254780262

254780262

30S ribosomal protein S10

GeneID in NCBI database:8209243Locus tag:CLIBASIA_00735
Protein GI in NCBI database:254780262Protein Accession:YP_003064675.1
Gene range:-(143076, 143390)Protein Length:104aa
Gene description:30S ribosomal protein S10
COG prediction:[J] Ribosomal protein S10
KEGG prediction:rpsJ; 30S ribosomal protein S10; K02946 small subunit ribosomal protein S10
SEED prediction:SSU ribosomal protein S10p (S20e)
Pathway involved in KEGG:Ribosome [PATH:las03010]
Subsystem involved in SEED:Ribosome SSU bacterial
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100----
MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL
cccccEEEEEEEEEEcHHHHHHHHHHHHHHHHHcccEEEccccccccEEEEEEEcccccccccHHHHHHEEEEEEEEEEcccHHHHHHHHccccccccEEEEEc
cccccccEEEEEEccccccccccHHHHHHHHHccccEEcccccccccEEEEEEEEccccccccHHHHHHHHHHHHHHccccccccHHHHHHccccccccEEEEc
MTSRNIRICICLKAFDSRILDSSMREIVLTTKksgsqivgpipfprsirrftvnrsphvdkksrdQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL
mtsrniriciclkafdsrildSSMREIVLttkksgsqivgpipfprsirrftvnrsphvdkksrdqlEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL
MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL
*****IR**ICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL
MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL
****NIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL
MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL
MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target104 30S ribosomal protein S10 [Candidatus Liberibacter asia
315122819104 30S ribosomal protein S10 [Candidatus Liberibacter sola 1 2e-42
90424938102 30S ribosomal protein S10 [Rhodopseudomonas palustris B 1 3e-34
299135258110 ribosomal protein S10 [Afipia sp. 1NLS2] Length = 110 1 3e-34
170738704102 30S ribosomal protein S10 [Methylobacterium sp. 4-46] L 1 4e-34
298291437102 ribosomal protein S10 [Starkeya novella DSM 506] Length 1 4e-34
154245622102 ribosomal protein S10 [Xanthobacter autotrophicus Py2] 1 4e-34
27380512102 30S ribosomal protein S10 [Bradyrhizobium japonicum USD 1 5e-34
209884812102 ribosomal protein S10 [Oligotropha carboxidovorans OM5] 1 7e-34
159184986102 30S ribosomal protein S10 [Agrobacterium tumefaciens st 1 9e-34
300022540102 ribosomal protein S10 [Hyphomicrobium denitrificans ATC 1 1e-33
>gi|315122819|ref|YP_004063308.1| 30S ribosomal protein S10 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 104 Back     alignment and organism information
 Score =  175 bits (444), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 89/104 (85%), Positives = 96/104 (92%)

Query: 1   MTSRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVD 60
           MTS+NIRI I LKAFDS ILD+S+REIV T KKSGS+IVGPIPFPRSIRRFTVNRSPHVD
Sbjct: 1   MTSQNIRIRISLKAFDSWILDASVREIVSTAKKSGSRIVGPIPFPRSIRRFTVNRSPHVD 60

Query: 61  KKSRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           KKSRDQLE+RI+KRLLYIIKPT  TV ALMKLDIAAGV+VVIKL
Sbjct: 61  KKSRDQLEIRIHKRLLYIIKPTQDTVAALMKLDIAAGVSVVIKL 104


