAQKSQVIIMDE 173

Query: 453 MGSALDIENEQKI 465
             +A+D + E+++
Sbjct: 174 PFAAIDFKTEREM 186

>gi|254780340|ref|YP_003064753.1| proline/glycine betaine ABC transporter, ATP-binding protein [Candidatus Liberibacter asiaticus str. psy62] Length = 348 Back     alignment
 Score = 49.7 bits (117), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 53/216 (24%), Positives = 101/216 (46%), Gaps = 19/216 (8%)

Query: 310 NFTVQPGETIALVGDSGAGKTSIF------SLILR---FYDPCSGSVEIEGIDLRLLSLE 360
           N  V+ GE + L+G SGAGK+++       + ++R     D   G V     D  +L   
Sbjct: 49  NLEVKKGEILVLMGLSGAGKSTLLRSINGLAPVVRGEVLVDTDKGFVNPYAADANVLRKL 108

Query: 361 EIRRFIAWVPQHPIMIAASVYDNIAIGCPHATRKEIQNAAMLAQAHEFIGCLENGYDTIL 420
            +        Q  ++   +V  N+ +G       +++  + +A+  E +        T  
Sbjct: 109 RMHTVSMVFQQFALLPWRTVARNVELGLEFLDIPDVERKSRVAEHLEIVNL------TKW 162

Query: 421 GDGAVH-LSTGQIQRIAIARAILKDSPILLLDEMGSALDIENEQKIW-KVLREQRR-GRT 477
            D  ++ LS G  QR+  ARA    +PILL+DE  S+LD     ++  ++L  QR+  +T
Sbjct: 163 ADCKINMLSGGMKQRVGFARAFATGAPILLMDEPFSSLDPLIRMRLQDELLALQRKLKKT 222

Query: 478 TIFASHRLS-AIQDADMVFVLHDQVIVEKGVHEELL 512
            +F SH ++ A +  + + ++    I++ G  +E++
Sbjct: 223 IVFVSHDINEAFRLGNRIAIMEGGRIIQCGTPQEII 258

>gi|254780273|ref|YP_003064686.1| putative ABC transporter ATP-binding protein [Candidatus Liberibacter asiaticus str. psy62] Length = 539 Back     alignment
 Score = 44.3 bits (103), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 42/165 (25%), Positives = 77/165 (46%), Gaps = 25/165 (15%)

Query: 301 SKRSILKNVNFTVQPGETIALVGDSGAGKTSIFSLILRFYDPCSGSVEIEGIDLRLLSLE 360
           + R ++ N++F + PG  + ++G +GAGKT++F ++     P SG++ + G  + L  ++
Sbjct: 328 NDRLLIDNLSFKLPPGGIVGVIGPNGAGKTTLFRMLTGDESPDSGTIHV-GETVCLSYVD 386

Query: 361 EIRRFIAWVPQHPIMIAASVYDNIAIGCP--HATRKEIQNAAMLAQAHEFIGCLENGYDT 418
           + R          +    +V+++I+ G         EI N+     A  F G        
Sbjct: 387 QSR--------DSLEAEKTVWEDISGGDDIVKLNGHEI-NSRAYCSAFNFKG-------- 429

Query: 419 ILGDGAVH---LSTGQIQRIAIARAILKDSPILLLDEMGSALDIE 460
             GD       LS GQ  R+ +A+ +     ++LLDE  + LD E
Sbjct: 430 --GDQQQRIGSLSGGQRGRVHLAKILKSGGNVILLDEPTNDLDTE 472

>gi|254780273|ref|YP_003064686.1| putative ABC transporter ATP-binding protein [Candidatus Liberibacter asiaticus str. psy62] Length = 539 Back     alignment
 Score = 31.6 bits (70), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 19/89 (21%), Positives = 41/89 (46%), Gaps = 12/89 (13%)

Query: 303 RSILKNVNFTVQPGETIALVGDSGAGKTSIFSLILRFYDPCSGSVEIEGIDLRLLSLEEI 362
           + +L ++N +  P   I ++G +GAGK++I  ++       +G   +             
Sbjct: 19  KKVLDDINLSFYPDAKIGILGPNGAGKSTILRIMAGIDKEYNGEAWL-----------AT 67

Query: 363 RRFIAWVPQHPIM-IAASVYDNIAIGCPH 390
              + ++PQ P + ++ +V +NI  G  H
Sbjct: 68  GFTVGYLPQEPQLDLSKTVKENIIEGVAH 96

>gi|254780139|ref|YP_003064552.1| putative ATP-binding component of ABC transporter [Candidatus Liberibacter asiaticus str. psy62] Length = 257 Back     alignment
 Score = 43.1 bits (100), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 54/201 (26%), Positives = 96/201 (47%), Gaps = 14/201 (6%)

Query: 316 GETIALVGDSGAGKTSIFSLILRFYDPCSGSVEIEGIDLRLLSLEEIRRFIAWVP---QH 372
           GE + ++G SG GK+ +   IL      SG V++ G  L L   ++   F A +    QH
Sbjct: 39  GEILGVIGSSGTGKSILMRGILGLIPRVSGEVKVLGEHLNLAKGKQNFAFSAKLGVLFQH 98

Query: 373 PIMIAA-SVYDNIAIGCPHATRKEIQNAAMLAQ--AHEFIGCLENGYDTILGDGAVHLST 429
             + ++ +V +NI++      ++ +   A L +   H  I  +    +T        LS 
Sbjct: 99  GALFSSMTVQENISM----PIKEHLNLPADLIEHIVHTKIAIVGLPPETA-NLMPFQLSG 153

Query: 430 GQIQRIAIARAILKDSPILLLDEMGSALDIENEQKIWKVLREQRR--GRTTIFASHRLSA 487
           G I+R+++ARA+  D  +L LDE  S LD    ++  K+L + R   G +    +H L+ 
Sbjct: 154 GMIKRVSLARALAIDPDLLFLDEPTSGLDPIAAEEFDKLLIKLRHSLGLSVYMITHDLNN 213

Query: 488 -IQDADMVFVLHDQVIVEKGV 507
            I   + V V+  + I+++G 
Sbjct: 214 LISTCNRVAVIQKKGIMKEGT 234

>gi|254781123|ref|YP_003065536.1| putative ABC transporter, ATP-binding protein [Candidatus Liberibacter asiaticus str. psy62] Length = 610 Back     alignment
 Score = 41.6 bits (96), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 40/166 (24%), Positives = 73/166 (43%), Gaps = 30/166 (18%)

Query: 303 RSILKNVNFTVQPGETIALVGDSGAGKTSIFSLILRFYDPCSGSVEIEGIDLRLLSLEEI 362
           R ++K+ +  +  GE I +VG +GAGKT++  L+     P  G + + G +L++ ++++ 
Sbjct: 297 RLVVKDFSLRIHYGECIGIVGPNGAGKTTLLKLLTGKIKPDCGFITL-GTNLKIATIDQK 355

Query: 363 RRFIAWVPQHPIMIAASVYDNIAIGCPHATRKEIQNAA--------MLAQAHEFIGCLEN 414
           R  I         +  S  D++ +      R E ++ A           QAH  +     
Sbjct: 356 REDIDPDKSLASYLTGSSGDSLMV------RGESRHVAGYIKDFLFHPDQAHSLMK---- 405

Query: 415 GYDTILGDGAVHLSTGQIQRIAIARAILKDSPILLLDEMGSALDIE 460
                      HLS G+  R  +AR + +    L++DE  + LD E
Sbjct: 406 -----------HLSGGEKMRAIVARVLAQPFNFLIMDEPTNDLDFE 440

>gi|254781123|ref|YP_003065536.1| putative ABC transporter, ATP-binding protein [Candidatus Liberibacter asiaticus str. psy62] Length = 610 Back     alignment
 Score = 40.4 bits (93), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 49/203 (24%), Positives = 86/203 (42%), Gaps = 42/203 (20%)

Query: 304 SILKNVNFTVQPGETIALVGDSGAGKTSIFSLILRFYDPCSGSVEIEGIDLRLLSLEEIR 363
            +L++V  +++P E I LVG +G+GK+++  +     +P SG+V +     RL  LE+  
Sbjct: 19  DLLQDVCLSIKPKERICLVGCNGSGKSTLLKIAAGITEPQSGNVFLHSSS-RLGYLEQNP 77

Query: 364 RFIAWVPQHPIMIAASVYDNI--AIGCPHATRKEIQNAAMLAQAHEFIGCLENGYDTILG 421
                   H   I+  + D I   I  P++    ++   +  Q                 
Sbjct: 78  DL-----SHFSTISQYIDDTIKDTIEAPYSPYSLLKKFNLREQ----------------- 115

Query: 422 DGAVHLSTGQIQRIAIARAILKDSPILLLDEMGSALDIENEQKIWKVLREQRRGRTTIFA 481
           D   +LS GQ + +A+ + ++    IL+LDE  + LD                 RT  + 
Sbjct: 116 DRIENLSVGQTRCVALMKMLISRPDILILDEPTNHLDF----------------RTIHWM 159

