254780238

254780238

30S ribosomal protein S11

GeneID in NCBI database:8209219Locus tag:CLIBASIA_00615
Protein GI in NCBI database:254780238Protein Accession:YP_003064651.1
Gene range:-(130827, 131216)Protein Length:129aa
Gene description:30S ribosomal protein S11
COG prediction:[J] Ribosomal protein S11
KEGG prediction:rpsK; 30S ribosomal protein S11; K02948 small subunit ribosomal protein S11
SEED prediction:SSU ribosomal protein S11p (S14e)
Pathway involved in KEGG:Ribosome [PATH:las03010]
Subsystem involved in SEED:Ribosome SSU bacterial
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED1 TM-Helix
HMMTOP1 TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------13
MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRRI
cccccccccccEEEEccEEEEEEEEEcccEEEEEEcccccEEEEEEcccccccccccccHHHHHHHHHHHHHHHHHccccEEEEEEEcccccHHHHHHHHHHcccEEEEEEEccccccccccccccccc
ccccccHHHHHHHEcccccEEEEEccccccEEEEEcccccEEEEcccccccccccccccHHHHHHHHHHHHHHHHHcccccEEEEEccccccHHHHHHHHHHcccEEEEEEcccccccccccccccccc
mpkspsrirnrerknivSGRAHVVStfnntrititdphgntiawsspkvvgfsgsrknspfaaQVATDDcsakaqnhgmsslevkvsglgagRDSALRALRAIGFTIVSICDVTmiahngcrprkrrri
mpkspsrirnrerknivsgrahvvstfnntrititdphgntiaWSSPKVVGFSGSRKNSPFAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSIcdvtmiahngcrprkrrri
MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRRI
*****************SGRAHVVSTFNNTRITITDPHGNTIAWSSPKVV*FSGSRKNSPFAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPR*****
*********NRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVG***************************MSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRRI
*****SRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRP******
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRRI
MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRRI
MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRRI

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target129 30S ribosomal protein S11 [Candidatus Liberibacter asia
315122795129 30S ribosomal protein S11 [Candidatus Liberibacter sola 1 1e-66
115525562129 30S ribosomal protein S11 [Rhodopseudomonas palustris B 1 2e-45
148256369129 30S ribosomal protein S11 [Bradyrhizobium sp. BTAi1] Le 1 3e-45
27380488129 30S ribosomal protein S11 [Bradyrhizobium japonicum USD 1 5e-45
90424914129 30S ribosomal protein S11 [Rhodopseudomonas palustris B 1 6e-45
299135234129 30S ribosomal protein S11 [Afipia sp. 1NLS2] Length = 1 1 6e-45
217979116129 30S ribosomal protein S11 [Methylocella silvestris BL2] 1 7e-45
319899076129 30S ribosomal protein S11 [Bartonella clarridgeiae 73] 1 9e-45
182679002129 30S ribosomal protein S11 [Beijerinckia indica subsp. i 1 1e-44
319405875129 30S ribosomal protein S11 [Bartonella sp. AR 15-3] Leng 1 1e-44
>gi|315122795|ref|YP_004063284.1| 30S ribosomal protein S11 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 129 Back     alignment and organism information
 Score =  255 bits (651), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 125/129 (96%), Positives = 127/129 (98%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           MPKSP+R+RNRERKNIVSG AHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP
Sbjct: 1   MPKSPARVRNRERKNIVSGCAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           FAAQVA DDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG
Sbjct: 61  FAAQVAADDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120