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|90424938|ref|YP_533308.1| 30S ribosomal protein S10 [Rhodopseudomonas palustris BisB18] Length = 102 Back     alignment and organism information
>gi|299135258|ref|ZP_07028449.1| ribosomal protein S10 [Afipia sp. 1NLS2] Length = 110 Back     alignment and organism information
>gi|170738704|ref|YP_001767359.1| 30S ribosomal protein S10 [Methylobacterium sp. 4-46] Length = 102 Back     alignment and organism information
>gi|298291437|ref|YP_003693376.1| ribosomal protein S10 [Starkeya novella DSM 506] Length = 102 Back     alignment and organism information
>gi|154245622|ref|YP_001416580.1| ribosomal protein S10 [Xanthobacter autotrophicus Py2] Length = 102 Back     alignment and organism information
>gi|27380512|ref|NP_772041.1| 30S ribosomal protein S10 [Bradyrhizobium japonicum USDA 110] Length = 102 Back     alignment and organism information
>gi|209884812|ref|YP_002288669.1| ribosomal protein S10 [Oligotropha carboxidovorans OM5] Length = 102 Back     alignment and organism information
>gi|159184986|ref|NP_529842.1| 30S ribosomal protein S10 [Agrobacterium tumefaciens str. C58] Length = 102 Back     alignment and organism information
>gi|300022540|ref|YP_003755151.1| ribosomal protein S10 [Hyphomicrobium denitrificans ATCC 51888] Length = 102 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target104 30S ribosomal protein S10 [Candidatus Liberibacter asia
PRK00596102 PRK00596, rpsJ, 30S ribosomal protein S10; Reviewed 5e-39
TIGR0104999 TIGR01049, rpsJ_bact, ribosomal protein S10, bacterial/ 2e-30
COG0051104 COG0051, RpsJ, Ribosomal protein S10 [Translation, ribo 2e-27
CHL00135101 CHL00135, rps10, ribosomal protein S10; Validated 4e-23
KOG3321175 KOG3321, KOG3321, KOG3321, Mitochondrial ribosomal prot 9e-11
KOG0900121 KOG0900, KOG0900, KOG0900, 40S ribosomal protein S20 [T 2e-08
PRK12271102 PRK12271, rps10p, 30S ribosomal protein S10P; Reviewed 4e-07
TIGR0104699 TIGR01046, S10_Arc_S20_Euk, ribosomal protein S10(archa 5e-07
PTZ00039115 PTZ00039, PTZ00039, 40S ribosomal protein S20; Provisio 5e-04
pfam0033897 pfam00338, Ribosomal_S10, Ribosomal protein S10p/S20e 1e-28
>gnl|CDD|179076 PRK00596, rpsJ, 30S ribosomal protein S10; Reviewed Back     alignment and domain information
>gnl|CDD|130121 TIGR01049, rpsJ_bact, ribosomal protein S10, bacterial/organelle Back     alignment and domain information
>gnl|CDD|30400 COG0051, RpsJ, Ribosomal protein S10 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|177057 CHL00135, rps10, ribosomal protein S10; Validated Back     alignment and domain information
>gnl|CDD|38531 KOG3321, KOG3321, KOG3321, Mitochondrial ribosomal protein S10 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|36118 KOG0900, KOG0900, KOG0900, 40S ribosomal protein S20 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|183392 PRK12271, rps10p, 30S ribosomal protein S10P; Reviewed Back     alignment and domain information
>gnl|CDD|130118 TIGR01046, S10_Arc_S20_Euk, ribosomal protein S10(archaeal)/S20(eukaryotic) Back     alignment and domain information
>gnl|CDD|173336 PTZ00039, PTZ00039, 40S ribosomal protein S20; Provisional Back     alignment and domain information
>gnl|CDD|144070 pfam00338, Ribosomal_S10, Ribosomal protein S10p/S20e Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 104 30S ribosomal protein S10 [Candidatus Liberibacter asia
TIGR0104999 rpsJ_bact ribosomal protein S10; InterPro: IPR005731 Ri 100.0
CHL00135106 rps10 ribosomal protein S10; Validated 100.0
PRK00596102 rpsJ 30S ribosomal protein S10; Reviewed 100.0
COG0051104 RpsJ Ribosomal protein S10 [Translation, ribosomal stru 100.0
PTZ00039115 40S ribosomal protein S20; Provisional 100.0
PRK12271102 rps10p 30S ribosomal protein S10P; Reviewed 100.0
pfam0033897 Ribosomal_S10 Ribosomal protein S10p/S20e. This family 100.0
TIGR0104699 S10_Arc_S20_Euk ribosomal protein S10; InterPro: IPR005 99.97
KOG3321175 consensus 99.94
KOG0900121 consensus 99.79
KOG4060176 consensus 98.47
>TIGR01049 rpsJ_bact ribosomal protein S10; InterPro: IPR005731 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>CHL00135 rps10 ribosomal protein S10; Validated Back     alignment and domain information
>PRK00596 rpsJ 30S ribosomal protein S10; Reviewed Back     alignment and domain information
>COG0051 RpsJ Ribosomal protein S10 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PTZ00039 40S ribosomal protein S20; Provisional Back     alignment and domain information
>PRK12271 rps10p 30S ribosomal protein S10P; Reviewed Back     alignment and domain information
>pfam00338 Ribosomal_S10 Ribosomal protein S10p/S20e Back     alignment and domain information
>TIGR01046 S10_Arc_S20_Euk ribosomal protein S10; InterPro: IPR005729 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>KOG3321 consensus Back     alignment and domain information
>KOG0900 consensus Back     alignment and domain information
>KOG4060 consensus Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target104 30S ribosomal protein S10 [Candidatus Liberibacter asia
1p6g_J103 Real Space Refined Coordinates Of The 30s Subunit F 2e-36
3bbn_J197 Homology Model For The Spinach Chloroplast 30s Subu 3e-36
3fih_J98 Ternary Complex-Bound E.Coli 70s Ribosome. This Ent 5e-34
2gy9_J96 Structure Of The 30s Subunit Of A Pre-Translocation 2e-33
1i94_J104 Crystal Structures Of The Small Ribosomal Subunit W 1e-32
1fjg_J105 Structure Of The Thermus Thermophilus 30s Ribosomal 1e-32
3fic_J99 T. Thermophilus 70s Ribosome In Complex With Mrna, 1e-31
1pns_J98 Crystal Structure Of A Streptomycin Dependent Ribos 1e-31
3d3b_J87 Structural And Functional Analysis Of The E. Coli N 3e-25
3d3c_J87 Structural And Functional Analysis Of The E. Coli N 1e-24
2zkq_j119 Structure Of A Mammalian Ribosomal 40s Subunit With 2e-22
3iz6_J128 Localization Of The Small Subunit Ribosomal Protein 2e-21
1s1h_J100 Structure Of The Ribosomal 80s-Eef2-Sordarin Comple 5e-17
3jyv_J96 Structure Of The 40s Rrna And Proteins And PE TRNA 1e-16
3izb_J121 Localization Of The Small Subunit Ribosomal Protein 4e-16
2xzm_J120 Crystal Structure Of The Eukaryotic 40s Ribosomal S 4e-16
gi|33357887|pdb|1P6G|J Chain J, Real Space Refined Coordinates Of The 30s Subunit Fitted Into The Low Resolution Cryo-Em Map Of The Ef-G.Gtp State Of E. Coli 70s Ribosome Length = 103 Back     alignment and structure
 Score =  155 bits (392), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 57/102 (55%), Positives = 76/102 (74%)