Query: 482 SHRLSAIQDADMVFVLHDQVIVE 504
              L  I  A ++FV HD+  +E
Sbjct: 160 EQELLKINSA-LIFVSHDRRFLE 181

>gi|254781060|ref|YP_003065473.1| ABC transporter, nucleotide binding/ATPase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 249 Back     alignment
 Score = 41.2 bits (95), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 51/216 (23%), Positives = 97/216 (44%), Gaps = 15/216 (6%)

Query: 304 SILKNVNFTVQPGETIALVGDSGAGKTSIFSLI--LRFYDPCSGSVEIEG---IDLRLLS 358
            I++ +N  V+P E +A++G +G+GK+++  L+   + Y+  +G +  +G   +D  ++ 
Sbjct: 17  EIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAGDILYKGESILDWSIVE 76

Query: 359 LEEIRRFIAWVPQHPIMIAASV---YDNIAIGCPHATR--KEIQNAAMLAQAHEFIGCLE 413
                 F+A+  Q+P+ I   +   +  IA+      R  KE+       +  +    L 
Sbjct: 77  RASKGIFLAF--QYPVEIPGIIMMQFLKIALNEQRKARNEKELLIPDFTRKVRKITAELG 134

Query: 414 NGYDTILGDGAVHLSTGQIQRIAIARAILKDSPILLLDEMGSALDIENEQ---KIWKVLR 470
              D +     +  S G+ +   I +  L +  + +LDE  S LDI+  +   +    LR
Sbjct: 135 INMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDIDALKIAAQGVNALR 194

Query: 471 EQRRGRTTIFASHRLSAIQDADMVFVLHDQVIVEKG 506
            Q R    I    RL      D + VLH+  I++ G
Sbjct: 195 SQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTG 230

>gi|254780184|ref|YP_003064597.1| excinuclease ABC subunit A [Candidatus Liberibacter asiaticus str. psy62] Length = 959 Back     alignment
 Score = 34.3 bits (77), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 23/80 (28%), Positives = 39/80 (48%), Gaps = 4/80 (5%)

Query: 420 LGDGAVHLSTGQIQRIAIARAILKD---SPILLLDEMGSALDIENEQKIWKVLRE-QRRG 475
           +G  A  LS G+ QR+ +A+ + K    + + +LDE  + L   +  K+  +L     RG
Sbjct: 839 IGQSANTLSGGESQRVKLAKELSKQATGNTLYILDEPTTGLHYHDIAKLLNILHTLVDRG 898

Query: 476 RTTIFASHRLSAIQDADMVF 495
            + I   H L  I+ AD + 
Sbjct: 899 NSIIVIEHNLEVIKTADWIL 918

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target528 lipid A ABC exporter family, fused ATPase and inner mem
315122765399 lipid A ABC exporter family, fused ATPase and inner mem 1 1e-112
209550825600 lipid A ABC exporter family, fused ATPase and inner mem 1 1e-103
86359098575 multidrug ABC transporter ATP-binding protein [Rhizobiu 1 1e-102
110635518601 lipid ABC transporter ATPase/inner membrane protein [Me 1 1e-101
241206235600 lipid A ABC exporter family, fused ATPase and inner mem 1 1e-101
116253757600 ATP-binding component of ABC transporter [Rhizobium leg 1 1e-100
190893324575 probable multidrug ABC transporter, ATP-binding protein 1 1e-99
327188831600 putative ATP-binding component of ABC transporter [Rhiz 1 2e-98
222149692608 ABC transporter nucleotide binding/ATPase protein [Agro 1 7e-97
27376619627 HlyB/MsbA family ABC transporter [Bradyrhizobium japoni 1 1e-96
>gi|315122765|ref|YP_004063254.1| lipid A ABC exporter family, fused ATPase and inner membrane subunits [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 399 Back     alignment and organism information
 Score =  411 bits (1056), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 218/336 (64%), Positives = 268/336 (79%), Gaps = 3/336 (0%)

Query: 1   MTSVFLDKRDVSLYLWGMFVLLLLAVASSLRYYCATMLGERMILFMQRDVIAKIIKLSPS 60
           +TSV L K  ++ YLW +F+ LLLA+ASSLRYYCATMLGERMILFMQRD+IAK+I  SPS
Sbjct: 51  ITSVLLKKVGIAPYLWCVFMFLLLAIASSLRYYCATMLGERMILFMQRDIIAKLINFSPS 110

Query: 61  FFNSRGHGEIFSILVKDTERIKAIIGIGMSIVLRSLLMGFGAMCMMFVISIKLSLIVVSI 120
           FF+SR H +IFS LV+DTERIK  IGI MSIVLR+LLM  G+M MMF ISI LSL ++ +
Sbjct: 111 FFSSRSHSDIFSTLVRDTERIKTTIGISMSIVLRNLLMALGSMYMMFFISIDLSLSIIGV 170

Query: 121 VTLFLMVM---IKFSRKKTNTLYADEKKLLNIFSDMIKSVMVLQSFNAGKEAIRLYDIQS 177
             + ++++   +KFSRKK NTLY DEKKLLNIFSDMIKS+MV+QSFNAGKE+++ Y+IQS
Sbjct: 171 ACITIILIIIIMKFSRKKVNTLYLDEKKLLNIFSDMIKSMMVIQSFNAGKESVKSYNIQS 230

Query: 178 QKTYKGFLRSALIRTCIACFVIFFVSCGIFIVFLIGAHYVATAEMPRGKLAEFVVYAFIF 237
           +KTYK FL+S LIR C+ CF IFF+SCGI +V L+GAH V+   M + KL  F++Y+F F
Sbjct: 231 EKTYKNFLKSVLIRACMTCFAIFFLSCGISMVLLLGAHRVSIEGMSQEKLTHFLIYSFTF 290

Query: 238 FASIRSCLGFIGGISQAIASLRRLRELIVCKLDISSPISSRTFPSPVLGSVSFRSVSFVY 297
             SIRS  GF+GGISQAIASL+RLR+L+  +LD  SP  S   PSPVLGS+ FR VSF Y
Sbjct: 291 LGSIRSASGFVGGISQAIASLKRLRDLMAYELDTPSPPLSVALPSPVLGSIVFRDVSFFY 350

Query: 298 PGKSKRSILKNVNFTVQPGETIALVGDSGAGKTSIF 333
           P KS +SILKN++FTV+ GET+ALVG SGAGKTS F
Sbjct: 351 PKKSAKSILKNIDFTVRSGETVALVGLSGAGKTSFF 386


