254780265

254780265

30S ribosomal protein S7

GeneID in NCBI database:8209246Locus tag:CLIBASIA_00750
Protein GI in NCBI database:254780265Protein Accession:YP_003064678.1
Gene range:-(146876, 147346)Protein Length:156aa
Gene description:30S ribosomal protein S7
COG prediction:[J] Ribosomal protein S7
KEGG prediction:rpsG; 30S ribosomal protein S7; K02992 small subunit ribosomal protein S7
SEED prediction:SSU ribosomal protein S7p (S5e)
Pathway involved in KEGG:Ribosome [PATH:las03010]
Subsystem involved in SEED:Ribosome SSU bacterial
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150------
MSRRRRAVVREVLPDPKFSDFVVAKFMNAIMYGGKKSVAVSIVYGAFDLVEKKEKKDPVALFRQALINVTPQFEVRTRRVGGAAYSVPGEITSKRSQALAIRWLIMAARKRNETTMIDRLGGEIIDAANNRGVAVRKREETHKVAEANRAFSHYRW
ccccccccccccccccccccHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHcccHHHEEEEEEccccccccccccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHccccccEEHHHHHHHHHHHcHHHHHccc
cccccccccccccccccccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHccccEEEEEcccccccccEccEEccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHcccccEEEHHcHHHHHHHHHHHHHccc
msrrrravvrevlpdpkfsDFVVAKFMNAIMYGGKKSVAVSIVYGAFdlvekkekkdPVALFRQALInvtpqfevrtrrvggaaysvpgeitSKRSQALAIRWLIMAARKRNETTMIDRLGGEIIDAANNRGVAVRKREETHKVAEANRAFSHYRW
msrrrravvrevlpdpkfsdfVVAKFMNAIMYGGKKSVAVSIVYGAFDLVEKKEKKDPVALFRQALinvtpqfevrtrrvggaaysvpgeitskrsQALAIRWLIMAARKRNETTmidrlggeiidaannrgvavrkreethkvaeanrafshyrw
MSRRRRAVVREVLPDPKFSDFVVAKFMNAIMYGGKKSVAVSIVYGAFDLVEKKEKKDPVALFRQALINVTPQFEVRTRRVGGAAYSVPGEITSKRSQALAIRWLIMAARKRNETTMIDRLGGEIIDAANNRGVAVRKREETHKVAEANRAFSHYRW
**********EVLPDPKFSDFVVAKFMNAIMYGGKKSVAVSIVYGAFDLVEKKEKKDPVALFRQALINVTPQFEVRTRRVGGAAYSVPGEITSKRSQALAIRWLIMAARKRN**TMIDRLGGEIIDAANNRGVAVRKREETHKVAEANRAFSHYRW
********VREVLPDPKFSDFVVAKFMNAIMYGGKKSVAVSIVYGAFDLVEKKEKKDPVALFRQALINVTPQFEVRTRRVGGAAYSVPGEITSKRSQALAIRWLIMAARKRNETTMIDRLGGEIIDAANNRGVAVRKREETHKVAEANRAFSHYRW
*******VVREVLPDPKFSDFVVAKFMNAIMYGGKKSVAVSIVYGAFDLVEKKEKKDPVALFRQALINVTPQFEVRTRRVGGAAYSVPGEITSKRSQALAIRWLIMAARKRNETTMIDRLGGEIIDAANNRGVAVRKREETHKVAEANRAFSHYRW
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSRRRRAVVREVLPDPKFSDFVVAKFMNAIMYGGKKSVAVSIVYGAFDLVEKKEKKDPVALFRQALINVTPQFEVRTRRVGGAAYSVPGEITSKRSQALAIRWLIMAARKRNETTMIDRLGGEIIDAANNRGVAVRKREETHKVAEANRAFSHYRW
MSRRRRAVVREVLPDPKFSDFVVAKFMNAIMYGGKKSVAVSIVYGAFDLVEKKEKKDPVALFRQALINVTPQFEVRTRRVGGAAYSVPGEITSKRSQALAIRWLIMAARKRNETTMIDRLGGEIIDAANNRGVAVRKREETHKVAEANRAFSHYRW
MSRRRRAVVREVLPDPKFSDFVVAKFMNAIMYGGKKSVAVSIVYGAFDLVEKKEKKDPVALFRQALINVTPQFEVRTRRVGGAAYSVPGEITSKRSQALAIRWLIMAARKRNETTMIDRLGGEIIDAANNRGVAVRKREETHKVAEANRAFSHYRW

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target156 30S ribosomal protein S7 [Candidatus Liberibacter asiat
222148362156 30S ribosomal protein S7 [Agrobacterium vitis S4] Lengt 1 2e-60
90417767156 ribosomal protein S7 [Aurantimonas manganoxydans SI85-9 1 7e-60
328543354156 30S ribosomal protein S7 [polymorphum gilvum SL003B-26A 1 9e-60
153009282156 30S ribosomal protein S7 [Ochrobactrum anthropi ATCC 49 1 1e-59
15965105156 30S ribosomal protein S7 [Sinorhizobium meliloti 1021] 1 2e-59
319408769156 30S ribosomal protein S7 [Bartonella schoenbuchensis R1 1 2e-59
114704480156 30S ribosomal protein S7 [Fulvimarina pelagi HTCC2506] 1 2e-59
239832126156 ribosomal protein S7 [Ochrobactrum intermedium LMG 3301 1 3e-59
13470548156 30S ribosomal protein S7 [Mesorhizobium loti MAFF303099 1 3e-59
118591188156 30S ribosomal protein S7 [Stappia aggregata IAM 12614] 1 4e-59
>gi|222148362|ref|YP_002549319.1| 30S ribosomal protein S7 [Agrobacterium vitis S4] Length = 156 Back     alignment and organism information
 Score =  235 bits (599), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 111/156 (71%), Positives = 130/156 (83%)

Query: 1   MSRRRRAVVREVLPDPKFSDFVVAKFMNAIMYGGKKSVAVSIVYGAFDLVEKKEKKDPVA 60
           MSRR +A  RE+ PDPKF D VV KFMNAIM  GKKSVA SIVYGAFD+VE K K +P+A
Sbjct: 1   MSRRHKAEKREINPDPKFGDLVVTKFMNAIMLHGKKSVAESIVYGAFDVVEAKSKAEPIA 60