Query: 3   SRNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKK 62
            +N RI I LKAFD R++D +  EIV T K++G+Q+ GPIP P    RFTV  SPHV+K 
Sbjct: 1   MQNQRIRIRLKAFDHRLIDQATAEIVETAKRTGAQVRGPIPLPTRKERFTVLISPHVNKD 60

Query: 63  SRDQLEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
           +RDQ E+R + RL+ I++PT +TVDALM+LD+AAGV+V I L
Sbjct: 61  ARDQYEIRTHLRLVDIVEPTEKTVDALMRLDLAAGVDVQISL 102


gi|188036211|pdb|3BBN|J Chain J, Homology Model For The Spinach Chloroplast 30s Subunit Fitted To 9.4a Cryo-Em Map Of The 70s Chlororibosome. Length = 197 Back     alignment and structure
>gi|224510711|pdb|3FIH|J Chain J, Ternary Complex-Bound E.Coli 70s Ribosome. This Entry Consists Of The 30s Subunit, Trnas And The Ternary Complex. Length = 98 Back     alignment and structure
>gi|116667419|pdb|2GY9|J Chain J, Structure Of The 30s Subunit Of A Pre-Translocational E. Coli Ribosome Obtained By Fitting Atomic Models For Rna And Protein Components Into Cryo-Em Map Emd-1056 Length = 96 Back     alignment and structure
>gi|14278539|pdb|1I94|J Chain J, Crystal Structures Of The Small Ribosomal Subunit With Tetracycline, Edeine And If3 Length = 104 Back     alignment and structure
gi|10835594|pdb|1FJG|J Chain J, Structure Of The Thermus Thermophilus 30s Ribosomal Subunit In Complex With The Antibiotics Streptomycin, Spectinomycin, And Paromomycin Length = 105 Back     alignment and structure
>gi|224510700|pdb|3FIC|J Chain J, T. Thermophilus 70s Ribosome In Complex With Mrna, Trnas And Ef-Tu.Gdp.Kirromycin Ternary Complex, Fitted To A 6.4 A Cryo-Em Map. This File Contains The 30s Subunit And The Ligands Length = 99 Back     alignment and structure
>gi|34811538|pdb|1PNS|J Chain J, Crystal Structure Of A Streptomycin Dependent Ribosome From E. Coli, 30s Subunit Of 70s Ribosome. This File, 1pns, Contains The 30s Subunit, Two Trnas, And One Mrna Molecule. The 50s Ribosomal Subunit Is In File 1pnu. Length = 98 Back     alignment and structure
>gi|220702383|pdb|3D3B|J Chain J, Structural And Functional Analysis Of The E. Coli Nusb-S10 Transcription Antitermination Complex. Length = 87 Back     alignment and structure
>gi|220702385|pdb|3D3C|J Chain J, Structural And Functional Analysis Of The E. Coli Nusb-S10 Transcription Antitermination Complex. Length = 87 Back     alignment and structure
gi|187609263|pdb|2ZKQ|JJ Chain j, Structure Of A Mammalian Ribosomal 40s Subunit Within An 80s Complex Obtained By Docking Homology Models Of The Rna And Proteins Into An 8.7 A Cryo-Em Map Length = 119 Back     alignment and structure
gi|313103635|pdb|3IZ6|J Chain J, Localization Of The Small Subunit Ribosomal Proteins Into A 5.5 A Cryo-Em Map Of Triticum Aestivum Translating 80s Ribosome Length = 128 Back     alignment and structure
>gi|49258829|pdb|1S1H|J Chain J, Structure Of The Ribosomal 80s-Eef2-Sordarin Complex From Yeast Obtained By Docking Atomic Models For Rna And Protein Components Into A 11.7 A Cryo-Em Map. This File, 1s1h, Contains 40s Subunit. The 60s Ribosomal Subunit Is In File 1s1i Length = 100 Back     alignment and structure
>gi|281500815|pdb|3JYV|J Chain J, Structure Of The 40s Rrna And Proteins And PE TRNA FOR EUKARYOTIC Ribosome Based On Cryo-Em Map Of Thermomyces Lanuginosus Ribosome At 8.9a Resolution Length = 96 Back     alignment and structure
gi|313103673|pdb|3IZB|J Chain J, Localization Of The Small Subunit Ribosomal Proteins Into A 6.1 A Cryo-Em Map Of Saccharomyces Cerevisiae Translating 80s Ribosome Length = 121 Back     alignment and structure
gi|319443365|pdb|2XZM|J Chain J, Crystal Structure Of The Eukaryotic 40s Ribosomal Subunit In Complex With Initiation Factor 1. This File Contains The 40s Subunit And Initiation Factor For Molecule 1 Length = 120 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target104 30S ribosomal protein S10 [Candidatus Liberibacter asia
3bbn_J197 Ribosomal protein S10; small ribosomal subunit, spinach 8e-31
3i1m_J103 30S ribosomal protein S10; ribosome structure, protein- 7e-30
3ofo_J98 30S ribosomal protein S10; protein biosynthesis, riboso 2e-28
2vqe_J105 30S ribosomal protein S10, 30S ribosomal protein S6; tR 6e-28
3jyv_J96 40S ribosomal protein S20; eukaryotic ribosome, RACK1 p 7e-24
2zkq_j119 40S ribosomal protein S20E; protein-RNA complex, 40S ri 8e-23
3d3b_J87 30S ribosomal protein S10, N utilization substance prot 3e-19
3d3c_J87 30S ribosomal protein S10, N utilization substance prot 4e-19
>3bbn_J Ribosomal protein S10; small ribosomal subunit, spinach chloroplast ribosome, ribonucleoprotein particle, macromolecular complex; 9.40A {Mesembryanthemum crystallinum} SCOP: i.1.1.1 Length = 197 Back     alignment and structure
 Score =  126 bits (319), Expect = 8e-31
 Identities = 38/98 (38%), Positives = 67/98 (68%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           +I I L+++   +++ S ++I+   + + ++ +GP+P P   R F V +SPHV K +R  
Sbjct: 100 KIRIKLRSYWVPLIEDSCKQIMDAARTTNAKTMGPVPLPTKKRIFCVLKSPHVHKDARFH 159