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|209550825|ref|YP_002282742.1| lipid A ABC exporter family, fused ATPase and inner membrane subunits [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 600 Back     alignment and organism information
>gi|86359098|ref|YP_470990.1| multidrug ABC transporter ATP-binding protein [Rhizobium etli CFN 42] Length = 575 Back     alignment and organism information
>gi|110635518|ref|YP_675726.1| lipid ABC transporter ATPase/inner membrane protein [Mesorhizobium sp. BNC1] Length = 601 Back     alignment and organism information
>gi|241206235|ref|YP_002977331.1| lipid A ABC exporter family, fused ATPase and inner membrane subunits [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 600 Back     alignment and organism information
>gi|116253757|ref|YP_769595.1| ATP-binding component of ABC transporter [Rhizobium leguminosarum bv. viciae 3841] Length = 600 Back     alignment and organism information
>gi|190893324|ref|YP_001979866.1| probable multidrug ABC transporter, ATP-binding protein [Rhizobium etli CIAT 652] Length = 575 Back     alignment and organism information
>gi|327188831|gb|EGE56025.1| putative ATP-binding component of ABC transporter [Rhizobium etli CNPAF512] Length = 600 Back     alignment and organism information
>gi|222149692|ref|YP_002550649.1| ABC transporter nucleotide binding/ATPase protein [Agrobacterium vitis S4] Length = 608 Back     alignment and organism information
>gi|27376619|ref|NP_768148.1| HlyB/MsbA family ABC transporter [Bradyrhizobium japonicum USDA 110] Length = 627 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target528 lipid A ABC exporter family, fused ATPase and inner mem
TIGR02204576 TIGR02204, MsbA_rel, ABC transporter, permease/ATP-bind 1e-122
COG1132567 COG1132, MdlB, ABC-type multidrug transport system, ATP 3e-93
KOG00551228 KOG0055, KOG0055, KOG0055, Multidrug/pheromone exporter 6e-92
KOG0055 1228 KOG0055, KOG0055, KOG0055, Multidrug/pheromone exporter 3e-88
TIGR00958711 TIGR00958, 3a01208, Conjugate Transporter-2 (CT2) Famil 4e-80
COG2274709 COG2274, SunT, ABC-type bacteriocin/lantibiotic exporte 5e-80
TIGR02203571 TIGR02203, MsbA_lipidA, lipid A export permease/ATP-bin 2e-73
PRK11176582 PRK11176, PRK11176, lipid transporter ATP-binding/perme 2e-66
COG4988559 COG4988, CydD, ABC-type transport system involved in cy 3e-65
TIGR01192585 TIGR01192, chvA, glucan exporter ATP-binding protein 5e-61
TIGR02857529 TIGR02857, CydD, thiol reductant ABC exporter, CydD sub 2e-60
KOG0057591 KOG0057, KOG0057, KOG0057, Mitochondrial Fe/S cluster e 1e-59
KOG0056790 KOG0056, KOG0056, KOG0056, Heavy metal exporter HMT1, A 8e-59
COG4987573 COG4987, CydC, ABC-type transport system involved in cy 8e-58
TIGR01846694 TIGR01846, type_I_sec_HlyB, type I secretion system ABC 4e-56
TIGR03796710 TIGR03796, NHPM_micro_ABC1, NHPM bacteriocin system ABC 4e-52
TIGR01193708 TIGR01193, bacteriocin_ABC, ABC-type bacteriocin transp 1e-48
KOG00541381 KOG0054, KOG0054, KOG0054, Multidrug resistance-associa 1e-47
TIGR03797686 TIGR03797, NHPM_micro_ABC2, NHPM bacteriocin system ABC 4e-47
PRK10790592 PRK10790, PRK10790, putative multidrug transporter memb 2e-45
KOG0054 1381 KOG0054, KOG0054, KOG0054, Multidrug resistance-associa 1e-41
TIGR009571522 TIGR00957, MRP_assoc_pro, multi drug resistance-associa 7e-34
PLN03232 1495 PLN03232, PLN03232, ABC transporter C family member; Pr 1e-22
COG4615546 COG4615, PvdE, ABC-type siderophore export system, fuse 5e-20
TIGR01194555 TIGR01194, cyc_pep_trnsptr, cyclic peptide transporter 3e-13
KOG0058716 KOG0058, KOG0058, KOG0058, Peptide exporter, ABC superf 6e-99
cd03249238 cd03249, ABC_MTABC3_MDL1_MDL2, MTABC3 (also known as AB 2e-75
cd03251234 cd03251, ABCC_MsbA, MsbA is an essential ABC transporte 1e-73
cd03253236 cd03253, ABCC_ATM1_transporter, ATM1 is an ABC transpor 4e-68
cd03254229 cd03254, ABCC_Glucan_exporter_like, Glucan exporter ATP 6e-65
PRK11174588 PRK11174, PRK11174, cysteine/glutathione ABC transporte 7e-55
PRK10789569 PRK10789, PRK10789, putative multidrug transporter memb 2e-54
cd03245220 cd03245, ABCC_bacteriocin_exporters, ABC-type bacterioc 6e-54
cd03252237 cd03252, ABCC_Hemolysin, The ABC-transporter hemolysin 6e-54
cd03228171 cd03228, ABCC_MRP_Like, The MRP (Mutidrug Resistance Pr 8e-51
cd03248226 cd03248, ABCC_TAP, TAP, the Transporter Associated with 1e-49
cd03244221 cd03244, ABCC_MRP_domain2, Domain 2 of the ABC subfamil 3e-45
cd03225211 cd03225, ABC_cobalt_CbiO_domain1, Domain I of the ABC c 7e-34
cd03246173 cd03246, ABCC_Protease_Secretion, This family represent 8e-33
cd03255218 cd03255, ABC_MJ0796_Lo1CDE_FtsE, This family is compris 4e-32
COG1120258 COG1120, FepC, ABC-type cobalamin/Fe3+-siderophores tra 5e-32
COG1135339 COG1135, AbcC, ABC-type metal ion transport system, ATP 3e-31
cd03247178 cd03247, ABCC_cytochrome_bd, The CYD subfamily implicat 8e-31
cd03260227 cd03260, ABC_PstB_phosphate_transporter, Phosphate upta 1e-30
COG1131293 COG1131, CcmA, ABC-type multidrug transport system, ATP 2e-30
cd03250204 cd03250, ABCC_MRP_domain1, Domain 1 of the ABC subfamil 6e-30
cd03369207 cd03369, ABCC_NFT1, Domain 2 of NFT1 (New full-length M 6e-30
cd03257228 cd03257, ABC_NikE_OppD_transporters, The ABC transporte 1e-29
cd03258233 cd03258, ABC_MetN_methionine_transporter, MetN (also kn 2e-29
COG1124252 COG1124, DppF, ABC-type dipeptide/oligopeptide/nickel t 6e-29
cd03259213 cd03259, ABC_Carb_Solutes_like, ABC Carbohydrate and So 2e-28
COG1136226 COG1136, SalX, ABC-type antimicrobial peptide transport 3e-28
cd03214180 cd03214, ABC_Iron-Siderophores_B12_Hemin, ABC transport 1e-27
cd03295242 cd03295, ABC_OpuCA_Osmoprotection, OpuCA is a the ATP b 2e-27
COG1122235 COG1122, CbiO, ABC-type cobalt transport system, ATPase 2e-27
COG1129 500 COG1129, MglA, ABC-type sugar transport system, ATPase 2e-27
PLN032321495 PLN03232, PLN03232, ABC transporter C family member; Pr 2e-27
COG3842 352 COG3842, PotA, ABC-type spermidine/putrescine transport 5e-27
PLN03130 1622 PLN03130, PLN03130, ABC transporter C family member; Pr 5e-27
COG1125309 COG1125, OpuBA, ABC-type proline/glycine betaine transp 6e-27
cd03230173 cd03230, ABC_DR_subfamily_A, This family of ATP-binding 7e-27
COG1121254 COG1121, ZnuC, ABC-type Mn/Zn transport systems, ATPase 7e-27
COG3638258 COG3638, COG3638, ABC-type phosphate/phosphonate transp 3e-26
COG3839338 COG3839, MalK, ABC-type sugar transport systems, ATPase 3e-26
cd03235213 cd03235, ABC_Metallic_Cations, ABC component of the met 4e-26
cd03293220 cd03293, ABC_NrtD_SsuB_transporters, NrtD and SsuB are 5e-26
cd03288257 cd03288, ABCC_SUR2, The SUR domain 2 6e-26
COG1116248 COG1116, TauB, ABC-type nitrate/sulfonate/bicarbonate t 9e-26
COG1123 539 COG1123, COG1123, ATPase components of various ABC-type 2e-25
cd03294269 cd03294, ABC_Pro_Gly_Bertaine, This family comprises th 5e-25
cd03299235 cd03299, ABC_ModC_like, Archeal protein closely related 1e-24
COG4608268 COG4608, AppF, ABC-type oligopeptide transport system, 1e-24
COG2884223 COG2884, FtsE, Predicted ATPase involved in cell divisi 2e-24
cd03229178 cd03229, ABC_Class3, This class is comprised of all BPD 4e-24
COG0444316 COG0444, DppD, ABC-type dipeptide/oligopeptide/nickel t 5e-24
cd00267157 cd00267, ABC_ATPase, ABC (ATP-binding cassette) transpo 5e-24
cd03256241 cd03256, ABC_PhnC_transporter, ABC-type phosphate/phosp 6e-24
cd03261235 cd03261, ABC_Org_Solvent_Resistant, ABC (ATP-binding ca 7e-24
COG1126240 COG1126, GlnQ, ABC-type polar amino acid transport syst 1e-23
cd03224222 cd03224, ABC_TM1139_LivF_branched, LivF (TM1139) is par 2e-23
COG1118 345 COG1118, CysA, ABC-type sulfate/molybdate transport sys 3e-23
COG1127263 COG1127, Ttg2A, ABC-type transport system involved in r 3e-23
cd03219236 cd03219, ABC_Mj1267_LivG_branched, The Mj1267/LivG ABC 4e-23
TIGR03864236 TIGR03864, PQQ_ABC_ATP, ABC transporter, ATP-binding su 4e-23
COG4619223 COG4619, COG4619, ABC-type uncharacterized transport sy 1e-22
COG1117253 COG1117, PstB, ABC-type phosphate transport system, ATP 1e-22
cd03300232 cd03300, ABC_PotA_N, PotA is an ABC-type transporter an 4e-22
PRK13635279 PRK13635, cbiO, cobalt transporter ATP-binding subunit; 4e-22
cd03296239 cd03296, ABC_CysA_sulfate_importer, Part of the ABC tra 6e-22
PRK13632271 PRK13632, cbiO, cobalt transporter ATP-binding subunit; 7e-22
PRK09452 375 PRK09452, potA, putrescine/spermidine ABC transporter A 9e-22
COG4555245 COG4555, NatA, ABC-type Na+ transport system, ATPase co 1e-21
cd03266218 cd03266, ABC_NatA_sodium_exporter, NatA is the ATPase c 2e-21
COG4172534 COG4172, COG4172, ABC-type uncharacterized transport sy 2e-21