Query: 61  LFRQALINVTPQFEVRTRRVGGAAYSVPGEITSKRSQALAIRWLIMAARKRNETTMIDRL 120
           +F QAL NV P  EVR+RRVGGA Y VP ++  +R QALAIRWLI+AARKRNETTM+DRL
Sbjct: 61  IFHQALENVAPHVEVRSRRVGGATYQVPVDVRPERRQALAIRWLIIAARKRNETTMVDRL 120

Query: 121 GGEIIDAANNRGVAVRKREETHKVAEANRAFSHYRW 156
            GE++DA+NNRG AV+KRE+THK+A+ANRAFSHYRW
Sbjct: 121 SGELLDASNNRGSAVKKREDTHKMADANRAFSHYRW 156


Species: Agrobacterium vitis
Genus: Agrobacterium
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|90417767|ref|ZP_01225679.1| ribosomal protein S7 [Aurantimonas manganoxydans SI85-9A1] Length = 156 Back     alignment and organism information
>gi|328543354|ref|YP_004303463.1| 30S ribosomal protein S7 [polymorphum gilvum SL003B-26A1] Length = 156 Back     alignment and organism information
>gi|153009282|ref|YP_001370497.1| 30S ribosomal protein S7 [Ochrobactrum anthropi ATCC 49188] Length = 156 Back     alignment and organism information
>gi|15965105|ref|NP_385458.1| 30S ribosomal protein S7 [Sinorhizobium meliloti 1021] Length = 156 Back     alignment and organism information
>gi|319408769|emb|CBI82426.1| 30S ribosomal protein S7 [Bartonella schoenbuchensis R1] Length = 156 Back     alignment and organism information
>gi|114704480|ref|ZP_01437388.1| 30S ribosomal protein S7 [Fulvimarina pelagi HTCC2506] Length = 156 Back     alignment and organism information
>gi|239832126|ref|ZP_04680455.1| ribosomal protein S7 [Ochrobactrum intermedium LMG 3301] Length = 156 Back     alignment and organism information
>gi|13470548|ref|NP_102116.1| 30S ribosomal protein S7 [Mesorhizobium loti MAFF303099] Length = 156 Back     alignment and organism information
>gi|118591188|ref|ZP_01548587.1| 30S ribosomal protein S7 [Stappia aggregata IAM 12614] Length = 156 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target156 30S ribosomal protein S7 [Candidatus Liberibacter asiat
PRK05302156 PRK05302, PRK05302, 30S ribosomal protein S7; Validated 7e-71
TIGR01029154 TIGR01029, rpsG_bact, ribosomal protein S7, bacterial/o 1e-55
CHL00053155 CHL00053, rps7, ribosomal protein S7 1e-49
COG0049148 COG0049, RpsG, Ribosomal protein S7 [Translation, ribos 6e-48
KOG3291208 KOG3291, KOG3291, KOG3291, Ribosomal protein S7 [Transl 3e-28
PRK04027195 PRK04027, PRK04027, 30S ribosomal protein S7P; Reviewed 1e-15
TIGR01028186 TIGR01028, S7_S5_E_A, ribosomal protein S7(archaeal)/S5 1e-14
PTZ00091193 PTZ00091, PTZ00091, 40S ribosomal protein S5; Provision 1e-08
pfam00177149 pfam00177, Ribosomal_S7, Ribosomal protein S7p/S5e 7e-55
>gnl|CDD|180003 PRK05302, PRK05302, 30S ribosomal protein S7; Validated Back     alignment and domain information
>gnl|CDD|162164 TIGR01029, rpsG_bact, ribosomal protein S7, bacterial/organelle Back     alignment and domain information
>gnl|CDD|176994 CHL00053, rps7, ribosomal protein S7 Back     alignment and domain information
>gnl|CDD|30398 COG0049, RpsG, Ribosomal protein S7 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|38501 KOG3291, KOG3291, KOG3291, Ribosomal protein S7 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|179717 PRK04027, PRK04027, 30S ribosomal protein S7P; Reviewed Back     alignment and domain information
>gnl|CDD|130100 TIGR01028, S7_S5_E_A, ribosomal protein S7(archaeal)/S5(eukaryotic) Back     alignment and domain information
>gnl|CDD|185439 PTZ00091, PTZ00091, 40S ribosomal protein S5; Provisional Back     alignment and domain information
>gnl|CDD|143943 pfam00177, Ribosomal_S7, Ribosomal protein S7p/S5e Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 156 30S ribosomal protein S7 [Candidatus Liberibacter asiat
TIGR01029159 rpsG_bact ribosomal protein S7; InterPro: IPR005717 Rib 100.0
PRK05302156 30S ribosomal protein S7; Validated 100.0
CHL00053155 rps7 ribosomal protein S7 100.0
pfam00177149 Ribosomal_S7 Ribosomal protein S7p/S5e. This family con 100.0
COG0049148 RpsG Ribosomal protein S7 [Translation, ribosomal struc 100.0
PTZ00091191 40S ribosomal protein S5; Provisional 100.0
PRK04027195 30S ribosomal protein S7P; Reviewed 100.0
KOG3291208 consensus 100.0
TIGR01028206 S7_S5_E_A ribosomal protein S7; InterPro: IPR005716 Rib 100.0
>TIGR01029 rpsG_bact ribosomal protein S7; InterPro: IPR005717 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>PRK05302 30S ribosomal protein S7; Validated Back     alignment and domain information
>CHL00053 rps7 ribosomal protein S7 Back     alignment and domain information
>pfam00177 Ribosomal_S7 Ribosomal protein S7p/S5e Back     alignment and domain information
>COG0049 RpsG Ribosomal protein S7 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PTZ00091 40S ribosomal protein S5; Provisional Back     alignment and domain information
>PRK04027 30S ribosomal protein S7P; Reviewed Back     alignment and domain information
>KOG3291 consensus Back     alignment and domain information
>TIGR01028 S7_S5_E_A ribosomal protein S7; InterPro: IPR005716 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target156 30S ribosomal protein S7 [Candidatus Liberibacter asiat
1hus_A155 Ribosomal Protein S7 Length = 155 6e-56
1vs5_G179 Crystal Structure Of The Bacterial Ribosome From Es 4e-55
3gty_S149 Promiscuous Substrate Recognition In Folding And As 4e-54
1p6g_G178 Real Space Refined Coordinates Of The 30s Subunit F 4e-54
1fjg_G156 Structure Of The Thermus Thermophilus 30s Ribosomal 3e-51
1i94_G155 Crystal Structures Of The Small Ribosomal Subunit W 2e-50
3bbn_G155 Homology Model For The Spinach Chloroplast 30s Subu 3e-49
1rss_A151 Ribosomal Protein S7 From Thermus Thermophilus Leng 4e-49
3ofo_G151 Crystal Structure Of The E. Coli Ribosome Bound To 6e-49
3fih_G150 Ternary Complex-Bound E.Coli 70s Ribosome. This Ent 3e-48
1x18_F154 Contact Sites Of Era Gtpase On The Thermus Thermoph 3e-48
1fka_G151 Structure Of Functionally Activated Small Ribosomal 7e-47
2gy9_G137 Structure Of The 30s Subunit Of A Pre-Translocation 4e-45
1eg0_D146 Fitting Of Components With Known Structure Into An 7e-44
1qd7_F135 Partial Model For 30s Ribosomal Subunit Length = 13 2e-40
2zkq_g204 Structure Of A Mammalian Ribosomal 40s Subunit With 1e-28
3izb_F225 Localization Of The Small Subunit Ribosomal Protein 2e-28
3iz6_F200 Localization Of The Small Subunit Ribosomal Protein 8e-28
3jyv_G186 Structure Of The 40s Rrna And Proteins And PE TRNA 7e-27
1s1h_G150 Structure Of The Ribosomal 80s-Eef2-Sordarin Comple 7e-26
2xzm_G200 Crystal Structure Of The Eukaryotic 40s Ribosomal S 6e-25
1iqv_A218 Crystal Structure Analysis Of The Archaebacterial R 2e-19
>gi|157831399|pdb|1HUS|A Chain A, Ribosomal Protein S7 Length = 155 Back     alignment and structure
 Score =  220 bits (561), Expect = 6e-56,   Method: Composition-based stats.
 Identities = 83/155 (53%), Positives = 104/155 (67%)