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            E+R ++RL+ I+ PT QT+D+LM+LD+ AGV+V +KL
Sbjct: 160 FEIRTHQRLIDILYPTAQTIDSLMQLDLPAGVDVEVKL 197


>3i1m_J 30S ribosomal protein S10; ribosome structure, protein-RNA complex, ribonucleoprotein, ribosomal protein, RNA-binding, rRNA-binding, antibiotic resistance; 3.19A {Escherichia coli k-12} PDB: 1p6g_J 1p87_J* 1vs7_J* 2avy_J 2aw7_J 1vs5_J 2i2u_J 2i2p_J* 2qan_J* 2qb9_J* 2qbb_J* 2qbd_J 2qbf_J 2qbh_J* 2qbj_J* 2qou_J* 2qow_J* 2qoy_J* 2qp0_J* 2vho_J ... Length = 103 Back     alignment and structure
>3ofo_J 30S ribosomal protein S10; protein biosynthesis, ribosomes, RNA, tRNA, transfer, eryThr ketolide, macrolide, antibiotic, EXIT, peptidyl; 3.10A {Escherichia coli} PDB: 3fih_J* 2wwl_J 3ofp_J 3i1m_J 1p6g_J 1p87_J* 1vs7_J* 2avy_J 2aw7_J 1vs5_J 2i2u_J 2i2p_J* 2qan_J* 2qb9_J* 2qbb_J* 2qbd_J 2qbf_J 2qbh_J* 2qbj_J* 2qou_J* ... Length = 98 Back     alignment and structure
>2vqe_J 30S ribosomal protein S10, 30S ribosomal protein S6; tRNA-binding, rRNA-binding, metal-binding, zinc-finger, translation; HET: TM2 PAR; 2.5A {Thermus thermophilus} SCOP: d.58.15.1 PDB: 1gix_M* 1hnw_J* 1hnx_J* 1hnz_J* 1hr0_J 1ibk_J* 1ibl_J* 1ibm_J 1jgo_M* 1jgp_M* 1jgq_M* 1ml5_M* 1xmo_J* 1xmq_J* 1xnq_J* 1xnr_J* 1yl4_M 2b64_J* 2b9m_J* 2b9o_J* ... Length = 105 Back     alignment and structure
>3jyv_J 40S ribosomal protein S20; eukaryotic ribosome, RACK1 protein, flexible fitting; HET: 2MG H2U M2G OMC OMG YYG PSU 5MC 7MG 5MU 1MA; 8.90A {Thermomyces lanuginosus} PDB: 1s1h_J Length = 96 Back     alignment and structure
>2zkq_j 40S ribosomal protein S20E; protein-RNA complex, 40S ribosomal subunit, ribosomal protein/RNA complex; 8.70A {Canis familiaris} Length = 119 Back     alignment and structure
>3d3b_J 30S ribosomal protein S10, N utilization substance protein B; NUSB, NUSE, NUT site, phage lambda, lambdan antitermination; HET: NHE; 1.30A {Escherichia coli K12} PDB: 3imq_J 3d3c_J Length = 87 Back     alignment and structure
>3d3c_J 30S ribosomal protein S10, N utilization substance protein B; NUSB, NUSE, phage lambda, lambda N antitermination, RRN antitermination; 2.60A {Escherichia coli K12} PDB: 2kvq_E 3d3b_J* 3imq_J Length = 87 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target104 30S ribosomal protein S10 [Candidatus Liberibacter asia
3bbn_J197 Ribosomal protein S10; small ribosomal subunit, spinach 100.0
3ofo_J98 30S ribosomal protein S10; protein biosynthesis, riboso 100.0
2zkq_j119 40S ribosomal protein S20E; protein-RNA complex, 40S ri 100.0
2vqe_J105 30S ribosomal protein S10, 30S ribosomal protein S6; tR 100.0
3jyv_J96 40S ribosomal protein S20; eukaryotic ribosome, RACK1 p 100.0
3d3c_J87 30S ribosomal protein S10, N utilization substance prot 99.94
>3bbn_J Ribosomal protein S10; small ribosomal subunit, spinach chloroplast ribosome, ribonucleoprotein particle, macromolecular complex; 9.40A {Mesembryanthemum crystallinum} SCOP: i.1.1.1 Back     alignment and structure
Probab=100.00  E-value=2.4e-40  Score=255.03  Aligned_cols=101  Identities=38%  Similarity=0.669  Sum_probs=98.7