PRK11153343 PRK11153, metN, DL-methionine transporter ATP-binding s 2e-21
COG0410237 COG0410, LivF, ABC-type branched-chain amino acid trans 3e-21
cd03301213 cd03301, ABC_MalK_N, The N-terminal ATPase domain of th 5e-21
cd03262213 cd03262, ABC_HisP_GlnQ_permeases, HisP and GlnQ are the 6e-21
TIGR02315243 TIGR02315, ABC_phnC, phosphonate ABC transporter, ATP-b 6e-21
PRK13640282 PRK13640, cbiO, cobalt transporter ATP-binding subunit; 7e-21
COG4175 386 COG4175, ProV, ABC-type proline/glycine betaine transpo 8e-21
PRK14250241 PRK14250, PRK14250, phosphate ABC transporter ATP-bindi 8e-21
COG0411250 COG0411, LivG, ABC-type branched-chain amino acid trans 2e-20
cd03289275 cd03289, ABCC_CFTR2, The CFTR subfamily domain 2 3e-20
COG3845 501 COG3845, COG3845, ABC-type uncharacterized transport sy 3e-20
PRK10247225 PRK10247, PRK10247, putative ABC transporter ATP-bindin 3e-20
cd03220224 cd03220, ABC_KpsT_Wzt, ABC_KpsT_Wzt The KpsT/Wzt ABC tr 4e-20
cd03264211 cd03264, ABC_drug_resistance_like, ABC-type multidrug t 4e-20
TIGR01271 1490 TIGR01271, CFTR_protein, cystic fibrosis transmembrane 8e-20
COG3840231 COG3840, ThiQ, ABC-type thiamine transport system, ATPa 2e-19
cd03291282 cd03291, ABCC_CFTR1, The CFTR subfamily domain 1 2e-19
TIGR00972247 TIGR00972, 3a0107s01c2, phosphate ABC transporter, ATP- 2e-19
TIGR01277213 TIGR01277, thiQ, thiamine ABC transporter, ATP-binding 2e-19
PRK09536 402 PRK09536, btuD, corrinoid ABC transporter ATPase; Revie 3e-19
cd03265220 cd03265, ABC_DrrA, DrrA is the ATP-binding protein comp 6e-19
PTZ002431560 PTZ00243, PTZ00243, ABC transporter; Provisional 6e-19
PRK13652277 PRK13652, cbiO, cobalt transporter ATP-binding subunit; 7e-19
TIGR02769265 TIGR02769, nickel_nikE, nickel import ATP-binding prote 9e-19
COG4172 534 COG4172, COG4172, ABC-type uncharacterized transport sy 1e-18
COG4525259 COG4525, TauB, ABC-type taurine transport system, ATPas 1e-18
PRK11231255 PRK11231, fecE, iron-dicitrate transporter ATP-binding 1e-18
PRK13548258 PRK13548, hmuV, hemin importer ATP-binding subunit; Pro 1e-18
COG4559259 COG4559, COG4559, ABC-type hemin transport system, ATPa 2e-18
cd03218232 cd03218, ABC_YhbG, The ABC transporters belonging to th 2e-18
TIGR02211221 TIGR02211, LolD_lipo_ex, lipoprotein releasing system, 2e-18
PRK14262250 PRK14262, PRK14262, phosphate ABC transporter ATP-bindi 2e-18
TIGR00968237 TIGR00968, 3a0106s01, sulfate ABC transporter, ATP-bind 2e-18
COG1137243 COG1137, YhbG, ABC-type (unclassified) transport system 3e-18
TIGR03258 362 TIGR03258, PhnT, 2-aminoethylphosphonate ABC transport 3e-18
PRK13639275 PRK13639, cbiO, cobalt transporter ATP-binding subunit; 4e-18
TIGR01186 363 TIGR01186, proV, glycine betaine/L-proline transport AT 4e-18
PRK10070 400 PRK10070, PRK10070, glycine betaine transporter ATP-bin 5e-18
COG1134249 COG1134, TagH, ABC-type polysaccharide/polyol phosphate 6e-18
TIGR02314343 TIGR02314, ABC_MetN, D-methionine ABC transporter, ATP- 7e-18
PRK10771232 PRK10771, thiQ, thiamine transporter ATP-binding subuni 9e-18
PRK13650279 PRK13650, cbiO, cobalt transporter ATP-binding subunit; 2e-17
PRK15439 510 PRK15439, PRK15439, autoinducer 2 ABC transporter ATP-b 2e-17
TIGR02770230 TIGR02770, nickel_nikD, nickel import ATP-binding prote 3e-17
COG4598256 COG4598, HisP, ABC-type histidine transport system, ATP 4e-17
cd03298211 cd03298, ABC_ThiQ_thiamine_transporter, ABC-type thiami 4e-17
TIGR03873256 TIGR03873, F420-0_ABC_ATP, proposed F420-0 ABC transpor 4e-17
TIGR02982220 TIGR02982, heterocyst_DevA, ABC exporter ATP-binding su 4e-17
COG1129500 COG1129, MglA, ABC-type sugar transport system, ATPase 5e-17
PRK14272252 PRK14272, PRK14272, phosphate ABC transporter ATP-bindi 5e-17
PRK14269246 PRK14269, PRK14269, phosphate ABC transporter ATP-bindi 5e-17
cd03290218 cd03290, ABCC_SUR1_N, The SUR domain 1 6e-17
cd03213194 cd03213, ABCG_EPDR, ABCG transporters are involved in e 7e-17
KOG0061 613 KOG0061, KOG0061, KOG0061, Transporter, ABC superfamily 8e-17
cd03215182 cd03215, ABC_Carb_Monos_II, This family represents doma 1e-16
TIGR03522301 TIGR03522, GldA_ABC_ATP, gliding motility-associated AB 1e-16
PRK13644274 PRK13644, cbiO, cobalt transporter ATP-binding subunit; 1e-16
PRK13637287 PRK13637, cbiO, cobalt transporter ATP-binding subunit; 2e-16
PRK14244251 PRK14244, PRK14244, phosphate ABC transporter ATP-bindi 2e-16
PRK13641287 PRK13641, cbiO, cobalt transporter ATP-binding subunit; 2e-16
COG0396251 COG0396, SufC, ABC-type transport system involved in Fe 3e-16
cd03268208 cd03268, ABC_BcrA_bacitracin_resist, The BcrA subfamily 3e-16
PTZ00243 1560 PTZ00243, PTZ00243, ABC transporter; Provisional 3e-16
COG1101263 COG1101, PhnK, ABC-type uncharacterized transport syste 4e-16
COG4181228 COG4181, COG4181, Predicted ABC-type transport system i 5e-16
cd03269210 cd03269, ABC_putative_ATPase, This subfamily is involve 6e-16
cd03297214 cd03297, ABC_ModC_molybdenum_transporter, ModC is an AB 7e-16
PRK14240250 PRK14240, PRK14240, phosphate transporter ATP-binding p 8e-16
PRK10851 353 PRK10851, PRK10851, sulfate/thiosulfate transporter sub 8e-16
COG4161242 COG4161, ArtP, ABC-type arginine transport system, ATPa 1e-15
PRK14246257 PRK14246, PRK14246, phosphate ABC transporter ATP-bindi 1e-15
TIGR03265 353 TIGR03265, PhnT2, putative 2-aminoethylphosphonate ABC 1e-15
COG4136213 COG4136, COG4136, ABC-type uncharacterized transport sy 2e-15
PRK14247250 PRK14247, PRK14247, phosphate ABC transporter ATP-bindi 2e-15
COG4152300 COG4152, COG4152, ABC-type uncharacterized transport sy 3e-15
PRK10419268 PRK10419, nikE, nickel transporter ATP-binding protein 3e-15
PRK11432 351 PRK11432, fbpC, ferric transporter ATP-binding subunit; 4e-15
TIGR03415 382 TIGR03415, ABC_choXWV_ATP, choline ABC transporter, ATP 4e-15
PRK14270251 PRK14270, PRK14270, phosphate ABC transporter ATP-bindi 4e-15
PRK13642277 PRK13642, cbiO, cobalt transporter ATP-binding subunit; 4e-15
cd03217200 cd03217, ABC_FeS_Assembly, ABC-type transport system in 6e-15
PRK14266250 PRK14266, PRK14266, phosphate ABC transporter ATP-bindi 6e-15
PRK11264250 PRK11264, PRK11264, putative amino-acid ABC transporter 7e-15
cd03223166 cd03223, ABCD_peroxisomal_ALDP, Peroxisomal ATP-binding 1e-14
PRK14252265 PRK14252, PRK14252, phosphate ABC transporter ATP-bindi 1e-14
COG4604252 COG4604, CeuD, ABC-type enterochelin transport system, 2e-14
PRK14255252 PRK14255, PRK14255, phosphate ABC transporter ATP-bindi 2e-14
PRK13646286 PRK13646, cbiO, cobalt transporter ATP-binding subunit; 2e-14
PRK11248255 PRK11248, tauB, taurine transporter ATP-binding subunit 2e-14
PRK13648269 PRK13648, cbiO, cobalt transporter ATP-binding subunit; 2e-14
PRK14251251 PRK14251, PRK14251, phosphate ABC transporter ATP-bindi 2e-14
PRK14264305 PRK14264, PRK14264, phosphate ABC transporter ATP-bindi 2e-14
TIGR03410230 TIGR03410, urea_trans_UrtE, urea ABC transporter, ATP-b 2e-14
COG3845501 COG3845, COG3845, ABC-type uncharacterized transport sy 4e-14
PRK13647274 PRK13647, cbiO, cobalt transporter ATP-binding subunit; 4e-14
PRK11288 501 PRK11288, araG, L-arabinose transporter ATP-binding pro 4e-14
PRK15079331 PRK15079, PRK15079, oligopeptide ABC transporter ATP-bi 5e-14
COG4138248 COG4138, BtuD, ABC-type cobalamin transport system, ATP 6e-14
PRK14249251 PRK14249, PRK14249, phosphate ABC transporter ATP-bindi 8e-14
PRK11308327 PRK11308, dppF, dipeptide transporter ATP-binding subun 9e-14
PRK11124242 PRK11124, artP, arginine transporter ATP-binding subuni 1e-13
TIGR01184230 TIGR01184, ntrCD, nitrate transport ATP-binding subunit 1e-13
PRK10619257 PRK10619, PRK10619, histidine/lysine/arginine/ornithine 1e-13
PRK10535 648 PRK10535, PRK10535, macrolide transporter ATP-binding / 1e-13
PRK14275286 PRK14275, PRK14275, phosphate ABC transporter ATP-bindi 2e-13
TIGR03005252 TIGR03005, ectoine_ehuA, ectoine/hydroxyectoine ABC tra 2e-13
PRK14248268 PRK14248, PRK14248, phosphate ABC transporter ATP-bindi 2e-13
PRK15134529 PRK15134, PRK15134, microcin C ABC transporter ATP-bind 2e-13
TIGR00955 617 TIGR00955, 3a01204, The Eye Pigment Precursor Transport 2e-13
PRK13636283 PRK13636, cbiO, cobalt transporter ATP-binding subunit; 2e-13
PRK14254285 PRK14254, PRK14254, phosphate ABC transporter ATP-bindi 3e-13
COG4586325 COG4586, COG4586, ABC-type uncharacterized transport sy 4e-13
COG4674249 COG4674, COG4674, Uncharacterized ABC-type transport sy 4e-13
PRK09493240 PRK09493, glnQ, glutamine ABC transporter ATP-binding p 4e-13
cd03234226 cd03234, ABCG_White, The White subfamily represents ABC 7e-13
PRK13649280 PRK13649, cbiO, cobalt transporter ATP-binding subunit; 7e-13
PRK10261 623 PRK10261, PRK10261, glutathione transporter ATP-binding 9e-13