Query: 121 CRPRKRRRI 129
           CRPRKRRRI
Sbjct: 121 CRPRKRRRI 129


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|115525562|ref|YP_782473.1| 30S ribosomal protein S11 [Rhodopseudomonas palustris BisA53] Length = 129 Back     alignment and organism information
>gi|148256369|ref|YP_001240954.1| 30S ribosomal protein S11 [Bradyrhizobium sp. BTAi1] Length = 129 Back     alignment and organism information
>gi|27380488|ref|NP_772017.1| 30S ribosomal protein S11 [Bradyrhizobium japonicum USDA 110] Length = 129 Back     alignment and organism information
>gi|90424914|ref|YP_533284.1| 30S ribosomal protein S11 [Rhodopseudomonas palustris BisB18] Length = 129 Back     alignment and organism information
>gi|299135234|ref|ZP_07028425.1| 30S ribosomal protein S11 [Afipia sp. 1NLS2] Length = 129 Back     alignment and organism information
>gi|217979116|ref|YP_002363263.1| 30S ribosomal protein S11 [Methylocella silvestris BL2] Length = 129 Back     alignment and organism information
>gi|319899076|ref|YP_004159169.1| 30S ribosomal protein S11 [Bartonella clarridgeiae 73] Length = 129 Back     alignment and organism information
>gi|182679002|ref|YP_001833148.1| 30S ribosomal protein S11 [Beijerinckia indica subsp. indica ATCC 9039] Length = 129 Back     alignment and organism information
>gi|319405875|emb|CBI79507.1| 30S ribosomal protein S11 [Bartonella sp. AR 15-3] Length = 129 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target129 30S ribosomal protein S11 [Candidatus Liberibacter asia
PRK05309128 PRK05309, PRK05309, 30S ribosomal protein S11; Validate 3e-50
TIGR03632108 TIGR03632, bact_S11, 30S ribosomal protein S11 2e-41
pfam00411109 pfam00411, Ribosomal_S11, Ribosomal protein S11 8e-31
CHL00041116 CHL00041, rps11, ribosomal protein S11 2e-30
KOG0408190 KOG0408, KOG0408, KOG0408, Mitochondrial/chloroplast ri 9e-23
PRK09607132 PRK09607, rps11p, 30S ribosomal protein S11P; Reviewed 2e-14
TIGR03628114 TIGR03628, arch_S11P, archaeal ribosomal protein S11P 8e-13
KOG0407139 KOG0407, KOG0407, KOG0407, 40S ribosomal protein S14 [T 2e-08
PTZ00129149 PTZ00129, PTZ00129, 40S ribosomal protein S14; Provisio 3e-08
COG0100129 COG0100, RpsK, Ribosomal protein S11 [Translation, ribo 2e-37
>gnl|CDD|180007 PRK05309, PRK05309, 30S ribosomal protein S11; Validated Back     alignment and domain information
>gnl|CDD|163365 TIGR03632, bact_S11, 30S ribosomal protein S11 Back     alignment and domain information
>gnl|CDD|144124 pfam00411, Ribosomal_S11, Ribosomal protein S11 Back     alignment and domain information
>gnl|CDD|176982 CHL00041, rps11, ribosomal protein S11 Back     alignment and domain information
>gnl|CDD|35629 KOG0408, KOG0408, KOG0408, Mitochondrial/chloroplast ribosomal protein S11 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|181987 PRK09607, rps11p, 30S ribosomal protein S11P; Reviewed Back     alignment and domain information
>gnl|CDD|132667 TIGR03628, arch_S11P, archaeal ribosomal protein S11P Back     alignment and domain information
>gnl|CDD|35628 KOG0407, KOG0407, KOG0407, 40S ribosomal protein S14 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|185465 PTZ00129, PTZ00129, 40S ribosomal protein S14; Provisional Back     alignment and domain information
>gnl|CDD|30449 COG0100, RpsK, Ribosomal protein S11 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 129 30S ribosomal protein S11 [Candidatus Liberibacter asia
PRK05309126 30S ribosomal protein S11; Validated 100.0
PTZ00129150 40S ribosomal protein S14; Provisional 100.0
COG0100129 RpsK Ribosomal protein S11 [Translation, ribosomal stru 100.0
TIGR03632108 bact_S11 30S ribosomal protein S11. This model describe 100.0
pfam00411109 Ribosomal_S11 Ribosomal protein S11. 100.0
PRK09607129 rps11p 30S ribosomal protein S11P; Reviewed 100.0
CHL00041116 rps11 ribosomal protein S11 100.0
KOG0408190 consensus 100.0
TIGR03628114 arch_S11P archaeal ribosomal protein S11P. This model d 100.0
KOG0407139 consensus 99.89
PTZ00090214 40S ribosomal protein S11; Provisional 99.18
cd00432103 Ribosomal_L18_L5e Ribosomal L18/L5e: L18 (L5e) is a rib 97.6
CHL00139109 rpl18 ribosomal protein L18; Validated 97.25
PRK05593115 rplR 50S ribosomal protein L18; Reviewed 97.17
pfam00861119 Ribosomal_L18p Ribosomal L18p/L5e family. This family i 96.98
PRK08569193 rpl18p 50S ribosomal protein L18P; Reviewed 95.81
COG0256125 RplR Ribosomal protein L18 [Translation, ribosomal stru 95.78
TIGR00060118 L18_bact ribosomal protein L18; InterPro: IPR004389 Rib 93.72
>PRK05309 30S ribosomal protein S11; Validated Back     alignment and domain information
>PTZ00129 40S ribosomal protein S14; Provisional Back     alignment and domain information
>COG0100 RpsK Ribosomal protein S11 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR03632 bact_S11 30S ribosomal protein S11 Back     alignment and domain information
>pfam00411 Ribosomal_S11 Ribosomal protein S11 Back     alignment and domain information
>PRK09607 rps11p 30S ribosomal protein S11P; Reviewed Back     alignment and domain information
>CHL00041 rps11 ribosomal protein S11 Back     alignment and domain information
>KOG0408 consensus Back     alignment and domain information
>TIGR03628 arch_S11P archaeal ribosomal protein S11P Back     alignment and domain information
>KOG0407 consensus Back     alignment and domain information
>PTZ00090 40S ribosomal protein S11; Provisional Back     alignment and domain information
>cd00432 Ribosomal_L18_L5e Ribosomal L18/L5e: L18 (L5e) is a ribosomal protein found in the central protuberance (CP) of the large subunit Back     alignment and domain information
>CHL00139 rpl18 ribosomal protein L18; Validated Back     alignment and domain information
>PRK05593 rplR 50S ribosomal protein L18; Reviewed Back     alignment and domain information
>pfam00861 Ribosomal_L18p Ribosomal L18p/L5e family Back     alignment and domain information
>PRK08569 rpl18p 50S ribosomal protein L18P; Reviewed Back     alignment and domain information
>COG0256 RplR Ribosomal protein L18 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00060 L18_bact ribosomal protein L18; InterPro: IPR004389 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target129 30S ribosomal protein S11 [Candidatus Liberibacter asia
1vs5_K129 Crystal Structure Of The Bacterial Ribosome From Es 5e-42
1p6g_K128 Real Space Refined Coordinates Of The 30s Subunit F 5e-41
3fih_K117 Ternary Complex-Bound E.Coli 70s Ribosome. This Ent 4e-39
2gy9_K116 Structure Of The 30s Subunit Of A Pre-Translocation 2e-38
3bbn_K140 Homology Model For The Spinach Chloroplast 30s Subu 3e-34
1pns_K119 Crystal Structure Of A Streptomycin Dependent Ribos 2e-30
1i94_K128 Crystal Structures Of The Small Ribosomal Subunit W 4e-30
1fjg_K129 Structure Of The Thermus Thermophilus 30s Ribosomal 5e-30
2zkq_k151 Structure Of A Mammalian Ribosomal 40s Subunit With 4e-23
3iz6_K150 Localization Of The Small Subunit Ribosomal Protein 3e-22
3jyv_K125 Structure Of The 40s Rrna And Proteins And PE TRNA 1e-20
3izb_K137 Localization Of The Small Subunit Ribosomal Protein 9e-20
1s1h_K136 Structure Of The Ribosomal 80s-Eef2-Sordarin Comple 1e-19
2xzm_K151 Crystal Structure Of The Eukaryotic 40s Ribosomal S 2e-19
gi|116666558|pdb|1VS5|K Chain K, Crystal Structure Of The Bacterial Ribosome From Escherichia Coli In Complex With The Antibiotic Kasugamyin At 3.5a Resolution. This File Contains The 30s Subunit Of One 70s Ribosome. The Entire Crystal Structure Contains Two 70s Ribosomes And Is Described In Remark 400. Length = 129 Back     alignment and structure
 Score =  173 bits (440), Expect = 5e-42,   Method: Composition-based stats.
 Identities = 67/129 (51%), Positives = 89/129 (68%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           M K+P R R R RK +  G AH+ ++FNNT +TITD  GN + W++    GF GSRK++P
Sbjct: 1   MAKAPIRARKRVRKQVSDGVAHIHASFNNTIVTITDRQGNALGWATAGGSGFRGSRKSTP 60