Q ss_pred             CCEEEEEEEEEECHHHHHHHHHHHHHHHHHHCCEECCCCCCCCEEEEEEEECCCCCCCCCHHHHHEEEEEEEEEEECCCH
Q ss_conf             86489999997168899999999999999718801156489821369987306789863142352233445787976998
Q gi|254780262|r    4 RNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQLEMRIYKRLLYIIKPTP   83 (104)
Q Consensus         4 ~~~kirIkl~s~d~~~Ld~~~~~i~~~a~~~g~~v~GpipLPtk~~~~tvlrSPhv~KksreqfE~r~hkRlI~i~~~~~   83 (104)
                      -+|||||+|+|||+++||.+|++|+++|+++|++++||+|||||+++|||+||||+||+||||||||+|||+|+|+++++
T Consensus        97 ~~qkiRIkL~S~D~~~Ld~~~~~I~~~ak~tg~~v~GPIpLPTK~~~~tvlRSPhv~KkSrEqFE~RtHKRlIdI~~~~~  176 (197)
T 3bbn_J           97 PKQKIRIKLRSYWVPLIEDSCKQIMDAARTTNAKTMGPVPLPTKKRIFCVLKSPHVHKDARFHFEIRTHQRLIDILYPTA  176 (197)
T ss_dssp             --CCSEEEEEESCHHHHHHHTTHHHHTTTTTSSCEEEEEECCCEEEEECCCCSSSSCCSSCCCEEEEEEEEEEEESSCCH
T ss_pred             CCCEEEEEEEECCHHHHHHHHHHHHHHHHHCCCEEECCCCCCCEEEEEEEEECCCCCCCCHHEEEEEEEEEEEEEECCCH
T ss_conf             64459999996778899999999999999829935588779953578876206878997311369998889999848998


Q ss_pred             HHHHHHHCCCCCCCCEEEEEC
Q ss_conf             999998647899984589989
Q gi|254780262|r   84 QTVDALMKLDIAAGVNVVIKL  104 (104)
Q Consensus        84 ~~~~~l~~~~lp~gV~i~i~~  104 (104)
                      ++++.||++++|+||+|+|+|
T Consensus       177 ~ti~~L~~l~lP~GV~IeIkv  197 (197)
T 3bbn_J          177 QTIDSLMQLDLPAGVDVEVKL  197 (197)
T ss_dssp             HHHHHHTTCCCCSSCEEEEEC
T ss_pred             HHHHHHHCCCCCCCCEEEEEC
T ss_conf             999998678899995699969