COG2401593 COG2401, COG2401, ABC-type ATPase fused to a predicted 1e-12
PRK15134 529 PRK15134, PRK15134, microcin C ABC transporter ATP-bind 1e-12
PRK09700 510 PRK09700, PRK09700, D-allose transporter ATP-binding pr 1e-12
KOG0066807 KOG0066, KOG0066, KOG0066, eIF2-interacting protein ABC 2e-12
COG4148 352 COG4148, ModC, ABC-type molybdate transport system, ATP 2e-12
PRK14271276 PRK14271, PRK14271, phosphate ABC transporter ATP-bindi 2e-12
PRK10253265 PRK10253, PRK10253, iron-enterobactin transporter ATP-b 2e-12
KOG0927614 KOG0927, KOG0927, KOG0927, Predicted transporter (ABC s 3e-12
PRK10261623 PRK10261, PRK10261, glutathione transporter ATP-binding 3e-12
PRK10575265 PRK10575, PRK10575, iron-hydroxamate transporter ATP-bi 3e-12
PRK11000 369 PRK11000, PRK11000, maltose/maltodextrin transporter AT 3e-12
PRK13633280 PRK13633, PRK13633, cobalt transporter ATP-binding subu 4e-12
PRK13549 506 PRK13549, PRK13549, xylose transporter ATP-binding subu 5e-12
TIGR03771223 TIGR03771, anch_rpt_ABC, anchored repeat-type ABC trans 5e-12
COG4167267 COG4167, SapF, ABC-type antimicrobial peptide transport 6e-12
TIGR01188302 TIGR01188, drrA, daunorubicin resistance ABC transporte 6e-12
PRK14256252 PRK14256, PRK14256, phosphate ABC transporter ATP-bindi 7e-12
PRK13643288 PRK13643, cbiO, cobalt transporter ATP-binding subunit; 7e-12
cd03216163 cd03216, ABC_Carb_Monos_I, This family represents the d 9e-12
PRK03695248 PRK03695, PRK03695, vitamin B12-transporter ATPase; Pro 1e-11
PRK11650 356 PRK11650, ugpC, glycerol-3-phosphate transporter ATP-bi 1e-11
COG4107258 COG4107, PhnK, ABC-type phosphonate transport system, A 2e-11
TIGR03740223 TIGR03740, galliderm_ABC, gallidermin-class lantibiotic 2e-11
PRK13547272 PRK13547, hmuV, hemin importer ATP-binding subunit; Pro 2e-11
TIGR02142 354 TIGR02142, modC_ABC, molybdenum ABC transporter, ATP-bi 3e-11
PRK14267253 PRK14267, PRK14267, phosphate ABC transporter ATP-bindi 3e-11
PRK13634290 PRK13634, cbiO, cobalt transporter ATP-binding subunit; 4e-11
TIGR02323253 TIGR02323, CP_lyasePhnK, phosphonate C-P lyase system p 5e-11
PRK11247257 PRK11247, ssuB, aliphatic sulfonates transport ATP-bind 9e-11
PRK10418254 PRK10418, nikD, nickel transporter ATP-binding protein 1e-10
cd03267236 cd03267, ABC_NatA_like, Similar in sequence to NatA, th 2e-10
TIGR02633 500 TIGR02633, xylG, D-xylose ABC transporter, ATP-binding 3e-10
TIGR03411242 TIGR03411, urea_trans_UrtD, urea ABC transporter, ATP-b 5e-10
TIGR01978243 TIGR01978, sufC, FeS assembly ATPase SufC 5e-10
PRK10762 501 PRK10762, PRK10762, D-ribose transporter ATP binding pr 1e-09
PRK11614237 PRK11614, livF, leucine/isoleucine/valine transporter A 2e-09
KOG0065 1391 KOG0065, KOG0065, KOG0065, Pleiotropic drug resistance 3e-09
cd03232192 cd03232, ABC_PDR_domain2, The pleiotropic drug resistan 1e-08
cd03233202 cd03233, ABC_PDR_domain1, The pleiotropic drug resistan 1e-08
PRK13549506 PRK13549, PRK13549, xylose transporter ATP-binding subu 2e-08
TIGR02633500 TIGR02633, xylG, D-xylose ABC transporter, ATP-binding 2e-08
PRK10982 491 PRK10982, PRK10982, galactose/methyl galaxtoside transp 2e-08
PRK15112267 PRK15112, PRK15112, antimicrobial peptide ABC system AT 2e-08
TIGR03269520 TIGR03269, met_CoM_red_A2, methyl coenzyme M reductase 3e-08
TIGR03269 520 TIGR03269, met_CoM_red_A2, methyl coenzyme M reductase 3e-08
PRK11831269 PRK11831, PRK11831, putative ABC transporter ATP-bindin 5e-08
PRK13631320 PRK13631, cbiO, cobalt transporter ATP-binding subunit; 6e-08
PRK13638271 PRK13638, cbiO, cobalt transporter ATP-binding subunit; 7e-08
cd03237246 cd03237, ABC_RNaseL_inhibitor_domain2, The ATPase domai 8e-08
PRK11701258 PRK11701, phnK, phosphonate C-P lyase system protein Ph 2e-07
PRK11022326 PRK11022, dppD, dipeptide transporter ATP-binding subun 2e-07
smart00382148 smart00382, AAA, ATPases associated with a variety of c 3e-07
COG1245591 COG1245, COG1245, Predicted ATPase, RNase L inhibitor ( 4e-07
PRK15439510 PRK15439, PRK15439, autoinducer 2 ABC transporter ATP-b 5e-07
PRK13651305 PRK13651, PRK13651, cobalt transporter ATP-binding subu 9e-07
PRK11144 352 PRK11144, modC, molybdate transporter ATP-binding prote 1e-06
PRK13645289 PRK13645, cbiO, cobalt transporter ATP-binding subunit; 1e-06
PRK10522547 PRK10522, PRK10522, multidrug transporter membrane comp 2e-06
PRK09580248 PRK09580, sufC, cysteine desulfurase ATPase component; 7e-06
KOG0062582 KOG0062, KOG0062, KOG0062, ATPase component of ABC tran 8e-06
COG4170330 COG4170, SapD, ABC-type antimicrobial peptide transport 9e-06
PRK10938 490 PRK10938, PRK10938, putative molybdenum transport ATP-b 1e-05
PLN03211 659 PLN03211, PLN03211, ABC transporter G-25; Provisional 4e-05
CHL00131252 CHL00131, ycf16, sulfate ABC transporter protein; Valid 5e-05
PRK09473330 PRK09473, oppD, oligopeptide transporter ATP-binding co 1e-04
TIGR00956 1394 TIGR00956, 3a01205, Pleiotropic Drug Resistance (PDR) F 2e-04
PRK15093330 PRK15093, PRK15093, antimicrobial peptide ABC transport 2e-04
PRK10636 638 PRK10636, PRK10636, putative ABC transporter ATP-bindin 3e-04
cd03240204 cd03240, ABC_Rad50, The catalytic domains of Rad50 are 0.002
PRK13657588 PRK13657, PRK13657, cyclic beta-1,2-glucan ABC transpor 2e-72
COG5265497 COG5265, ATM1, ABC-type transport system involved in Fe 5e-63
TIGR03375694 TIGR03375, type_I_sec_LssB, type I secretion system ATP 3e-57
TIGR01842544 TIGR01842, type_I_sec_PrtD, type I secretion system ABC 4e-46
COG4618580 COG4618, ArpD, ABC-type protease/lipase transport syste 1e-45
PLN03130 1622 PLN03130, PLN03130, ABC transporter C family member; Pr 1e-27
COG1123539 COG1123, COG1123, ATPase components of various ABC-type 5e-26
TIGR00957 1522 TIGR00957, MRP_assoc_pro, multi drug resistance-associa 2e-24
COG4178604 COG4178, COG4178, ABC-type uncharacterized transport sy 3e-18
COG0488530 COG0488, Uup, ATPase components of ABC transporters wit 1e-15
TIGR01257 2272 TIGR01257, rim_protein, retinal-specific rim ABC transp 5e-14
PRK14260259 PRK14260, PRK14260, phosphate ABC transporter ATP-bindi 4e-12
PRK14258261 PRK14258, PRK14258, phosphate ABC transporter ATP-bindi 1e-11
KOG0927 614 KOG0927, KOG0927, KOG0927, Predicted transporter (ABC s 7e-09
PRK11160574 PRK11160, PRK11160, cysteine/glutathione ABC transporte 9e-50
KOG0060659 KOG0060, KOG0060, KOG0060, Long-chain acyl-CoA transpor 4e-12
TIGR02868529 TIGR02868, CydC, thiol reductant ABC exporter, CydC sub 1e-43
TIGR012711490 TIGR01271, CFTR_protein, cystic fibrosis transmembrane 1e-20
PTZ002651466 PTZ00265, PTZ00265, multidrug resistance protein (mdr1) 7e-28
TIGR01187 325 TIGR01187, potA, spermidine/putrescine ABC transporter 2e-15
TIGR03608206 TIGR03608, L_ocin_972_ABC, putative bacteriocin export 5e-25
TIGR02673214 TIGR02673, FtsE, cell division ATP-binding protein FtsE 5e-25
TIGR00960216 TIGR00960, 3a0501s02, Type II (General) Secretory Pathw 4e-24
cd03263220 cd03263, ABC_subfamily_A, The ABCA subfamily mediates t 3e-22
cd03292214 cd03292, ABC_FtsE_transporter, FtsE is a hydrophilic nu 2e-21
cd03226205 cd03226, ABC_cobalt_CbiO_domain2, Domain II of the ABC 2e-20
COG1119257 COG1119, ModF, ABC-type molybdenum transport system, AT 9e-19
PRK10908222 PRK10908, PRK10908, cell division protein FtsE; Provisi 3e-17
TIGR02324224 TIGR02324, CP_lyasePhnL, phosphonate C-P lyase system p 7e-17
TIGR01166190 TIGR01166, cbiO, cobalt transport protein ATP-binding s 2e-16
PRK14259269 PRK14259, PRK14259, phosphate ABC transporter ATP-bindi 5e-16
COG0488 530 COG0488, Uup, ATPase components of ABC transporters wit 2e-15
PRK15056272 PRK15056, PRK15056, manganese/iron transporter ATP-bind 6e-15
PRK14245250 PRK14245, PRK14245, phosphate ABC transporter ATP-bindi 8e-15
PRK11629233 PRK11629, lolD, lipoprotein transporter ATP-binding sub 9e-15
PRK14239252 PRK14239, PRK14239, phosphate transporter ATP-binding p 1e-14
PRK14242253 PRK14242, PRK14242, phosphate transporter ATP-binding p 7e-14
COG4133209 COG4133, CcmA, ABC-type transport system involved in cy 8e-14
PRK14273254 PRK14273, PRK14273, phosphate ABC transporter ATP-bindi 3e-13
PRK14268258 PRK14268, PRK14268, phosphate ABC transporter ATP-bindi 3e-13
PRK14237267 PRK14237, PRK14237, phosphate transporter ATP-binding p 3e-13
cd03231201 cd03231, ABC_CcmA_heme_exporter, CcmA, the ATP-binding 5e-13
PRK14257329 PRK14257, PRK14257, phosphate ABC transporter ATP-bindi 7e-13
PRK10744260 PRK10744, pstB, phosphate transporter ATP-binding prote 9e-13
PRK13536340 PRK13536, PRK13536, nodulation factor exporter subunit 1e-12
PRK14236272 PRK14236, PRK14236, phosphate transporter ATP-binding p 1e-12
COG4778235 COG4778, PhnL, ABC-type phosphonate transport system, A 2e-12