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           FAAQVA + C+   + +G+ +LEV V G G GR+S +RAL A GF I +I DVT I HNG
Sbjct: 61  FAAQVAAERCADAVKEYGIKNLEVMVKGPGPGRESTIRALNAAGFRITNITDVTPIPHNG 120

Query: 121 CRPRKRRRI 129
           CRP K+RR+
Sbjct: 121 CRPPKKRRV 129


>gi|33357888|pdb|1P6G|K Chain K, Real Space Refined Coordinates Of The 30s Subunit Fitted Into The Low Resolution Cryo-Em Map Of The Ef-G.Gtp State Of E. Coli 70s Ribosome Length = 128 Back     alignment and structure
>gi|224510712|pdb|3FIH|K Chain K, Ternary Complex-Bound E.Coli 70s Ribosome. This Entry Consists Of The 30s Subunit, Trnas And The Ternary Complex. Length = 117 Back     alignment and structure
>gi|116667420|pdb|2GY9|K Chain K, Structure Of The 30s Subunit Of A Pre-Translocational E. Coli Ribosome Obtained By Fitting Atomic Models For Rna And Protein Components Into Cryo-Em Map Emd-1056 Length = 116 Back     alignment and structure
>gi|188036212|pdb|3BBN|K Chain K, Homology Model For The Spinach Chloroplast 30s Subunit Fitted To 9.4a Cryo-Em Map Of The 70s Chlororibosome Length = 140 Back     alignment and structure
>gi|34811539|pdb|1PNS|K Chain K, Crystal Structure Of A Streptomycin Dependent Ribosome From E. Coli, 30s Subunit Of 70s Ribosome. This File, 1pns, Contains The 30s Subunit, Two Trnas, And One Mrna Molecule. The 50s Ribosomal Subunit Is In File 1pnu. Length = 119 Back     alignment and structure
>gi|14278540|pdb|1I94|K Chain K, Crystal Structures Of The Small Ribosomal Subunit With Tetracycline, Edeine And If3 Length = 128 Back     alignment and structure
gi|10835595|pdb|1FJG|K Chain K, Structure Of The Thermus Thermophilus 30s Ribosomal Subunit In Complex With The Antibiotics Streptomycin, Spectinomycin, And Paromomycin Length = 129 Back     alignment and structure
gi|187609264|pdb|2ZKQ|KK Chain k, Structure Of A Mammalian Ribosomal 40s Subunit Within An 80s Complex Obtained By Docking Homology Models Of The Rna And Proteins Into An 8.7 A Cryo-Em Map Length = 151 Back     alignment and structure
gi|313103636|pdb|3IZ6|K Chain K, Localization Of The Small Subunit Ribosomal Proteins Into A 5.5 A Cryo-Em Map Of Triticum Aestivum Translating 80s Ribosome Length = 150 Back     alignment and structure
>gi|281500816|pdb|3JYV|K Chain K, Structure Of The 40s Rrna And Proteins And PE TRNA FOR EUKARYOTIC Ribosome Based On Cryo-Em Map Of Thermomyces Lanuginosus Ribosome At 8.9a Resolution Length = 125 Back     alignment and structure
gi|313103674|pdb|3IZB|K Chain K, Localization Of The Small Subunit Ribosomal Proteins Into A 6.1 A Cryo-Em Map Of Saccharomyces Cerevisiae Translating 80s Ribosome Length = 137 Back     alignment and structure
>gi|49258830|pdb|1S1H|K Chain K, Structure Of The Ribosomal 80s-Eef2-Sordarin Complex From Yeast Obtained By Docking Atomic Models For Rna And Protein Components Into A 11.7 A Cryo-Em Map. This File, 1s1h, Contains 40s Subunit. The 60s Ribosomal Subunit Is In File 1s1i Length = 136 Back     alignment and structure
gi|319443366|pdb|2XZM|K Chain K, Crystal Structure Of The Eukaryotic 40s Ribosomal Subunit In Complex With Initiation Factor 1. This File Contains The 40s Subunit And Initiation Factor For Molecule 1 Length = 151 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target129 30S ribosomal protein S11 [Candidatus Liberibacter asia
3ofo_K117 30S ribosomal protein S11; protein biosynthesis, riboso 4e-39
3i1m_K129 30S ribosomal protein S11; ribosome structure, protein- 1e-36
2vqe_K129 30S ribosomal protein S11, 30S ribosomal protein S6; tR 2e-35
3bbn_K140 Ribosomal protein S11; small ribosomal subunit, spinach 1e-33
1s1h_K136 RP59A, 40S ribosomal protein S14-A; 80S ribosome, 40S r 3e-28
2zkq_k151 40S ribosomal protein S14E; protein-RNA complex, 40S ri 4e-28
>3ofo_K 30S ribosomal protein S11; protein biosynthesis, ribosomes, RNA, tRNA, transfer, eryThr ketolide, macrolide, antibiotic, EXIT, peptidyl; 3.10A {Escherichia coli} PDB: 3fih_K* 3iy8_K 2wwl_K 3ofp_K 3i1m_K 1vs7_K* 3e1a_C 3e1c_C 1vs5_K 3i1o_K 3i1q_K 3i1s_K 3i1z_K 3i21_K 3kc4_K 3or9_K 3ora_K 2qal_K* 1p6g_K 1p87_K ... Length = 117 Back     alignment and structure
 Score =  154 bits (392), Expect = 4e-39
 Identities = 61/117 (52%), Positives = 82/117 (70%)