>3ofo_J 30S ribosomal protein S10; protein biosynthesis, ribosomes, RNA, tRNA, transfer, eryThr ketolide, macrolide, antibiotic, EXIT, peptidyl; 3.10A {Escherichia coli} PDB: 3fih_J* 2wwl_J 3ofp_J 3i1m_J 1p6g_J 1p87_J* 1vs7_J* 2avy_J 2aw7_J 1vs5_J 2i2u_J 2i2p_J* 2qan_J* 2qb9_J* 2qbb_J* 2qbd_J 2qbf_J 2qbh_J* 2qbj_J* 2qou_J* ... Back     alignment and structure
>2zkq_j 40S ribosomal protein S20E; protein-RNA complex, 40S ribosomal subunit, ribosomal protein/RNA complex; 8.70A {Canis familiaris} Back     alignment and structure
>2vqe_J 30S ribosomal protein S10, 30S ribosomal protein S6; tRNA-binding, rRNA-binding, metal-binding, zinc-finger, translation; HET: TM2 PAR; 2.5A {Thermus thermophilus} SCOP: d.58.15.1 PDB: 1gix_M* 1hnw_J* 1hnx_J* 1hnz_J* 1hr0_J 1ibk_J* 1ibl_J* 1ibm_J 1jgo_M* 1jgp_M* 1jgq_M* 1ml5_M* 1xmo_J* 1xmq_J* 1xnq_J* 1xnr_J* 1yl4_M 2b64_J* 2b9m_J* 2b9o_J* ... Back     alignment and structure
>3jyv_J 40S ribosomal protein S20; eukaryotic ribosome, RACK1 protein, flexible fitting; HET: 2MG H2U M2G OMC OMG YYG PSU 5MC 7MG 5MU 1MA; 8.90A {Thermomyces lanuginosus} PDB: 1s1h_J Back     alignment and structure
>3d3c_J 30S ribosomal protein S10, N utilization substance protein B; NUSB, NUSE, phage lambda, lambda N antitermination, RRN antitermination; 2.60A {Escherichia coli K12} PDB: 2kvq_E 3d3b_J* 3imq_J Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 104 30S ribosomal protein S10 [Candidatus Liberibacter asia
d2qalj198 d.58.15.1 (J:5-102) Ribosomal protein S10 {Escherichia 7e-30
d2uubj198 d.58.15.1 (J:3-100) Ribosomal protein S10 {Thermus ther 7e-30
>d2qalj1 d.58.15.1 (J:5-102) Ribosomal protein S10 {Escherichia coli [TaxId: 562]} Length = 98 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: Ribosomal protein S10
family: Ribosomal protein S10
domain: Ribosomal protein S10
species: Escherichia coli [TaxId: 562]
 Score =  122 bits (309), Expect = 7e-30
 Identities = 56/98 (57%), Positives = 74/98 (75%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           RI I LKAFD R++D +  EIV T K++G+Q+ GPIP P    RFTV  SPHV+K +RDQ
Sbjct: 1   RIRIRLKAFDHRLIDQATAEIVETAKRTGAQVRGPIPLPTRKERFTVLISPHVNKDARDQ 60

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            E+R + RL+ I++PT +TVDALM+LD+AAGV+V I L
Sbjct: 61  YEIRTHLRLVDIVEPTEKTVDALMRLDLAAGVDVQISL 98


>d2uubj1 d.58.15.1 (J:3-100) Ribosomal protein S10 {Thermus thermophilus [TaxId: 274]} Length = 98 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target104 30S ribosomal protein S10 [Candidatus Liberibacter asia
d2qalj198 Ribosomal protein S10 {Escherichia coli [TaxId: 562]} 100.0
d2uubj198 Ribosomal protein S10 {Thermus thermophilus [TaxId: 274 100.0
>d2qalj1 d.58.15.1 (J:5-102) Ribosomal protein S10 {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: Ribosomal protein S10
family: Ribosomal protein S10
domain: Ribosomal protein S10
species: Escherichia coli [TaxId: 562]
Probab=100.00  E-value=2.4e-39  Score=247.82  Aligned_cols=98  Identities=57%  Similarity=0.863  Sum_probs=96.6

Q ss_pred             EEEEEEEEECHHHHHHHHHHHHHHHHHHCCEECCCCCCCCEEEEEEEECCCCCCCCCHHHHHEEEEEEEEEEECCCHHHH
Q ss_conf             89999997168899999999999999718801156489821369987306789863142352233445787976998999
Q gi|254780262|r    7 RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQLEMRIYKRLLYIIKPTPQTV   86 (104)
Q Consensus         7 kirIkl~s~d~~~Ld~~~~~i~~~a~~~g~~v~GpipLPtk~~~~tvlrSPhv~KksreqfE~r~hkRlI~i~~~~~~~~   86 (104)
                      ||||+|+|||+++||++|++|+++|+.+|++++||+||||++++|||+||||++|+||||||||+|||+|+|++++++++
T Consensus         1 kirI~L~s~d~~~Ld~~~~~i~~~a~~~g~~v~GPiplPtk~~~~tvlrSPh~~kksreqfE~r~hkRli~i~~~~~~~~   80 (98)
T d2qalj1           1 RIRIRLKAFDHRLIDQATAEIVETAKRTGAQVRGPIPLPTRKERFTVLISPHVNKDARDQYEIRTHLRLVDIVEPTEKTV   80 (98)
T ss_dssp             CBEECEEESSHHHHHHHHHHHHHHHTTSSCCCCBCCCCCCEEEEEEECCSSSSCTTCCEEEEEEEEEECBCBSSCCHHHH
T ss_pred             CEEEEEEEECHHHHHHHHHHHHHHHHHCCCEEECCCCCCCEEEEEEEEECCCCCCCHHHHEEEEEEEEEEEEECCCHHHH
T ss_conf             98999996068899999999999999819917888789958889999856999995166116015389999988998999