Query: 2   SRRRRAVVREVLPDPKFSDFVVAKFMNAIMYGGKKSVAVSIVYGAFDLVEKKEKKDPVAL 61
            RR     R+VLPDP ++  +V + +N I   GKKS A  I+Y AFD++ ++  KDP  +
Sbjct: 1   PRRGPVAKRDVLPDPIYNSKLVTRLINKIXIDGKKSKAQKILYTAFDIIRERTGKDPXEV 60

Query: 62  FRQALINVTPQFEVRTRRVGGAAYSVPGEITSKRSQALAIRWLIMAARKRNETTMIDRLG 121
           F QAL NV P  EVR RRVGGA Y VP E+   R  +L +RWL+  AR RNE T  +RL 
Sbjct: 61  FEQALKNVXPVLEVRARRVGGANYQVPVEVRPDRRVSLGLRWLVQYARLRNEKTXEERLA 120

Query: 122 GEIIDAANNRGVAVRKREETHKVAEANRAFSHYRW 156
            EI DAANN G AV+KRE+THK AEAN+AF+HYRW
Sbjct: 121 NEIXDAANNTGAAVKKREDTHKXAEANKAFAHYRW 155


gi|116666554|pdb|1VS5|G Chain G, Crystal Structure Of The Bacterial Ribosome From Escherichia Coli In Complex With The Antibiotic Kasugamyin At 3.5a Resolution. This File Contains The 30s Subunit Of One 70s Ribosome. The Entire Crystal Structure Contains Two 70s Ribosomes And Is Described In Remark 400. Length = 179 Back     alignment and structure
>gi|281500762|pdb|3GTY|S Chain S, Promiscuous Substrate Recognition In Folding And Assembly Activities Of The Trigger Factor Chaperone Length = 149 Back     alignment and structure
>gi|33357884|pdb|1P6G|G Chain G, Real Space Refined Coordinates Of The 30s Subunit Fitted Into The Low Resolution Cryo-Em Map Of The Ef-G.Gtp State Of E. Coli 70s Ribosome Length = 178 Back     alignment and structure
gi|10835591|pdb|1FJG|G Chain G, Structure Of The Thermus Thermophilus 30s Ribosomal Subunit In Complex With The Antibiotics Streptomycin, Spectinomycin, And Paromomycin Length = 156 Back     alignment and structure
>gi|14278536|pdb|1I94|G Chain G, Crystal Structures Of The Small Ribosomal Subunit With Tetracycline, Edeine And If3 Length = 155 Back     alignment and structure
gi|188036208|pdb|3BBN|G Chain G, Homology Model For The Spinach Chloroplast 30s Subunit Fitted To 9.4a Cryo-Em Map Of The 70s Chlororibosome. Length = 155 Back     alignment and structure
>gi|157833748|pdb|1RSS|A Chain A, Ribosomal Protein S7 From Thermus Thermophilus Length = 151 Back     alignment and structure
>gi|308387971|pdb|3OFO|G Chain G, Crystal Structure Of The E. Coli Ribosome Bound To Erythromycin. This File Contains The 30s Subunit Of The First 70s Ribosome. Length = 151 Back     alignment and structure
>gi|224510728|pdb|3FIH|G Chain G, Ternary Complex-Bound E.Coli 70s Ribosome. This Entry Consists Of The 30s Subunit, Trnas And The Ternary Complex. Length = 150 Back     alignment and structure
>gi|73536331|pdb|1X18|F Chain F, Contact Sites Of Era Gtpase On The Thermus Thermophilus 30s Subunit Length = 154 Back     alignment and structure
>gi|10120570|pdb|1FKA|G Chain G, Structure Of Functionally Activated Small Ribosomal Subunit At 3.3 A Resolution Length = 151 Back     alignment and structure
>gi|116667416|pdb|2GY9|G Chain G, Structure Of The 30s Subunit Of A Pre-Translocational E. Coli Ribosome Obtained By Fitting Atomic Models For Rna And Protein Components Into Cryo-Em Map Emd-1056 Length = 137 Back     alignment and structure
>gi|6137690|pdb|1QD7|F Chain F, Partial Model For 30s Ribosomal Subunit Length = 135 Back     alignment and structure