PRK13537306 PRK13537, PRK13537, nodulation ABC transporter NodI; Pr 2e-12
PRK14253249 PRK14253, PRK14253, phosphate ABC transporter ATP-bindi 2e-12
PRK14261253 PRK14261, PRK14261, phosphate ABC transporter ATP-bindi 3e-12
PRK10895241 PRK10895, PRK10895, lipopolysaccharide ABC transporter 4e-12
PRK14235267 PRK14235, PRK14235, phosphate transporter ATP-binding p 6e-12
PRK11607 377 PRK11607, potG, putrescine transporter ATP-binding subu 6e-12
PRK14263261 PRK14263, PRK14263, phosphate ABC transporter ATP-bindi 2e-11
PRK14243264 PRK14243, PRK14243, phosphate transporter ATP-binding p 4e-11
PRK10584228 PRK10584, PRK10584, putative ABC transporter ATP-bindin 4e-11
PRK14238271 PRK14238, PRK14238, phosphate transporter ATP-binding p 5e-11
PRK13539207 PRK13539, PRK13539, cytochrome c biogenesis protein Ccm 6e-11
PRK14274259 PRK14274, PRK14274, phosphate ABC transporter ATP-bindi 7e-11
PRK14265274 PRK14265, PRK14265, phosphate ABC transporter ATP-bindi 2e-10
TIGR01189198 TIGR01189, ccmA, heme ABC exporter, ATP-binding protein 2e-10
KOG0064728 KOG0064, KOG0064, KOG0064, Peroxisomal long-chain acyl- 9e-10
TIGR01288303 TIGR01288, nodI, ATP-binding ABC transporter family nod 1e-08
PRK09544251 PRK09544, znuC, high-affinity zinc transporter ATPase; 4e-08
PRK10938490 PRK10938, PRK10938, putative molybdenum transport ATP-b 8e-08
PRK11288501 PRK11288, araG, L-arabinose transporter ATP-binding pro 2e-07
TIGR012572272 TIGR01257, rim_protein, retinal-specific rim ABC transp 2e-07
PRK09984262 PRK09984, PRK09984, phosphonate/organophosphate ester t 4e-07
PRK11147 635 PRK11147, PRK11147, ABC transporter ATPase component; R 2e-06
KOG2355291 KOG2355, KOG2355, KOG2355, Predicted ABC-type transport 2e-05
TIGR00956 1394 TIGR00956, 3a01205, Pleiotropic Drug Resistance (PDR) F 4e-05
KOG0062 582 KOG0062, KOG0062, KOG0062, ATPase component of ABC tran 5e-05
PRK13541195 PRK13541, PRK13541, cytochrome c biogenesis protein Ccm 5e-05
TIGR00954659 TIGR00954, 3a01203, Peroxysomal Fatty Acyl CoA Transpor 7e-05
PRK13540200 PRK13540, PRK13540, cytochrome c biogenesis protein Ccm 7e-05
PRK13545 549 PRK13545, tagH, teichoic acids export protein ATP-bindi 3e-04
KOG0063 592 KOG0063, KOG0063, KOG0063, RNAse L inhibitor, ABC super 5e-04
PLN03140 1470 PLN03140, PLN03140, ABC transporter G family member; Pr 0.001
pfam00005119 pfam00005, ABC_tran, ABC transporter 2e-16
PRK13543214 PRK13543, PRK13543, cytochrome c biogenesis protein Ccm 6e-10
PRK13538204 PRK13538, PRK13538, cytochrome c biogenesis protein Ccm 4e-09
PRK11300255 PRK11300, livG, leucine/isoleucine/valine transporter A 3e-08
PTZ00265 1466 PTZ00265, PTZ00265, multidrug resistance protein (mdr1) 2e-16
COG1245 591 COG1245, COG1245, Predicted ATPase, RNase L inhibitor ( 5e-07
cd03222177 cd03222, ABC_RNaseL_inhibitor, The ABC ATPase RNase L i 2e-05
PRK13409590 PRK13409, PRK13409, putative ATPase RIL; Provisional 1e-04
KOG0059885 KOG0059, KOG0059, KOG0059, Lipid exporter ABCA1 and rel 3e-16
pfam00664275 pfam00664, ABC_membrane, ABC transporter transmembrane 4e-16
PTZ00265 1466 PTZ00265, PTZ00265, multidrug resistance protein (mdr1) 3e-13
KOG0065 1391 KOG0065, KOG0065, KOG0065, Pleiotropic drug resistance 4e-12
PTZ002651466 PTZ00265, PTZ00265, multidrug resistance protein (mdr1) 1e-10
PRK14241258 PRK14241, PRK14241, phosphate transporter ATP-binding p 9e-10
PLN03073718 PLN03073, PLN03073, ABC transporter F family; Provision 3e-09
PRK11147635 PRK11147, PRK11147, ABC transporter ATPase component; R 1e-08
TIGR03719 552 TIGR03719, ABC_ABC_ChvD, ATP-binding cassette protein, 6e-05
TIGR03719552 TIGR03719, ABC_ABC_ChvD, ATP-binding cassette protein, 6e-05
cd03221144 cd03221, ABCF_EF-3, ABCF_EF-3 Elongation factor 3 (EF-3 4e-07
PRK15064530 PRK15064, PRK15064, ABC transporter ATP-binding protein 0.002
PRK13409 590 PRK13409, PRK13409, putative ATPase RIL; Provisional 7e-07
cd03221144 cd03221, ABCF_EF-3, ABCF_EF-3 Elongation factor 3 (EF-3 3e-05
cd03236255 cd03236, ABC_RNaseL_inhibitor_domain1, The ATPase domai 4e-05
cd03227162 cd03227, ABC_Class2, ABC-type Class 2 contains systems 1e-04
COG11961163 COG1196, Smc, Chromosome segregation ATPases [Cell divi 0.002
>gnl|CDD|131259 TIGR02204, MsbA_rel, ABC transporter, permease/ATP-binding protein Back     alignment and domain information
>gnl|CDD|31327 COG1132, MdlB, ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|35278 KOG0055, KOG0055, KOG0055, Multidrug/pheromone exporter, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>gnl|CDD|35278 KOG0055, KOG0055, KOG0055, Multidrug/pheromone exporter, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>gnl|CDD|162132 TIGR00958, 3a01208, Conjugate Transporter-2 (CT2) Family protein Back     alignment and domain information
>gnl|CDD|32455 COG2274, SunT, ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|131258 TIGR02203, MsbA_lipidA, lipid A export permease/ATP-binding protein MsbA Back     alignment and domain information
>gnl|CDD|183016 PRK11176, PRK11176, lipid transporter ATP-binding/permease protein; Provisional Back     alignment and domain information
>gnl|CDD|34593 COG4988, CydD, ABC-type transport system involved in cytochrome bd biosynthesis, ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|130260 TIGR01192, chvA, glucan exporter ATP-binding protein Back     alignment and domain information
>gnl|CDD|163042 TIGR02857, CydD, thiol reductant ABC exporter, CydD subunit Back     alignment and domain information
>gnl|CDD|35280 KOG0057, KOG0057, KOG0057, Mitochondrial Fe/S cluster exporter, ABC superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>gnl|CDD|35279 KOG0056, KOG0056, KOG0056, Heavy metal exporter HMT1, ABC superfamily [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|34592 COG4987, CydC, ABC-type transport system involved in cytochrome bd biosynthesis, fused ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|162558 TIGR01846, type_I_sec_HlyB, type I secretion system ABC transporter, HlyB family Back     alignment and domain information
>gnl|CDD|163508 TIGR03796, NHPM_micro_ABC1, NHPM bacteriocin system ABC transporter, peptidase/ATP-binding protein Back     alignment and domain information
>gnl|CDD|130261 TIGR01193, bacteriocin_ABC, ABC-type bacteriocin transporter Back     alignment and domain information
>gnl|CDD|35277 KOG0054, KOG0054, KOG0054, Multidrug resistance-associated protein/mitoxantrone resistance protein, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>gnl|CDD|163509 TIGR03797, NHPM_micro_ABC2, NHPM bacteriocin system ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|182733 PRK10790, PRK10790, putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>gnl|CDD|35277 KOG0054, KOG0054, KOG0054, Multidrug resistance-associated protein/mitoxantrone resistance protein, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>gnl|CDD|130031 TIGR00957, MRP_assoc_pro, multi drug resistance-associated protein (MRP) Back     alignment and domain information
>gnl|CDD|178771 PLN03232, PLN03232, ABC transporter C family member; Provisional Back     alignment and domain information
>gnl|CDD|34240 COG4615, PvdE, ABC-type siderophore export system, fused ATPase and permease components [Secondary metabolites biosynthesis, transport, and catabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|130262 TIGR01194, cyc_pep_trnsptr, cyclic peptide transporter Back     alignment and domain information
>gnl|CDD|35281 KOG0058, KOG0058, KOG0058, Peptide exporter, ABC superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>gnl|CDD|73008 cd03249, ABC_MTABC3_MDL1_MDL2, MTABC3 (also known as ABCB6) is a mitochondrial ATP-binding cassette protein involved in iron homeostasis and one of four ABC transporters expressed in the mitochondrial inner membrane, the other three being MDL1(ABC7), MDL2, and ATM1 Back     alignment and domain information
>gnl|CDD|73010 cd03251, ABCC_MsbA, MsbA is an essential ABC transporter, closely related to eukaryotic MDR proteins Back     alignment and domain information
>gnl|CDD|73012 cd03253, ABCC_ATM1_transporter, ATM1 is an ABC transporter that is expressed in the mitochondria Back     alignment and domain information
>gnl|CDD|73013 cd03254, ABCC_Glucan_exporter_like, Glucan exporter ATP-binding protein Back     alignment and domain information
>gnl|CDD|183014 PRK11174, PRK11174, cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>gnl|CDD|182732 PRK10789, PRK10789, putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>gnl|CDD|73004 cd03245, ABCC_bacteriocin_exporters, ABC-type bacteriocin exporters Back     alignment and domain information