Q ss_pred             HHHHCCCCCCCCEEEEEC
Q ss_conf             998647899984589989
Q gi|254780262|r   87 DALMKLDIAAGVNVVIKL  104 (104)
Q Consensus        87 ~~l~~~~lp~gV~i~i~~  104 (104)
                      ++||++++|+||+|+|+|
T Consensus        81 ~~l~~~~lp~GV~i~i~l   98 (98)
T d2qalj1          81 DALMRLDLAAGVDVQISL   98 (98)
T ss_dssp             HHTTTSCCCSSCCCCEEC
T ss_pred             HHHHCCCCCCCCEEEEEC
T ss_conf             998668899981799979



>d2uubj1 d.58.15.1 (J:3-100) Ribosomal protein S10 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 104 30S ribosomal protein S10 [Candidatus Liberibacter
3i1m_J_103 (J:) 30S ribosomal protein S10; ribosome structure 6e-25
2vqe_J_105 (J:) 30S ribosomal protein S10, 30S ribosomal prot 8e-25
3bbn_J_197 (J:) Ribosomal protein S10; small ribosomal subuni 7e-24
2zkq_j_119 (j:) 40S ribosomal protein S20E; protein-RNA compl 2e-22
3jyv_J_96 (J:) 40S ribosomal protein S20; eukaryotic ribosom 8e-22
3d3b_J_87 (J:) 30S ribosomal protein S10, N utilization subs 1e-15
>3i1m_J (J:) 30S ribosomal protein S10; ribosome structure, protein-RNA complex, ribonucleoprotein, ribosomal protein, RNA-binding, rRNA-binding, antibiotic resistance; 3.19A {Escherichia coli k-12} PDB: 1p6g_J 1p87_J* 1vs7_J* 2avy_J 2aw7_J 1vs5_J 2i2u_J 2i2p_J* 2qan_J* 2qb9_J* 2qbb_J* 2qbd_J 2qbf_J 2qbh_J* 2qbj_J* 2qou_J* 2qow_J* 2qoy_J* 2qp0_J* 2vho_J ...Length = 103 Back     alignment and structure
 Score =  107 bits (269), Expect = 6e-25
 Identities = 56/98 (57%), Positives = 74/98 (75%)

Query: 7   RICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQ 66
           RI I LKAFD R++D +  EIV T K++G+Q+ GPIP P    RFTV  SPHV+K +RDQ
Sbjct: 5   RIRIRLKAFDHRLIDQATAEIVETAKRTGAQVRGPIPLPTRKERFTVLISPHVNKDARDQ 64

Query: 67  LEMRIYKRLLYIIKPTPQTVDALMKLDIAAGVNVVIKL 104
            E+R + RL+ I++PT +TVDALM+LD+AAGV+V I L
Sbjct: 65  YEIRTHLRLVDIVEPTEKTVDALMRLDLAAGVDVQISL 102


>2vqe_J (J:) 30S ribosomal protein S10, 30S ribosomal protein S6; tRNA-binding, rRNA-binding, metal-binding, zinc-finger, translation; HET: TM2 PAR; 2.5A {Thermus thermophilus}Length = 105 Back     alignment and structure
>3bbn_J (J:) Ribosomal protein S10; small ribosomal subunit, spinach chloroplast ribosome, ribonucleoprotein particle, macromolecular complex; 9.40A {Mesembryanthemum crystallinum}Length = 197 Back     alignment and structure
>2zkq_j (j:) 40S ribosomal protein S20E; protein-RNA complex, 40S ribosomal subunit, ribosomal protein/RNA complex; 8.70A {Canis familiaris}Length = 119 Back     alignment and structure
>3jyv_J (J:) 40S ribosomal protein S20; eukaryotic ribosome, RACK1 protein, flexible fitting; HET: 2MG H2U M2G OMC OMG YYG PSU 5MC 7MG 5MU 1MA; 8.90A {Thermomyces lanuginosus} PDB: 1s1h_JLength = 96 Back     alignment and structure
>3d3b_J (J:) 30S ribosomal protein S10, N utilization substance protein B; NUSB, NUSE, NUT site, phage lambda, lambdan antitermination; HET: NHE; 1.30A {Escherichia coli K12} PDB: 3imq_J 3d3c_JLength = 87 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target104 30S ribosomal protein S10 [Candidatus Liberibacter asia
3i1m_J_103 30S ribosomal protein S10; ribosome structure, pro 100.0
3bbn_J_197 Ribosomal protein S10; small ribosomal subunit, sp 100.0
2zkq_j_119 40S ribosomal protein S20E; protein-RNA complex, 4 99.98
2vqe_J_105 30S ribosomal protein S10, 30S ribosomal protein S 99.98
3jyv_J_96 40S ribosomal protein S20; eukaryotic ribosome, RA 99.97
3d3b_J_87 30S ribosomal protein S10, N utilization substance 99.92
>3i1m_J (J:) 30S ribosomal protein S10; ribosome structure, protein-RNA complex, ribonucleoprotein, ribosomal protein, RNA-binding, rRNA-binding, antibiotic resistance; 3.19A {Escherichia coli k-12} PDB: 1p6g_J 1p87_J* 1vs7_J* 2avy_J 2aw7_J 1vs5_J 2i2u_J 2i2p_J* 2qan_J* 2qb9_J* 2qbb_J* 2qbd_J 2qbf_J 2qbh_J* 2qbj_J* 2qou_J* 2qow_J* 2qoy_J* 2qp0_J* 2vho_J ... Back     alignment and structure
Probab=100.00  E-value=2.3e-35  Score=226.80  Aligned_cols=101  Identities=56%  Similarity=0.849  Sum_probs=98.7