Query: 13  RKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCSA 72
           RK +  G AH+ ++FNNT +TITD  GN + W++    GF GSRK++PFAAQVA + C+ 
Sbjct: 1   RKQVSDGVAHIHASFNNTIVTITDRQGNALGWATAGGSGFRGSRKSTPFAAQVAAERCAD 60

Query: 73  KAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRRI 129
             + +G+ +LEV V G G GR+S +RAL A GF I +I DVT I HNGCRP K+RR+
Sbjct: 61  AVKEYGIKNLEVMVKGPGPGRESTIRALNAAGFRITNITDVTPIPHNGCRPPKKRRV 117


>3i1m_K 30S ribosomal protein S11; ribosome structure, protein-RNA complex, ribonucleoprotein, ribosomal protein, RNA-binding, rRNA-binding, antibiotic resistance; 3.19A {Escherichia coli k-12} PDB: 1vs7_K* 3e1a_C 3e1c_C 1vs5_K 3i1o_K 3i1q_K 3i1s_K 3i1z_K 3i21_K 2qal_K* 1p6g_K 1p87_K 2aw7_K 2avy_K 2i2u_K 2i2p_K* 2qan_K* 2qb9_K* 2qbb_K* 2qbd_K ... Length = 129 Back     alignment and structure
>2vqe_K 30S ribosomal protein S11, 30S ribosomal protein S6; tRNA-binding, rRNA-binding, metal-binding, zinc-finger, translation; HET: TM2 PAR; 2.5A {Thermus thermophilus} SCOP: c.55.4.1 PDB: 1gix_N* 1hnw_K* 1hnx_K* 1hnz_K* 1hr0_K 1ibk_K* 1ibl_K* 1ibm_K 1j5e_K 1jgo_N* 1jgp_N* 1jgq_N* 1ml5_N* 1n32_K* 1n33_K* 1n34_K 1n36_K 1xmo_K* 1xmq_K* 1xnq_K* ... Length = 129 Back     alignment and structure
>3bbn_K Ribosomal protein S11; small ribosomal subunit, spinach chloroplast ribosome, ribonucleoprotein particle, macromolecular complex; 9.40A {Spinacea oleracea} SCOP: i.1.1.1 Length = 140 Back     alignment and structure
>1s1h_K RP59A, 40S ribosomal protein S14-A; 80S ribosome, 40S ribosomal subunit, EEF2, tRNA translocation, sordarin, cryo-EM; 11.70A {Saccharomyces cerevisiae} SCOP: i.1.1.1 Length = 136 Back     alignment and structure
>2zkq_k 40S ribosomal protein S14E; protein-RNA complex, 40S ribosomal subunit, ribosomal protein/RNA complex; 8.70A {Canis familiaris} Length = 151 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target129 30S ribosomal protein S11 [Candidatus Liberibacter asia
2vqe_K129 30S ribosomal protein S11, 30S ribosomal protein S6; tR 100.0
3bbn_K140 Ribosomal protein S11; small ribosomal subunit, spinach 100.0
3ofo_K117 30S ribosomal protein S11; protein biosynthesis, riboso 100.0
2zkq_k151 40S ribosomal protein S14E; protein-RNA complex, 40S ri 100.0
1s1h_K136 RP59A, 40S ribosomal protein S14-A; 80S ribosome, 40S r 100.0
1vq8_N187 50S ribosomal protein L18P; ribosome 50S, protein-prote 97.47
1ovy_A120 50S ribosomal protein L18; ribosome; NMR {Geobacillus s 97.0
3bbo_Q161 Ribosomal protein L18; large ribosomal subunit, spinach 96.2
2j01_S112 50S ribosomal protein L18; ribosome, tRNA, paromomycin, 95.17
2zjr_L114 50S ribosomal protein L18; ribosome, large ribosomal su 94.8
3ofq_O116 50S ribosomal protein L18; protein biosynthesis, riboso 93.49
>2vqe_K 30S ribosomal protein S11, 30S ribosomal protein S6; tRNA-binding, rRNA-binding, metal-binding, zinc-finger, translation; HET: TM2 PAR; 2.5A {Thermus thermophilus} SCOP: c.55.4.1 PDB: 1gix_N* 1hnw_K* 1hnx_K* 1hnz_K* 1hr0_K 1ibk_K* 1ibl_K* 1ibm_K 1j5e_K 1jgo_N* 1jgp_N* 1jgq_N* 1ml5_N* 1n32_K* 1n33_K* 1n34_K 1n36_K 1xmo_K* 1xmq_K* 1xnq_K* ... Back     alignment and structure
Probab=100.00  E-value=0  Score=312.54  Aligned_cols=126  Identities=51%  Similarity=0.857  Sum_probs=121.6