>gnl|CDD|73011 cd03252, ABCC_Hemolysin, The ABC-transporter hemolysin B is a central component of the secretion machinery that translocates the toxin, hemolysin A, in a Sec-independent fashion across both membranes of E Back     alignment and domain information
>gnl|CDD|72987 cd03228, ABCC_MRP_Like, The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export Back     alignment and domain information
>gnl|CDD|73007 cd03248, ABCC_TAP, TAP, the Transporter Associated with Antigen Processing; TAP is essential for peptide delivery from the cytosol into the lumen of the endoplasmic reticulum (ER), where these peptides are loaded on major histocompatibility complex (MHC) I molecules Back     alignment and domain information
>gnl|CDD|73003 cd03244, ABCC_MRP_domain2, Domain 2 of the ABC subfamily C Back     alignment and domain information
>gnl|CDD|72984 cd03225, ABC_cobalt_CbiO_domain1, Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>gnl|CDD|73005 cd03246, ABCC_Protease_Secretion, This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain Back     alignment and domain information
>gnl|CDD|73014 cd03255, ABC_MJ0796_Lo1CDE_FtsE, This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE) Back     alignment and domain information
>gnl|CDD|31317 COG1120, FepC, ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|31330 COG1135, AbcC, ABC-type metal ion transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|73006 cd03247, ABCC_cytochrome_bd, The CYD subfamily implicated in cytochrome bd biogenesis Back     alignment and domain information
>gnl|CDD|73019 cd03260, ABC_PstB_phosphate_transporter, Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient Back     alignment and domain information
>gnl|CDD|31326 COG1131, CcmA, ABC-type multidrug transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|73009 cd03250, ABCC_MRP_domain1, Domain 1 of the ABC subfamily C Back     alignment and domain information
>gnl|CDD|73061 cd03369, ABCC_NFT1, Domain 2 of NFT1 (New full-length MRP-type transporter 1) Back     alignment and domain information
>gnl|CDD|73016 cd03257, ABC_NikE_OppD_transporters, The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE) Back     alignment and domain information
>gnl|CDD|73017 cd03258, ABC_MetN_methionine_transporter, MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport Back     alignment and domain information
>gnl|CDD|31321 COG1124, DppF, ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|73018 cd03259, ABC_Carb_Solutes_like, ABC Carbohydrate and Solute Transporters-like subgroup Back     alignment and domain information
>gnl|CDD|31331 COG1136, SalX, ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|72973 cd03214, ABC_Iron-Siderophores_B12_Hemin, ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea Back     alignment and domain information
>gnl|CDD|73054 cd03295, ABC_OpuCA_Osmoprotection, OpuCA is a the ATP binding component of a bacterial solute transporter that serves a protective role to cells growing in a hyperosmolar environment Back     alignment and domain information
>gnl|CDD|31319 COG1122, CbiO, ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|31325 COG1129, MglA, ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|178771 PLN03232, PLN03232, ABC transporter C family member; Provisional Back     alignment and domain information
>gnl|CDD|33633 COG3842, PotA, ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|178676 PLN03130, PLN03130, ABC transporter C family member; Provisional Back     alignment and domain information
>gnl|CDD|31322 COG1125, OpuBA, ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|72989 cd03230, ABC_DR_subfamily_A, This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity Back     alignment and domain information
>gnl|CDD|31318 COG1121, ZnuC, ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|33436 COG3638, COG3638, ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|33631 COG3839, MalK, ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|72994 cd03235, ABC_Metallic_Cations, ABC component of the metal-type transporters Back     alignment and domain information
>gnl|CDD|73052 cd03293, ABC_NrtD_SsuB_transporters, NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively Back     alignment and domain information
>gnl|CDD|73047 cd03288, ABCC_SUR2, The SUR domain 2 Back     alignment and domain information
>gnl|CDD|31313 COG1116, TauB, ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|31320 COG1123, COG1123, ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|73053 cd03294, ABC_Pro_Gly_Bertaine, This family comprises the glycine betaine/L-proline ATP binding subunit in bacteria and its equivalents in archaea Back     alignment and domain information
>gnl|CDD|73058 cd03299, ABC_ModC_like, Archeal protein closely related to ModC Back     alignment and domain information
>gnl|CDD|73178 COG4608, AppF, ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|32710 COG2884, FtsE, Predicted ATPase involved in cell division [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|72988 cd03229, ABC_Class3, This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment Back     alignment and domain information
>gnl|CDD|30793 COG0444, DppD, ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|72971 cd00267, ABC_ATPase, ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>gnl|CDD|73015 cd03256, ABC_PhnC_transporter, ABC-type phosphate/phosphonate transport system Back     alignment and domain information
>gnl|CDD|73020 cd03261, ABC_Org_Solvent_Resistant, ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>gnl|CDD|31323 COG1126, GlnQ, ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|72983 cd03224, ABC_TM1139_LivF_branched, LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids Back     alignment and domain information
>gnl|CDD|31315 COG1118, CysA, ABC-type sulfate/molybdate transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|31324 COG1127, Ttg2A, ABC-type transport system involved in resistance to organic solvents, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|72978 cd03219, ABC_Mj1267_LivG_branched, The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine Back     alignment and domain information
>gnl|CDD|163576 TIGR03864, PQQ_ABC_ATP, ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system Back     alignment and domain information
>gnl|CDD|34242 COG4619, COG4619, ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|31314 COG1117, PstB, ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|73059 cd03300, ABC_PotA_N, PotA is an ABC-type transporter and the ATPase component of the spermidine/putrescine-preferential uptake system consisting of PotA, -B, -C, and -D Back     alignment and domain information
>gnl|CDD|184195 PRK13635, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|73055 cd03296, ABC_CysA_sulfate_importer, Part of the ABC transporter complex cysAWTP involved in sulfate import Back     alignment and domain information
>gnl|CDD|184192 PRK13632, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|181868 PRK09452, potA, putrescine/spermidine ABC transporter ATPase protein; Reviewed Back     alignment and domain information
>gnl|CDD|34199 COG4555, NatA, ABC-type Na+ transport system, ATPase component [Energy production and conversion / Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|73025 cd03266, ABC_NatA_sodium_exporter, NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake Back     alignment and domain information
>gnl|CDD|33913 COG4172, COG4172, ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|183001 PRK11153, metN, DL-methionine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|30759 COG0410, LivF, ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|73060 cd03301, ABC_MalK_N, The N-terminal ATPase domain of the maltose transporter, MalK Back     alignment and domain information
>gnl|CDD|73021 cd03262, ABC_HisP_GlnQ_permeases, HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively Back     alignment and domain information
>gnl|CDD|131368 TIGR02315, ABC_phnC, phosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|184200 PRK13640, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|33915 COG4175, ProV, ABC-type proline/glycine betaine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|184591 PRK14250, PRK14250, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|30760 COG0411, LivG, ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|73048 cd03289, ABCC_CFTR2, The CFTR subfamily domain 2 Back     alignment and domain information