gi|187609260|pdb|2ZKQ|GG Chain g, Structure Of A Mammalian Ribosomal 40s Subunit Within An 80s Complex Obtained By Docking Homology Models Of The Rna And Proteins Into An 8.7 A Cryo-Em Map Length = 204 Back     alignment and structure
gi|313103670|pdb|3IZB|F Chain F, Localization Of The Small Subunit Ribosomal Proteins Into A 6.1 A Cryo-Em Map Of Saccharomyces Cerevisiae Translating 80s Ribosome Length = 225 Back     alignment and structure
gi|313103633|pdb|3IZ6|F Chain F, Localization Of The Small Subunit Ribosomal Proteins Into A 5.5 A Cryo-Em Map Of Triticum Aestivum Translating 80s Ribosome Length = 200 Back     alignment and structure
>gi|281500812|pdb|3JYV|G Chain G, Structure Of The 40s Rrna And Proteins And PE TRNA FOR EUKARYOTIC Ribosome Based On Cryo-Em Map Of Thermomyces Lanuginosus Ribosome At 8.9a Resolution Length = 186 Back     alignment and structure
>gi|49258826|pdb|1S1H|G Chain G, Structure Of The Ribosomal 80s-Eef2-Sordarin Complex From Yeast Obtained By Docking Atomic Models For Rna And Protein Components Into A 11.7 A Cryo-Em Map. This File, 1s1h, Contains 40s Subunit. The 60s Ribosomal Subunit Is In File 1s1i. Length = 150 Back     alignment and structure
gi|319443362|pdb|2XZM|G Chain G, Crystal Structure Of The Eukaryotic 40s Ribosomal Subunit In Complex With Initiation Factor 1. This File Contains The 40s Subunit And Initiation Factor For Molecule 1 Length = 200 Back     alignment and structure
gi|15826617|pdb|1IQV|A Chain A, Crystal Structure Analysis Of The Archaebacterial Ribosomal Protein S7 Length = 218 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target156 30S ribosomal protein S7 [Candidatus Liberibacter asiat
3gty_S149 TF, 30S ribosomal protein S7; chaperone-client complex, 4e-50
3i1m_G179 30S ribosomal protein S7; ribosome structure, protein-R 1e-49
1hus_A155 Ribosomal protein S7; RNA-binding protein, decoding cen 3e-49
3ofp_G150 30S ribosomal protein S7; protein biosynthesis, ribosom 5e-49
3bbn_G155 Ribosomal protein S7; small ribosomal subunit, spinach 9e-49
1rss_A151 Ribosomal protein S7; RNA-binding, translation; 1.90A { 4e-47
1iqv_A218 Ribosomal protein S7; RNA-binding, decoding center, hel 2e-38
2zkq_g204 40S ribosomal protein S5E; protein-RNA complex, 40S rib 7e-32
2noq_F150 L10A, 40S ribosomal protein S5; IRES RNA, ribosome, tra 2e-30
>3gty_S TF, 30S ribosomal protein S7; chaperone-client complex, cell cycle, cell division, chaperone, isomerase, rotamase, ribonucleoprotein; 3.40A {Thermotoga maritima} Length = 149 Back     alignment and structure
 Score =  192 bits (489), Expect = 4e-50
 Identities = 80/147 (54%), Positives = 109/147 (74%)

Query: 10  REVLPDPKFSDFVVAKFMNAIMYGGKKSVAVSIVYGAFDLVEKKEKKDPVALFRQALINV 69
           R++ PDP F D +VAK +N +M+ GKK++A  IVYGAFD++ +K KKDP+ +FRQA+ NV
Sbjct: 3   RQIPPDPVFGDVLVAKLINRVMWDGKKTIAQKIVYGAFDIIREKTKKDPLEVFRQAVENV 62

Query: 70  TPQFEVRTRRVGGAAYSVPGEITSKRSQALAIRWLIMAARKRNETTMIDRLGGEIIDAAN 129
            P  EVR RRVGGA Y VP E+   R  +LA+RW++ AAR +    M ++L  EII A N
Sbjct: 63  KPVLEVRPRRVGGATYQVPIEVQEPRRTSLALRWIVEAARAKKGRPMKEKLAEEIIAAYN 122

Query: 130 NRGVAVRKREETHKVAEANRAFSHYRW 156
           N G A++K+E+TH++AEANRAF+HYRW
Sbjct: 123 NTGTAIKKKEDTHRMAEANRAFAHYRW 149