Q ss_pred             CCCCCCCCCCCEEEECCCEEEEEEECCCCEEEEEECCCCCEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCC
Q ss_conf             98876443343001225218999917987799997089988997404443557754335203789999999999986981
Q gi|254780238|r    1 MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCSAKAQNHGMS   80 (129)
Q Consensus         1 m~~~~~~~~~k~~~~i~~GiihI~~t~NNTiitlTd~~Gn~i~~~S~G~~gfkg~kk~t~~Aa~~~a~~~~~~~~~~gi~   80 (129)
                      |++...  +++.+++++.|++||++|+|||||||||++||+++|+|+|++||+|++|+|||||+++++.++++++++||+
T Consensus         1 m~~~~~--~~~~k~~i~~GivhI~~t~NNTiitlTD~~Gn~i~~~S~G~~gfkg~rk~t~~Aa~~~a~~~~~k~~~~Gi~   78 (129)
T 2vqe_K            1 MAKKPS--KKKVKRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQ   78 (129)
T ss_dssp             ------------CCCCSEEEEEEEECSSCEEEEEECTTSCEEEECCTTTTTCCSGGGGSHHHHHHHHHHHHHHHHTTTCC
T ss_pred             CCCCCC--CCCCCEECCCCEEEEECCCCCEEEEEECCCCCEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCC
T ss_conf             998776--665431512528999806798999998799999999835731137755476889999999999999981981


Q ss_pred             EEEEEEECCCCCHHHHHHHHHHCCCEEEEEEECCCCCCCCCCCCCCCC
Q ss_conf             999999779986788877876369369999963889888868888678
Q gi|254780238|r   81 SLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRR  128 (129)
Q Consensus        81 ~v~v~ikG~G~GR~~~ik~l~~~glkI~~I~D~T~ip~nGcRp~K~RR  128 (129)
                      .|+|+++|||+||+++|++|...||+|.+|+|+||+|||||||||+||
T Consensus        79 ~v~V~~kG~G~GR~~aik~l~~~glkI~~I~D~TpiphNGcRp~K~RR  126 (129)
T 2vqe_K           79 SVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFR  126 (129)
T ss_dssp             EEEEEEESCCTTHHHHHHHHHTSSSEEEECEECCCCCSSCSCCCGGGC
T ss_pred             EEEEEEECCCCCCHHHHHHHHHCCCEEEEEEECCCCCCCCCCCCCCCC
T ss_conf             999999899997299999998789879999989999979989798887



>3bbn_K Ribosomal protein S11; small ribosomal subunit, spinach chloroplast ribosome, ribonucleoprotein particle, macromolecular complex; 9.40A {Spinacea oleracea} SCOP: i.1.1.1 Back     alignment and structure
>3ofo_K 30S ribosomal protein S11; protein biosynthesis, ribosomes, RNA, tRNA, transfer, eryThr ketolide, macrolide, antibiotic, EXIT, peptidyl; 3.10A {Escherichia coli} PDB: 3fih_K* 3iy8_K 2wwl_K 3ofp_K 3i1m_K 1vs7_K* 3e1a_C 3e1c_C 1vs5_K 3i1o_K 3i1q_K 3i1s_K 3i1z_K 3i21_K 3kc4_K 3or9_K 3ora_K 2qal_K* 1p6g_K 1p87_K ... Back     alignment and structure
>2zkq_k 40S ribosomal protein S14E; protein-RNA complex, 40S ribosomal subunit, ribosomal protein/RNA complex; 8.70A {Canis familiaris} PDB: 3jyv_K* Back     alignment and structure
>1s1h_K RP59A, 40S ribosomal protein S14-A; 80S ribosome, 40S ribosomal subunit, EEF2, tRNA translocation, sordarin, cryo-EM; 11.70A {Saccharomyces cerevisiae} SCOP: i.1.1.1 Back     alignment and structure
>1vq8_N 50S ribosomal protein L18P; ribosome 50S, protein-protein complex, RNA-RNA complex, protein-RNA complex, peptidyl transferase reaction; HET: 1MA OMU OMG UR3 PSU SPS; 2.20A {Haloarcula marismortui} SCOP: c.55.4.1 PDB: 1vq4_N* 1vq5_N* 1vq6_N* 1vq7_N* 1s72_N* 1vq9_N* 1vqk_N* 1vql_N* 1vqm_N* 1vqn_N* 1vqo_N* 1vqp_N* 1yhq_N* 1yi2_N* 1yij_N* 1yit_N* 1yj9_N* 1yjn_N* 1yjw_N* 2otj_N* ... Back     alignment and structure
>1ovy_A 50S ribosomal protein L18; ribosome; NMR {Geobacillus stearothermophilus} SCOP: c.55.4.1 Back     alignment and structure
>3bbo_Q Ribosomal protein L18; large ribosomal subunit, spinach chloroplast ribosome, ribonucleoprotein particle, macromolecular complex; 9.40A {Vitis vinifera} Back     alignment and structure
>2j01_S 50S ribosomal protein L18; ribosome, tRNA, paromomycin, mRNA, translation; 2.8A {Thermus thermophilus} SCOP: c.55.4.1 PDB: 1vsp_M 2hgj_R 2hgq_R 2hgu_R 1vsa_M 2j03_S 2jl6_S 2jl8_S 2v47_S 2v49_S 2wdi_S 2wdj_S 2wdl_S 2wdn_S 2wh2_S 2wh4_S 2wrj_S 2wrl_S 2wro_S 2wrr_S ... Back     alignment and structure
>2zjr_L 50S ribosomal protein L18; ribosome, large ribosomal subunit, ribonucleoprotein, RNA-binding, rRNA-binding, tRNA-binding, methylation; 2.91A {Deinococcus radiodurans} SCOP: c.55.4.1 PDB: 1sm1_M* 2zjp_L* 2zjq_L 1nkw_M 3cf5_L* 3dll_L* 1nwy_M* 1nwx_M* 1xbp_M* 1pnu_M 1pny_M 1vor_P 1vou_P 1vow_P 1voy_P 1vp0_P Back     alignment and structure
>3ofq_O 50S ribosomal protein L18; protein biosynthesis, ribosomes, RNA, tRNA, transfer, antibi EXIT, peptidyl, ribosomal subunit, large; 3.10A {Escherichia coli} PDB: 3fik_O 2wwq_O 3ofr_O* 3i1n_O 1p85_M 1p86_M 1vs8_O 1vs6_O 2aw4_O 2awb_O 1vt2_O 2i2v_O 2j28_O 2i2t_O* 2qao_O* 2qba_O* 2qbc_O* 2qbe_O 2qbg_O 2qbi_O* ... Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 129 30S ribosomal protein S11 [Candidatus Liberibacter asia
d2qalk1117 c.55.4.1 (K:12-128) Ribosomal protein S11 {Escherichia 1e-34
d2uubk1119 c.55.4.1 (K:11-129) Ribosomal protein S11 {Thermus ther 3e-33
>d2qalk1 c.55.4.1 (K:12-128) Ribosomal protein S11 {Escherichia coli [TaxId: 562]} Length = 117 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Ribonuclease H-like motif
superfamily: Translational machinery components
family: Ribosomal protein L18 and S11
domain: Ribosomal protein S11
species: Escherichia coli [TaxId: 562]
 Score =  138 bits (350), Expect = 1e-34
 Identities = 61/117 (52%), Positives = 82/117 (70%)

Query: 13  RKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCSA 72
           RK +  G AH+ ++FNNT +TITD  GN + W++    GF GSRK++PFAAQVA + C+ 
Sbjct: 1   RKQVSDGVAHIHASFNNTIVTITDRQGNALGWATAGGSGFRGSRKSTPFAAQVAAERCAD 60

Query: 73  KAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRRI 129
             + +G+ +LEV V G G GR+S +RAL A GF I +I DVT I HNGCRP K+RR+
Sbjct: 61  AVKEYGIKNLEVMVKGPGPGRESTIRALNAAGFRITNITDVTPIPHNGCRPPKKRRV 117


>d2uubk1 c.55.4.1 (K:11-129) Ribosomal protein S11 {Thermus thermophilus [TaxId: 274]} Length = 119 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target129 30S ribosomal protein S11 [Candidatus Liberibacter asia
d2qalk1117 Ribosomal protein S11 {Escherichia coli [TaxId: 562]} 100.0
d2uubk1119 Ribosomal protein S11 {Thermus thermophilus [TaxId: 274 100.0
d1vqon1186 Ribosomal protein L18 (L18p) {Archaeon Haloarcula maris 97.26
d1ovya_97 Ribosomal protein L18 (L18p) {Bacillus stearothermophil 97.0
d2gycm1113 Ribosomal protein L18 (L18p) {Escherichia coli [TaxId: 96.5
d2j01s186 Ribosomal protein L18 (L18p) {Thermus thermophilus [Tax 95.35
>d2qalk1 c.55.4.1 (K:12-128) Ribosomal protein S11 {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Ribonuclease H-like motif
superfamily: Translational machinery components
family: Ribosomal protein L18 and S11
domain: Ribosomal protein S11
species: Escherichia coli [TaxId: 562]
Probab=100.00  E-value=0  Score=305.18  Aligned_cols=117  Identities=52%  Similarity=0.912  Sum_probs=115.1

Q ss_pred             EEECCCEEEEEEECCCCEEEEEECCCCCEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCEEEEEEECCCCC
Q ss_conf             01225218999917987799997089988997404443557754335203789999999999986981999999779986
Q gi|254780238|r   13 RKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCSAKAQNHGMSSLEVKVSGLGAG   92 (129)
Q Consensus        13 ~~~i~~GiihI~~t~NNTiitlTd~~Gn~i~~~S~G~~gfkg~kk~t~~Aa~~~a~~~~~~~~~~gi~~v~v~ikG~G~G   92 (129)
                      +++++.|++||++|+|||||||||++||++.|+|+|++||||++|+||||||++++.++++++++||+.|+|+++|+|+|
T Consensus         1 k~~~~~Gi~hI~~t~NNTiitlTD~~G~~~~~~S~G~~gfkg~~K~t~~Aa~~~a~~~~~~~~~~gi~~v~V~~kG~G~G   80 (117)
T d2qalk1           1 RKQVSDGVAHIHASFNNTIVTITDRQGNALGWATAGGSGFRGSRKSTPFAAQVAAERCADAVKEYGIKNLEVMVKGPGPG   80 (117)
T ss_dssp             CCCCCEEEEEEECCSSCCEEEEEETTSCEEEEEETTTSSCCHHHHTSHHHHHHHHHHHHHHHGGGTCCEEEEEEECCSTT
T ss_pred             CCCCCCEEEEEEECCCCEEEEEECCCCCEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCEEEEEEECCCCC
T ss_conf             95144259999925798999998799999999863235546643333479999999999999983996899999679996


Q ss_pred             HHHHHHHHHHCCCEEEEEEECCCCCCCCCCCCCCCCC
Q ss_conf             7888778763693699999638898888688886789
Q gi|254780238|r   93 RDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRRI  129 (129)
Q Consensus        93 R~~~ik~l~~~glkI~~I~D~T~ip~nGcRp~K~RRi  129 (129)
                      |++++++|+..||+|.+|+|+||+|||||||||+|||
T Consensus        81 R~~air~l~~~gl~I~~I~D~TpiphnGcRp~K~RRv  117 (117)
T d2qalk1          81 RESTIRALNAAGFRITNITDVTPIPHNGCRPPKKRRV  117 (117)
T ss_dssp             TTHHHHHHHHTTCEEEEEEECCCCCSSCSCCCCCCCC
T ss_pred             HHHHHHHHHHCCCEEEEEEECCCCCCCCCCCCCCCCC
T ss_conf             4999999975898899989899999899898999899



>d2uubk1 c.55.4.1 (K:11-129) Ribosomal protein S11 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1vqon1 c.55.4.1 (N:1-186) Ribosomal protein L18 (L18p) {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure
>d1ovya_ c.55.4.1 (A:) Ribosomal protein L18 (L18p) {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2gycm1 c.55.4.1 (M:3-115) Ribosomal protein L18 (L18p) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2j01s1 c.55.4.1 (S:23-108) Ribosomal protein L18 (L18p) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 129 30S ribosomal protein S11 [Candidatus Liberibacter
3i1m_K_129 (K:) 30S ribosomal protein S11; ribosome structure 1e-37
3bbn_K_140 (K:) Ribosomal protein S11; small ribosomal subuni 6e-36
2vqe_K_129 (K:) 30S ribosomal protein S11, 30S ribosomal prot 8e-36
1s1h_K_136 (K:) RP59A, 40S ribosomal protein S14-A; 80S ribos 9e-32
2zkq_k_151 (k:) 40S ribosomal protein S14E; protein-RNA compl 5e-30
>3i1m_K (K:) 30S ribosomal protein S11; ribosome structure, protein-RNA complex, ribonucleoprotein, ribosomal protein, RNA-binding, rRNA-binding, antibiotic resistance; 3.19A {Escherichia coli k-12} PDB: 1vs7_K* 3e1a_C 3e1c_C 1vs5_K 3i1o_K 3i1q_K 3i1s_K 3i1z_K 3i21_K 2qal_K* 1p6g_K 1p87_K 2aw7_K 2avy_K 2i2u_K 2i2p_K* 2qan_K* 2qb9_K* 2qbb_K* 2qbd_K ...Length = 129 Back     alignment and structure
 Score =  149 bits (378), Expect = 1e-37
 Identities = 67/129 (51%), Positives = 89/129 (68%)

Query: 1   MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSP 60
           M K+P R R R RK +  G AH+ ++FNNT +TITD  GN + W++    GF GSRK++P
Sbjct: 1   MAKAPIRARKRVRKQVSDGVAHIHASFNNTIVTITDRQGNALGWATAGGSGFRGSRKSTP 60

Query: 61  FAAQVATDDCSAKAQNHGMSSLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNG 120
           FAAQVA + C+   + +G+ +LEV V G G GR+S +RAL A GF I +I DVT I HNG
Sbjct: 61  FAAQVAAERCADAVKEYGIKNLEVMVKGPGPGRESTIRALNAAGFRITNITDVTPIPHNG 120

Query: 121 CRPRKRRRI 129
           CRP K+RR+
Sbjct: 121 CRPPKKRRV 129


>3bbn_K (K:) Ribosomal protein S11; small ribosomal subunit, spinach chloroplast ribosome, ribonucleoprotein particle, macromolecular complex; 9.40A {Spinacea oleracea}Length = 140 Back     alignment and structure
>2vqe_K (K:) 30S ribosomal protein S11, 30S ribosomal protein S6; tRNA-binding, rRNA-binding, metal-binding, zinc-finger, translation; HET: TM2 PAR; 2.5A {Thermus thermophilus}Length = 129 Back     alignment and structure
>1s1h_K (K:) RP59A, 40S ribosomal protein S14-A; 80S ribosome, 40S ribosomal subunit, EEF2, tRNA translocation, sordarin, cryo-EM; 11.70A {Saccharomyces cerevisiae}Length = 136 Back     alignment and structure
>2zkq_k (k:) 40S ribosomal protein S14E; protein-RNA complex, 40S ribosomal subunit, ribosomal protein/RNA complex; 8.70A {Canis familiaris}Length = 151 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target129 30S ribosomal protein S11 [Candidatus Liberibacter asia
3i1m_K_129 30S ribosomal protein S11; ribosome structure, pro 100.0
2vqe_K_129 30S ribosomal protein S11, 30S ribosomal protein S 100.0
3bbn_K_140 Ribosomal protein S11; small ribosomal subunit, sp 100.0
1s1h_K_136 RP59A, 40S ribosomal protein S14-A; 80S ribosome, 100.0
2zkq_k_151 40S ribosomal protein S14E; protein-RNA complex, 4 100.0
1vq8_N_187 50S ribosomal protein L18P; ribosome 50S, protein- 97.22
1ovy_A_120 50S ribosomal protein L18; ribosome; NMR {Geobacil 97.16
3i1n_O_117 50S ribosomal protein L18; ribosome structure, pro 97.01
3bbo_Q_161 Ribosomal protein L18; large ribosomal subunit, sp 96.55
2j01_S_112 50S ribosomal protein L18; ribosome, tRNA, paromom 96.4
2zjr_L_23-11492 50S ribosomal protein L18; ribosome, large ribosom 96.18
3jyw_E_237 60S ribosomal protein L5; eukaryotic ribosome, RAC 94.14
>3i1m_K (K:) 30S ribosomal protein S11; ribosome structure, protein-RNA complex, ribonucleoprotein, ribosomal protein, RNA-binding, rRNA-binding, antibiotic resistance; 3.19A {Escherichia coli k-12} PDB: 1vs7_K* 3e1a_C 3e1c_C 1vs5_K 3i1o_K 3i1q_K 3i1s_K 3i1z_K 3i21_K 2qal_K* 1p6g_K 1p87_K 2aw7_K 2avy_K 2i2u_K 2i2p_K* 2qan_K* 2qb9_K* 2qbb_K* 2qbd_K ... Back     alignment and structure
Probab=100.00  E-value=0  Score=310.92  Aligned_cols=129  Identities=52%  Similarity=0.897  Sum_probs=128.0