Q ss_pred             CCEEEEEEEEEECHHHHHHHHHHHHHHHHHHCCEECCCCCCCCEEEEEEEECCCCCCCCCHHHHHEEEEEEEEEEECCCH
Q ss_conf             86489999997168899999999999999718801156489821369987306789863142352233445787976998
Q gi|254780262|r    4 RNIRICICLKAFDSRILDSSMREIVLTTKKSGSQIVGPIPFPRSIRRFTVNRSPHVDKKSRDQLEMRIYKRLLYIIKPTP   83 (104)
Q Consensus         4 ~~~kirIkl~s~d~~~Ld~~~~~i~~~a~~~g~~v~GpipLPtk~~~~tvlrSPhv~KksreqfE~r~hkRlI~i~~~~~   83 (104)
                      +.++|+|+|+|||+..||++|++|.++|+++|+.++||+||||++.+||++||||++||||||||+|+|+|+|+|+++++
T Consensus         2 ~~~~i~I~l~S~d~~~Le~~~~~i~~~a~~~~~~v~gp~~lPtk~~~~tvlrSphv~kksreqfe~r~~kR~i~i~~~~~   81 (103)
T 3i1m_J            2 QNQRIRIRLKAFDHRLIDQATAEIVETAKRTGAQVRGPIPLPTRKERFTVLISPHVNKDARDQYEIRTHLRLVDIVEPTE   81 (103)
T ss_dssp             ---CBCCEEEESCHHHHHHHHHHHHHHHHHHSCCCCCCCCCCCEEEEEEECCSSSSCTTCCEEEEEEEEEECCCBSCCCH
T ss_pred             CCCEEEEEEEECCHHHHHHHHHHHHHHHHHCCCEECCCCCCCCEEEEEEEEECCCCCCCHHHHHHHEEEEEEEEEECCCH
T ss_conf             97769999996378899999999999999839925167789848889999737889985789710515279999978998


Q ss_pred             HHHHHHHCCCCCCCCEEEEEC
Q ss_conf             999998647899984589989
Q gi|254780262|r   84 QTVDALMKLDIAAGVNVVIKL  104 (104)
Q Consensus        84 ~~~~~l~~~~lp~gV~i~i~~  104 (104)
                      ++++.|+++++|+||+|+|++
T Consensus        82 ~~~~~~l~~~~p~GV~i~v~v  102 (103)
T 3i1m_J           82 KTVDALMRLDLAAGVDVQISL  102 (103)
T ss_dssp             HHHHHHTTCCCCSSCEEECCC
T ss_pred             HHHHHHHCCCCCCCCEEEEEE
T ss_conf             999998678899994699997



>3bbn_J (J:) Ribosomal protein S10; small ribosomal subunit, spinach chloroplast ribosome, ribonucleoprotein particle, macromolecular complex; 9.40A {Mesembryanthemum crystallinum} Back     alignment and structure
>2zkq_j (j:) 40S ribosomal protein S20E; protein-RNA complex, 40S ribosomal subunit, ribosomal protein/RNA complex; 8.70A {Canis familiaris} Back     alignment and structure
>2vqe_J (J:) 30S ribosomal protein S10, 30S ribosomal protein S6; tRNA-binding, rRNA-binding, metal-binding, zinc-finger, translation; HET: TM2 PAR; 2.5A {Thermus thermophilus} Back     alignment and structure
>3jyv_J (J:) 40S ribosomal protein S20; eukaryotic ribosome, RACK1 protein, flexible fitting; HET: 2MG H2U M2G OMC OMG YYG PSU 5MC 7MG 5MU 1MA; 8.90A {Thermomyces lanuginosus} PDB: 1s1h_J Back     alignment and structure
>3d3b_J (J:) 30S ribosomal protein S10, N utilization substance protein B; NUSB, NUSE, NUT site, phage lambda, lambdan antitermination; HET: NHE; 1.30A {Escherichia coli K12} PDB: 3imq_J 3d3c_J Back     alignment and structure