>3i1m_G 30S ribosomal protein S7; ribosome structure, protein-RNA complex, ribonucleoprotein, ribosomal protein, RNA-binding, rRNA-binding, antibiotic resistance; 3.19A {Escherichia coli k-12} PDB: 1vs7_G* 3e1a_U 3e1c_U 1vs5_G 3i1o_G 3i1q_G 3i1s_G 3i1z_G 3i21_G 2qal_G* 1p6g_G 1p87_G 2aw7_G 2avy_G 2i2u_G 2i2p_G* 2qan_G* 2qb9_G* 2qbb_G* 2qbd_G ... Length = 179 Back     alignment and structure
>1hus_A Ribosomal protein S7; RNA-binding protein, decoding center,; 2.50A {Geobacillus stearothermophilus} SCOP: a.75.1.1 Length = 155 Back     alignment and structure
>3ofp_G 30S ribosomal protein S7; protein biosynthesis, ribosomes, RNA, tRNA, transfer, eryThr ketolide, macrolide, antibiotic, EXIT, peptidyl; 3.10A {Escherichia coli} PDB: 3fih_G* 2wwl_G 3ofo_G 2gy9_G 2gyb_G Length = 150 Back     alignment and structure
>3bbn_G Ribosomal protein S7; small ribosomal subunit, spinach chloroplast ribosome, ribonucleoprotein particle, macromolecular complex; 9.40A {Spinacea oleracea} SCOP: i.1.1.1 Length = 155 Back     alignment and structure
>1rss_A Ribosomal protein S7; RNA-binding, translation; 1.90A {Thermus thermophilus} SCOP: a.75.1.1 PDB: 1n32_G* 1i95_G* 1i96_G* 1i97_G* 1i94_G 1j5e_G* 1n33_G* 1n34_G 1n36_G 1pns_G 1pnx_G 1voq_G 1vos_G 1vov_G 1vox_G 1voz_G 2e5l_G 2zm6_G 3fic_G* 2vqe_G* ... Length = 151 Back     alignment and structure
>1iqv_A Ribosomal protein S7; RNA-binding, decoding center, helix-turn- helix, ribosome; 2.10A {Pyrococcus horikoshii} SCOP: a.75.1.1 Length = 218 Back     alignment and structure
>2zkq_g 40S ribosomal protein S5E; protein-RNA complex, 40S ribosomal subunit, ribosomal protein/RNA complex; 8.70A {Canis familiaris} Length = 204 Back     alignment and structure
>2noq_F L10A, 40S ribosomal protein S5; IRES RNA, ribosome, translation, internal initiation; 7.30A {Saccharomyces cerevisiae} PDB: 1s1h_G Length = 150 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target156 30S ribosomal protein S7 [Candidatus Liberibacter asiat
3i1m_G179 30S ribosomal protein S7; ribosome structure, protein-R 100.0
1hus_A155 Ribosomal protein S7; RNA-binding protein, decoding cen 100.0
1rss_A151 Ribosomal protein S7; RNA-binding, translation; 1.90A { 100.0
3bbn_G155 Ribosomal protein S7; small ribosomal subunit, spinach 100.0
3gty_S149 TF, 30S ribosomal protein S7; chaperone-client complex, 100.0
3ofp_G150 30S ribosomal protein S7; protein biosynthesis, ribosom 100.0
2noq_F150 L10A, 40S ribosomal protein S5; IRES RNA, ribosome, tra 100.0
2zkq_g204 40S ribosomal protein S5E; protein-RNA complex, 40S rib 100.0
1iqv_A218 Ribosomal protein S7; RNA-binding, decoding center, hel 100.0
>3i1m_G 30S ribosomal protein S7; ribosome structure, protein-RNA complex, ribonucleoprotein, ribosomal protein, RNA-binding, rRNA-binding, antibiotic resistance; 3.19A {Escherichia coli k-12} PDB: 1vs7_G* 3e1a_U 3e1c_U 1vs5_G 3i1o_G 3i1q_G 3i1s_G 3i1z_G 3i21_G 3kc4_G 2qal_G* 1p6g_G 1p87_G 2aw7_G 2avy_G 2i2u_G 2i2p_G* 2qan_G* 2qb9_G* 2qbb_G* ... Back     alignment and structure
Probab=100.00  E-value=0  Score=391.86  Aligned_cols=156  Identities=51%  Similarity=0.855  Sum_probs=155.4

Q ss_pred             CCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHCCCCEEEEEEEE
Q ss_conf             98989997555799974378799999999976695999999999999866742488638999999984275404778752
Q gi|254780265|r    1 MSRRRRAVVREVLPDPKFSDFVVAKFMNAIMYGGKKSVAVSIVYGAFDLVEKKEKKDPVALFRQALINVTPQFEVRTRRV   80 (156)
Q Consensus         1 m~Rr~~~~kr~~~pD~~y~~~lv~kliN~lMk~GKK~~A~kIv~~al~~I~~~~~~npi~il~~Ai~n~~P~~evk~~r~   80 (156)
                      ||||+.++||.++|||+|+|++|++|||+||++|||++|++|++++|++|+++|++||+++|++||+|++|.+||+++++
T Consensus         1 m~R~~~~~kr~~~pD~~y~~~lV~kliN~lMk~GKK~~A~kIv~~a~~~I~~~t~~npi~vl~~AI~N~~P~~evk~~r~   80 (179)
T 3i1m_G            1 MPRRRVIGQRKILPDPKFGSELLAKFVNILMVDGKKSTAESIVYSALETLAQRSGKSELEAFEVALENVRPTVEVKSRRV   80 (179)
T ss_dssp             -CCSCCCCCCCCCCCTTTCCHHHHHHHHHHCCTTCHHHHHHHHHHHHHHHHHHHCSCSHHHHHHHHHHHCCSEEEECCCC
T ss_pred             CCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHCCCCEEEEEEEE
T ss_conf             96999998787999977587899999999876645999999999999888874367425899999993799627887750


Q ss_pred             CCCCEECEEECCHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHCCCCCCEECHHHHHHHHHHHHHHHCCCC
Q ss_conf             4630000010485799999999999999857999989999999999973888726307889999999888532569
Q gi|254780265|r   81 GGAAYSVPGEITSKRSQALAIRWLIMAARKRNETTMIDRLGGEIIDAANNRGVAVRKREETHKVAEANRAFSHYRW  156 (156)
Q Consensus        81 gG~~yqvP~~i~~~r~~~lAirWii~~a~~r~~~~~~~~La~Eii~A~~~~g~aikkK~elhk~A~aNRa~ah~Rw  156 (156)
                      ||++||||+||++.|+++||||||+++|+++++++|+++||+||++|++|+|.|++||+|+||+|++|||||||||
T Consensus        81 GG~~~qvPv~i~~~rr~~lAirWil~aar~r~~k~~~~~La~EIi~A~~~~g~aikKK~elhK~A~aNRa~ahyRW  156 (179)
T 3i1m_G           81 GGSTYQVPVEVRPVRRNALAMRWIVEAARKRGDKSMALRLANELSDAAENKGTAVKKREDVHRMAEANKAFAHYRW  156 (179)
T ss_dssp             SSSCCCEEEECCTTHHHHHHHHHHHHHHTTCCSSSHHHHHHHHHHHHHTSCSHHHHHHHHHHHHTTTGGGGC----
T ss_pred             CCCCCEEEEECCHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHCCCCEEEEHHHHHHHHHHHHHHHHHHH
T ss_conf             7722222022282889999999999999865999899999999999995899766519999999999899998998



>1hus_A Ribosomal protein S7; RNA-binding protein, decoding center,; 2.50A {Geobacillus stearothermophilus} SCOP: a.75.1.1 Back     alignment and structure
>1rss_A Ribosomal protein S7; RNA-binding, translation; 1.90A {Thermus thermophilus} SCOP: a.75.1.1 PDB: 1n32_G* 1i95_G* 1i96_G* 1i97_G* 1i94_G 1j5e_G* 1n33_G* 1n34_G 1n36_G 1pns_G 1pnx_G 1voq_G 1vos_G 1vov_G 1vox_G 1voz_G 2e5l_G 2zm6_G 3fic_G* 2vqe_G* ... Back     alignment and structure
>3bbn_G Ribosomal protein S7; small ribosomal subunit, spinach chloroplast ribosome, ribonucleoprotein particle, macromolecular complex; 9.40A {Spinacea oleracea} SCOP: i.1.1.1 Back     alignment and structure
>3gty_S TF, 30S ribosomal protein S7; chaperone-client complex, cell cycle, cell division, chaperone, isomerase, rotamase, ribonucleoprotein; 3.40A {Thermotoga maritima} Back     alignment and structure
>3ofp_G 30S ribosomal protein S7; protein biosynthesis, ribosomes, RNA, tRNA, transfer, eryThr ketolide, macrolide, antibiotic, EXIT, peptidyl; 3.10A {Escherichia coli} PDB: 3fih_G* 2wwl_G 3ofo_G 2gy9_G 2gyb_G Back     alignment and structure
>2noq_F L10A, 40S ribosomal protein S5; IRES RNA, ribosome, translation, internal initiation; 7.30A {Saccharomyces cerevisiae} PDB: 1s1h_G Back     alignment and structure
>2zkq_g 40S ribosomal protein S5E; protein-RNA complex, 40S ribosomal subunit, ribosomal protein/RNA complex; 8.70A {Canis familiaris} PDB: 3jyv_G* Back     alignment and structure
>1iqv_A Ribosomal protein S7; RNA-binding, decoding center, helix-turn- helix, ribosome; 2.10A {Pyrococcus horikoshii} SCOP: a.75.1.1 Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 156 30S ribosomal protein S7 [Candidatus Liberibacter asiat
d1rssa_145 a.75.1.1 (A:) Ribosomal protein S7 {Thermus thermophilu 5e-47
d2qalg1150 a.75.1.1 (G:2-151) Ribosomal protein S7 {Escherichia co 1e-45
d1husa_139 a.75.1.1 (A:) Ribosomal protein S7 {Bacillus stearother 3e-41
d1iqva_201 a.75.1.1 (A:) Ribosomal protein S7 {Archaeon Pyrococcus 4e-32
>d1rssa_ a.75.1.1 (A:) Ribosomal protein S7 {Thermus thermophilus [TaxId: 274]} Length = 145 Back     information, alignment and structure

class: All alpha proteins
fold: Ribosomal protein S7
superfamily: Ribosomal protein S7
family: Ribosomal protein S7
domain: Ribosomal protein S7
species: Thermus thermophilus [TaxId: 274]
 Score =  180 bits (458), Expect = 5e-47
 Identities = 67/145 (46%), Positives = 103/145 (71%)

Query: 12  VLPDPKFSDFVVAKFMNAIMYGGKKSVAVSIVYGAFDLVEKKEKKDPVALFRQALINVTP 71
           + PD  + D +V  F+N IM  GKK++A  I Y A  ++++K  ++P+ +F+QA+ NV P
Sbjct: 1   LQPDLVYGDVLVTAFINKIMRDGKKNLAARIFYDACKIIQEKTGQEPLKVFKQAVENVKP 60

Query: 72  QFEVRTRRVGGAAYSVPGEITSKRSQALAIRWLIMAARKRNETTMIDRLGGEIIDAANNR 131
           + EVR+RRVGGA Y VP E++ +R Q+LA+RWL+ AA +R E     R+  E++DAA  +
Sbjct: 61  RMEVRSRRVGGANYQVPMEVSPRRQQSLALRWLVQAANQRPERRAAVRIAHELMDAAEGK 120

Query: 132 GVAVRKREETHKVAEANRAFSHYRW 156
           G AV+K+E+  ++AEANRA++HYRW
Sbjct: 121 GGAVKKKEDVERMAEANRAYAHYRW 145


>d2qalg1 a.75.1.1 (G:2-151) Ribosomal protein S7 {Escherichia coli [TaxId: 562]} Length = 150 Back     information, alignment and structure
>d1husa_ a.75.1.1 (A:) Ribosomal protein S7 {Bacillus stearothermophilus [TaxId: 1422]} Length = 139 Back     information, alignment and structure
>d1iqva_ a.75.1.1 (A:) Ribosomal protein S7 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Length = 201 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target156 30S ribosomal protein S7 [Candidatus Liberibacter asiat
d1rssa_145 Ribosomal protein S7 {Thermus thermophilus [TaxId: 274] 100.0
d2qalg1150 Ribosomal protein S7 {Escherichia coli [TaxId: 562]} 100.0
d1husa_139 Ribosomal protein S7 {Bacillus stearothermophilus [TaxI 100.0
d1iqva_201 Ribosomal protein S7 {Archaeon Pyrococcus horikoshii [T 100.0
>d1rssa_ a.75.1.1 (A:) Ribosomal protein S7 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
class: All alpha proteins
fold: Ribosomal protein S7
superfamily: Ribosomal protein S7
family: Ribosomal protein S7
domain: Ribosomal protein S7
species: Thermus thermophilus [TaxId: 274]
Probab=100.00  E-value=0  Score=368.01  Aligned_cols=145  Identities=46%  Similarity=0.849  Sum_probs=143.8

Q ss_pred             CCCCCCCCCHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHCCCCEEEEEEEECCCCEECEEEC
Q ss_conf             79997437879999999997669599999999999986674248863899999998427540477875246300000104
Q gi|254780265|r   12 VLPDPKFSDFVVAKFMNAIMYGGKKSVAVSIVYGAFDLVEKKEKKDPVALFRQALINVTPQFEVRTRRVGGAAYSVPGEI   91 (156)
Q Consensus        12 ~~pD~~y~~~lv~kliN~lMk~GKK~~A~kIv~~al~~I~~~~~~npi~il~~Ai~n~~P~~evk~~r~gG~~yqvP~~i   91 (156)
                      +.|||+|+|++|++|||+||++|||++|++|++++|++|++++++||+++|++||+|++|.+||+++++||++||||+++
T Consensus         1 ~~pdp~y~d~lv~k~in~lMk~GKK~~A~~iv~~al~~i~~~~~~npi~vl~~Ai~n~~P~~evk~~r~gG~~~~vPv~i   80 (145)
T d1rssa_           1 LQPDLVYGDVLVTAFINKIMRDGKKNLAARIFYDACKIIQEKTGQEPLKVFKQAVENVKPRMEVRSRRVGGANYQVPMEV   80 (145)
T ss_dssp             CCCCTTTCCHHHHHHHHHHCCTTCHHHHHHHHHHHHHHHHHHHCSCHHHHHHHHHHHHCCSEEEEEEEETTEEEEEEEEC
T ss_pred             CCCCCCCCCHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHCCCCCCCEEEEEECCCCEEEEECC
T ss_conf             98998779889999999987624699999999999998887135760899999986352102014466377002530046


Q ss_pred             CHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHCCCCCCEECHHHHHHHHHHHHHHHCCCC
Q ss_conf             85799999999999999857999989999999999973888726307889999999888532569
Q gi|254780265|r   92 TSKRSQALAIRWLIMAARKRNETTMIDRLGGEIIDAANNRGVAVRKREETHKVAEANRAFSHYRW  156 (156)
Q Consensus        92 ~~~r~~~lAirWii~~a~~r~~~~~~~~La~Eii~A~~~~g~aikkK~elhk~A~aNRa~ah~Rw  156 (156)
                      ++.||++||||||+++|++|++++|+++||+||++|++|+|.|++||+|+||+|++||||+||||
T Consensus        81 ~~~rr~~lAirwil~aa~~r~~k~~~~~La~Eii~A~~~~g~aikkK~e~hK~A~aNRa~ah~Rw  145 (145)
T d1rssa_          81 SPRRQQSLALRWLVQAANQRPERRAAVRIAHELMDAAEGKGGAVKKKEDVERMAEANRAYAHYRW  145 (145)
T ss_dssp             CHHHHHHHHHHHHHHHHTTSSCSSHHHHHHHHHHHHHTTCSHHHHHHHHHHHHHCC-----CSCC
T ss_pred             CHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHCCCCCEEEHHHHHHHHHHHHHHHHCCCC
T ss_conf             87899999999999999864999899999999999982888654408889999999774611379



>d2qalg1 a.75.1.1 (G:2-151) Ribosomal protein S7 {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1husa_ a.75.1.1 (A:) Ribosomal protein S7 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1iqva_ a.75.1.1 (A:) Ribosomal protein S7 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 156 30S ribosomal protein S7 [Candidatus Liberibacter
3bbn_G_155 (G:) Ribosomal protein S7; small ribosomal subunit 5e-46
3i1m_G_179 (G:) 30S ribosomal protein S7; ribosome structure, 2e-45
3gty_S_149 (S:) TF, 30S ribosomal protein S7; chaperone-clien 6e-45
1hus_A_155 (A:) Ribosomal protein S7; RNA-binding protein, de 7e-44
2noq_F_150 (F:) L10A, 40S ribosomal protein S5; IRES RNA, rib 2e-39
2zkq_g_204 (g:) 40S ribosomal protein S5E; protein-RNA comple 9e-39
1iqv_A_218 (A:) Ribosomal protein S7; RNA-binding, decoding c 1e-35
1rss_A_151 (A:) Ribosomal protein S7; RNA-binding, translatio 1e-32
>3bbn_G (G:) Ribosomal protein S7; small ribosomal subunit, spinach chloroplast ribosome, ribonucleoprotein particle, macromolecular complex; 9.40A {Spinacea oleracea}Length = 155 Back     alignment and structure
 Score =  177 bits (451), Expect = 5e-46
 Identities = 72/155 (46%), Positives = 103/155 (66%)

Query: 1   MSRRRRAVVREVLPDPKFSDFVVAKFMNAIMYGGKKSVAVSIVYGAFDLVEKKEKKDPVA 60
           MSRR     +    DP + + +V   +N I+  GKKS+A  I+Y A   +++K + +P++
Sbjct: 1   MSRRGTVEEKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQILYRAVKKIQQKTETNPLS 60

Query: 61  LFRQALINVTPQFEVRTRRVGGAAYSVPGEITSKRSQALAIRWLIMAARKRNETTMIDRL 120
           + RQA+  VTP   V+ RRVGG+ + VP EI S + +ALAIRWL+ AARKR    M  +L
Sbjct: 61  VLRQAIRGVTPDIAVKARRVGGSTHQVPIEIGSTQGKALAIRWLLGAARKRPGRNMAFKL 120

Query: 121 GGEIIDAANNRGVAVRKREETHKVAEANRAFSHYR 155
             E++DAA   G AVRK+EETH++AEANRAF+H+R
Sbjct: 121 SSELVDAAKGSGDAVRKKEETHRMAEANRAFAHFR 155


>3i1m_G (G:) 30S ribosomal protein S7; ribosome structure, protein-RNA complex, ribonucleoprotein, ribosomal protein, RNA-binding, rRNA-binding, antibiotic resistance; 3.19A {Escherichia coli k-12} PDB: 1vs7_G* 3e1a_U 3e1c_U 1vs5_G 3i1o_G 3i1q_G 3i1s_G 3i1z_G 3i21_G 2qal_G* 1p6g_G 1p87_G 2aw7_G 2avy_G 2i2u_G 2i2p_G* 2qan_G* 2qb9_G* 2qbb_G* 2qbd_G ...Length = 179 Back     alignment and structure
>3gty_S (S:) TF, 30S ribosomal protein S7; chaperone-client complex, cell cycle, cell division, chaperone, isomerase, rotamase, ribonucleoprotein; 3.40A {Thermotoga maritima}Length = 149 Back     alignment and structure
>1hus_A (A:) Ribosomal protein S7; RNA-binding protein, decoding center,; 2.50A {Geobacillus stearothermophilus}Length = 155 Back     alignment and structure
>2noq_F (F:) L10A, 40S ribosomal protein S5; IRES RNA, ribosome, translation, internal initiation; 7.30A {Saccharomyces cerevisiae} PDB: 1s1h_GLength = 150 Back     alignment and structure
>2zkq_g (g:) 40S ribosomal protein S5E; protein-RNA complex, 40S ribosomal subunit, ribosomal protein/RNA complex; 8.70A {Canis familiaris}Length = 204 Back     alignment and structure
>1iqv_A (A:) Ribosomal protein S7; RNA-binding, decoding center, helix-turn- helix, ribosome; 2.10A {Pyrococcus horikoshii}Length = 218 Back     alignment and structure
>1rss_A (A:) Ribosomal protein S7; RNA-binding, translation; 1.90A {Thermus thermophilus}Length = 151 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target156 30S ribosomal protein S7 [Candidatus Liberibacter asiat
3i1m_G_179 30S ribosomal protein S7; ribosome structure, prot 100.0
1hus_A_155 Ribosomal protein S7; RNA-binding protein, decodin 100.0
3bbn_G_155 Ribosomal protein S7; small ribosomal subunit, spi 100.0
3gty_S_149 TF, 30S ribosomal protein S7; chaperone-client com 100.0
2noq_F_150 L10A, 40S ribosomal protein S5; IRES RNA, ribosome 100.0
2zkq_g_204 40S ribosomal protein S5E; protein-RNA complex, 40 100.0
1rss_A_151 Ribosomal protein S7; RNA-binding, translation; 1. 100.0
1iqv_A_218 Ribosomal protein S7; RNA-binding, decoding center 100.0
>3i1m_G (G:) 30S ribosomal protein S7; ribosome structure, protein-RNA complex, ribonucleoprotein, ribosomal protein, RNA-binding, rRNA-binding, antibiotic resistance; 3.19A {Escherichia coli k-12} PDB: 1vs7_G* 3e1a_U 3e1c_U 1vs5_G 3i1o_G 3i1q_G 3i1s_G 3i1z_G 3i21_G 2qal_G* 1p6g_G 1p87_G 2aw7_G 2avy_G 2i2u_G 2i2p_G* 2qan_G* 2qb9_G* 2qbb_G* 2qbd_G ... Back     alignment and structure
Probab=100.00  E-value=0  Score=371.70  Aligned_cols=156  Identities=51%  Similarity=0.855  Sum_probs=155.7

Q ss_pred             CCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHCCCCEEEEEEEE
Q ss_conf             98989997555799974378799999999976695999999999999866742488638999999984275404778752
Q gi|254780265|r    1 MSRRRRAVVREVLPDPKFSDFVVAKFMNAIMYGGKKSVAVSIVYGAFDLVEKKEKKDPVALFRQALINVTPQFEVRTRRV   80 (156)
Q Consensus         1 m~Rr~~~~kr~~~pD~~y~~~lv~kliN~lMk~GKK~~A~kIv~~al~~I~~~~~~npi~il~~Ai~n~~P~~evk~~r~   80 (156)
                      ||||++++++..+|||+|+|++|++|||++|++|||++|++|++++|++|+..|++||+++|++||+|++|.+||+++++
T Consensus         1 Msr~~~~~k~~~~~d~~~~~~lv~klin~lmk~GKK~~A~kIv~~al~~I~~~t~~nPi~il~~Ai~Nv~P~~ev~~ik~   80 (179)
T 3i1m_G            1 MPRRRVIGQRKILPDPKFGSELLAKFVNILMVDGKKSTAESIVYSALETLAQRSGKSELEAFEVALENVRPTVEVKSRRV   80 (179)
T ss_dssp             -CCSCCCCCCCCCCCTTTCCHHHHHHHHHHCCTTCHHHHHHHHHHHHHHHHHHHCSCSHHHHHHHHHHHCCSEEEECCCC
T ss_pred             CCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHCCCEEEEEEEEE
T ss_conf             97999998787999976587999999999875641999999999999998873467640689999985356057886641


Q ss_pred             CCCCEECEEECCHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHCCCCCCEECHHHHHHHHHHHHHHHCCCC
Q ss_conf             4630000010485799999999999999857999989999999999973888726307889999999888532569
Q gi|254780265|r   81 GGAAYSVPGEITSKRSQALAIRWLIMAARKRNETTMIDRLGGEIIDAANNRGVAVRKREETHKVAEANRAFSHYRW  156 (156)
Q Consensus        81 gG~~yqvP~~i~~~r~~~lAirWii~~a~~r~~~~~~~~La~Eii~A~~~~g~aikkK~elhk~A~aNRa~ah~Rw  156 (156)
                      ||++||||++|++.|++++||+||+++|+++++++|+++||+||++|++++|.|++||||+||+|++||||+||||
T Consensus        81 gG~~y~vP~~i~~~rr~~lAirWll~~a~~r~~k~~~~~La~Eii~A~~~~G~aikKK~elhK~A~aNRa~ah~Rw  156 (179)
T 3i1m_G           81 GGSTYQVPVEVRPVRRNALAMRWIVEAARKRGDKSMALRLANELSDAAENKGTAVKKREDVHRMAEANKAFAHYRW  156 (179)
T ss_dssp             SSSCCCEEEECCTTHHHHHHHHHHHHHHTTCCSSSHHHHHHHHHHHHHTSCSHHHHHHHHHHHHTTTGGGGC----
T ss_pred             CCCCCEEEEECCHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHCCCCEEEEHHHHHHHHHHHHHHHHHHH
T ss_conf             7744323232381889999999999988743899899999999999994889666628999999999999998898



>1hus_A (A:) Ribosomal protein S7; RNA-binding protein, decoding center,; 2.50A {Geobacillus stearothermophilus} Back     alignment and structure
>3bbn_G (G:) Ribosomal protein S7; small ribosomal subunit, spinach chloroplast ribosome, ribonucleoprotein particle, macromolecular complex; 9.40A {Spinacea oleracea} Back     alignment and structure
>3gty_S (S:) TF, 30S ribosomal protein S7; chaperone-client complex, cell cycle, cell division, chaperone, isomerase, rotamase, ribonucleoprotein; 3.40A {Thermotoga maritima} Back     alignment and structure
>2noq_F (F:) L10A, 40S ribosomal protein S5; IRES RNA, ribosome, translation, internal initiation; 7.30A {Saccharomyces cerevisiae} PDB: 1s1h_G Back     alignment and structure
>2zkq_g (g:) 40S ribosomal protein S5E; protein-RNA complex, 40S ribosomal subunit, ribosomal protein/RNA complex; 8.70A {Canis familiaris} Back     alignment and structure
>1rss_A (A:) Ribosomal protein S7; RNA-binding, translation; 1.90A {Thermus thermophilus} Back     alignment and structure
>1iqv_A (A:) Ribosomal protein S7; RNA-binding, decoding center, helix-turn- helix, ribosome; 2.10A {Pyrococcus horikoshii} Back     alignment and structure