Q ss_pred             CCCCCCCCCCCEEEECCCEEEEEEECCCCEEEEEECCCCCEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCC
Q ss_conf             98876443343001225218999917987799997089988997404443557754335203789999999999986981
Q gi|254780238|r    1 MPKSPSRIRNRERKNIVSGRAHVVSTFNNTRITITDPHGNTIAWSSPKVVGFSGSRKNSPFAAQVATDDCSAKAQNHGMS   80 (129)
Q Consensus         1 m~~~~~~~~~k~~~~i~~GiihI~~t~NNTiitlTd~~Gn~i~~~S~G~~gfkg~kk~t~~Aa~~~a~~~~~~~~~~gi~   80 (129)
                      |+++..+++++++++++.|++||++|+|||||||||++|++++|+|+|++||||++|+|+|||+++++.++++++++||+
T Consensus         1 ma~~~~~~~~~~~~~~~~giihI~~s~NNT~vt~Td~~g~~~~~~S~G~~GfK~~rk~t~~Aa~~~a~~~~~~~~~~Gi~   80 (129)
T 3i1m_K            1 MAKAPIRARKRVRKQVSDGVAHIHASFNNTIVTITDRQGNALGWATAGGSGFRGSRKSTPFAAQVAAERCADAVKEYGIK   80 (129)
T ss_dssp             ------------CCCCSEEEEEEEECSSCEEEEEEETTCCCCEEEETGGGSCCGGGTTSHHHHHHHHHHHHTTTGGGCCC
T ss_pred             CCCCCCCCCCCCCCCCCCCEEEEEECCCCEEEEEECCCCCEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCE
T ss_conf             98887555454243156618999923787899998699998889843443226754443679999999999999982982


Q ss_pred             EEEEEEECCCCCHHHHHHHHHHCCCEEEEEEECCCCCCCCCCCCCCCCC
Q ss_conf             9999997799867888778763693699999638898888688886789
Q gi|254780238|r   81 SLEVKVSGLGAGRDSALRALRAIGFTIVSICDVTMIAHNGCRPRKRRRI  129 (129)
Q Consensus        81 ~v~v~ikG~G~GR~~~ik~l~~~glkI~~I~D~T~ip~nGcRp~K~RRi  129 (129)
                      .|+|+++|+|+||+++|++|..+||+|.+|.|+||+|||||||||+|||
T Consensus        81 ~v~v~~kG~G~gr~~ai~~l~~~glkI~~I~D~T~iphnGcRp~K~RRv  129 (129)
T 3i1m_K           81 NLEVMVKGPGPGRESTIRALNAAGFRITNITDVTPIPHNGCRPPKKRRV  129 (129)
T ss_dssp             EEEEEEESSSTTSSHHHHHHHTTTCCCCEEEBCCCCCSSCSCCCCCCCC
T ss_pred             EEEEEEECCCCCHHHHHHHHHCCCCEEEEEEECCCCCCCCCCCCCCCCC
T ss_conf             9999997977861777546524898898989899999999897989899



>2vqe_K (K:) 30S ribosomal protein S11, 30S ribosomal protein S6; tRNA-binding, rRNA-binding, metal-binding, zinc-finger, translation; HET: TM2 PAR; 2.5A {Thermus thermophilus} Back     alignment and structure
>3bbn_K (K:) Ribosomal protein S11; small ribosomal subunit, spinach chloroplast ribosome, ribonucleoprotein particle, macromolecular complex; 9.40A {Spinacea oleracea} Back     alignment and structure
>1s1h_K (K:) RP59A, 40S ribosomal protein S14-A; 80S ribosome, 40S ribosomal subunit, EEF2, tRNA translocation, sordarin, cryo-EM; 11.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2zkq_k (k:) 40S ribosomal protein S14E; protein-RNA complex, 40S ribosomal subunit, ribosomal protein/RNA complex; 8.70A {Canis familiaris} Back     alignment and structure
>1vq8_N (N:) 50S ribosomal protein L18P; ribosome 50S, protein-protein complex, RNA-RNA complex, protein-RNA complex, peptidyl transferase reaction; HET: 1MA OMU OMG UR3 PSU SPS; 2.20A {Haloarcula marismortui} Back     alignment and structure
>1ovy_A (A:) 50S ribosomal protein L18; ribosome; NMR {Geobacillus stearothermophilus} Back     alignment and structure
>3i1n_O (O:) 50S ribosomal protein L18; ribosome structure, protein-RNA complex, acetylation, ribonucleoprotein, ribosomal protein, RNA-binding, rRNA- binding, methylation; 3.19A {Escherichia coli k-12} PDB: 1p85_M 1p86_M 1vs8_O 2aw4_O 2awb_O 1vs6_O 2i2v_O 2j28_O 2i2t_O* 2qao_O* 2qba_O* 2qbc_O* 2qbe_O 2qbg_O 2qbi_O* 2qbk_O* 2qov_O 2qox_O 2qoz_O* 2qp1_O* ... Back     alignment and structure
>3bbo_Q (Q:) Ribosomal protein L18; large ribosomal subunit, spinach chloroplast ribosome, ribonucleoprotein particle, macromolecular complex; 9.40A {Vitis vinifera} Back     alignment and structure
>2j01_S (S:) 50S ribosomal protein L18; ribosome, tRNA, paromomycin, mRNA, translation; 2.8A {Thermus thermophilus} Back     alignment and structure
>2zjr_L (L:23-114) 50S ribosomal protein L18; ribosome, large ribosomal subunit, ribonucleoprotein, RNA-binding, rRNA-binding, tRNA-binding, methylation; 2.91A {Deinococcus radiodurans} Back     alignment and structure
>3jyw_E (E:) 60S ribosomal protein L5; eukaryotic ribosome, RACK1 protein, flexible fitting; 8.90A {Thermomyces lanuginosus} PDB: 1s1i_E Back     alignment and structure