>gnl|CDD|33636 COG3845, COG3845, ABC-type uncharacterized transport systems, ATPase components [General function prediction only] Back     alignment and domain information
>gnl|CDD|182331 PRK10247, PRK10247, putative ABC transporter ATP-binding protein YbbL; Provisional Back     alignment and domain information
>gnl|CDD|72979 cd03220, ABC_KpsT_Wzt, ABC_KpsT_Wzt The KpsT/Wzt ABC transporter subfamily is involved in extracellular polysaccharide export Back     alignment and domain information
>gnl|CDD|73023 cd03264, ABC_drug_resistance_like, ABC-type multidrug transport system, ATPase component Back     alignment and domain information
>gnl|CDD|162277 TIGR01271, CFTR_protein, cystic fibrosis transmembrane conductor regulator (CFTR) Back     alignment and domain information
>gnl|CDD|33632 COG3840, ThiQ, ABC-type thiamine transport system, ATPase component [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|73050 cd03291, ABCC_CFTR1, The CFTR subfamily domain 1 Back     alignment and domain information
>gnl|CDD|130045 TIGR00972, 3a0107s01c2, phosphate ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|130344 TIGR01277, thiQ, thiamine ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|169949 PRK09536, btuD, corrinoid ABC transporter ATPase; Reviewed Back     alignment and domain information
>gnl|CDD|73024 cd03265, ABC_DrrA, DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin Back     alignment and domain information
>gnl|CDD|140270 PTZ00243, PTZ00243, ABC transporter; Provisional Back     alignment and domain information
>gnl|CDD|172200 PRK13652, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|131816 TIGR02769, nickel_nikE, nickel import ATP-binding protein NikE Back     alignment and domain information
>gnl|CDD|33913 COG4172, COG4172, ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|34177 COG4525, TauB, ABC-type taurine transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|183044 PRK11231, fecE, iron-dicitrate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|184133 PRK13548, hmuV, hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|34201 COG4559, COG4559, ABC-type hemin transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|72977 cd03218, ABC_YhbG, The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids Back     alignment and domain information
>gnl|CDD|131266 TIGR02211, LolD_lipo_ex, lipoprotein releasing system, ATP-binding protein Back     alignment and domain information
>gnl|CDD|172750 PRK14262, PRK14262, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|130041 TIGR00968, 3a0106s01, sulfate ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|31332 COG1137, YhbG, ABC-type (unclassified) transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|132302 TIGR03258, PhnT, 2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT Back     alignment and domain information
>gnl|CDD|184199 PRK13639, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|130254 TIGR01186, proV, glycine betaine/L-proline transport ATP binding subunit Back     alignment and domain information
>gnl|CDD|182221 PRK10070, PRK10070, glycine betaine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|31329 COG1134, TagH, ABC-type polysaccharide/polyol phosphate transport system, ATPase component [Carbohydrate transport and metabolism / Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|131367 TIGR02314, ABC_MetN, D-methionine ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|182716 PRK10771, thiQ, thiamine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|184209 PRK13650, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|185336 PRK15439, PRK15439, autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional Back     alignment and domain information
>gnl|CDD|131817 TIGR02770, nickel_nikD, nickel import ATP-binding protein NikD Back     alignment and domain information
>gnl|CDD|34233 COG4598, HisP, ABC-type histidine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|73057 cd03298, ABC_ThiQ_thiamine_transporter, ABC-type thiamine tranport system; part of the binding-protein-dependent transport system tbpA-thiPQ for thiamine and TPP Back     alignment and domain information
>gnl|CDD|163585 TIGR03873, F420-0_ABC_ATP, proposed F420-0 ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|132027 TIGR02982, heterocyst_DevA, ABC exporter ATP-binding subunit, DevA family Back     alignment and domain information
>gnl|CDD|31325 COG1129, MglA, ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|172760 PRK14272, PRK14272, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|172757 PRK14269, PRK14269, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|73049 cd03290, ABCC_SUR1_N, The SUR domain 1 Back     alignment and domain information
>gnl|CDD|72972 cd03213, ABCG_EPDR, ABCG transporters are involved in eye pigment (EP) precursor transport, regulation of lipid-trafficking mechanisms, and pleiotropic drug resistance (DR) Back     alignment and domain information
>gnl|CDD|35284 KOG0061, KOG0061, KOG0061, Transporter, ABC superfamily (Breast cancer resistance protein) [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>gnl|CDD|72974 cd03215, ABC_Carb_Monos_II, This family represents domain II of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>gnl|CDD|132561 TIGR03522, GldA_ABC_ATP, gliding motility-associated ABC transporter ATP-binding subunit GldA Back     alignment and domain information
>gnl|CDD|106587 PRK13644, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|184197 PRK13637, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|172732 PRK14244, PRK14244, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|184201 PRK13641, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|30745 COG0396, SufC, ABC-type transport system involved in Fe-S cluster assembly, ATPase component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|73027 cd03268, ABC_BcrA_bacitracin_resist, The BcrA subfamily represents ABC transporters involved in peptide antibiotic resistance Back     alignment and domain information
>gnl|CDD|140270 PTZ00243, PTZ00243, ABC transporter; Provisional Back     alignment and domain information
>gnl|CDD|31298 COG1101, PhnK, ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|33919 COG4181, COG4181, Predicted ABC-type transport system involved in lysophospholipase L1 biosynthesis, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|73028 cd03269, ABC_putative_ATPase, This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity Back     alignment and domain information
>gnl|CDD|73056 cd03297, ABC_ModC_molybdenum_transporter, ModC is an ABC-type transporter and the ATPase component of a molybdate transport system that also includes the periplasmic binding protein ModA and the membrane protein ModB Back     alignment and domain information
>gnl|CDD|184586 PRK14240, PRK14240, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|182778 PRK10851, PRK10851, sulfate/thiosulfate transporter subunit; Provisional Back     alignment and domain information
>gnl|CDD|33907 COG4161, ArtP, ABC-type arginine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|172734 PRK14246, PRK14246, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|163196 TIGR03265, PhnT2, putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|33892 COG4136, COG4136, ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|172735 PRK14247, PRK14247, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|33903 COG4152, COG4152, ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|182444 PRK10419, nikE, nickel transporter ATP-binding protein NikE; Provisional Back     alignment and domain information
>gnl|CDD|183133 PRK11432, fbpC, ferric transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|132456 TIGR03415, ABC_choXWV_ATP, choline ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|184597 PRK14270, PRK14270, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|184202 PRK13642, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|72976 cd03217, ABC_FeS_Assembly, ABC-type transport system involved in Fe-S cluster assembly, ATPase component Back     alignment and domain information
>gnl|CDD|184595 PRK14266, PRK14266, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|183063 PRK11264, PRK11264, putative amino-acid ABC transporter ATP-binding protein YecC; Provisional Back     alignment and domain information
>gnl|CDD|72982 cd03223, ABCD_peroxisomal_ALDP, Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome Back     alignment and domain information
>gnl|CDD|172740 PRK14252, PRK14252, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain in