254780293

254780293

30S ribosomal protein S9

GeneID in NCBI database:8209275Locus tag:CLIBASIA_00890
Protein GI in NCBI database:254780293Protein Accession:YP_003064706.1
Gene range:+(183838, 184350)Protein Length:170aa
Gene description:30S ribosomal protein S9
COG prediction:[J] Ribosomal protein S9
KEGG prediction:rpsI; 30S ribosomal protein S9; K02996 small subunit ribosomal protein S9
SEED prediction:SSU ribosomal protein S9p (S16e)
Pathway involved in KEGG:Ribosome [PATH:las03010]
Subsystem involved in SEED:Ribosome SSU bacterial
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED1 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170
MEDIENIRDIIEQQGGTLTEENTSQPEETSSSPAIHSRKVDQWQRSYATGKRKTSIARVWIKSGSGKFTINYVDISKYFTQDLLVLNIKRPFNTVSQDNMYDVFATVSGGGLSGQASAICHGVAKALTYFQPDLRPQIKKGGFLTRDSRIVERKKYGKAKARRSFQFSKR
ccHHHHHHHHHHHHcccccccccccccccccccccccccHHHHHHHHcccccccEEEEEEEEccccEEEEccEEHHHHHccHHHHHHHHHHHHHHcccccccEEEEEEcccccHHHHHHHHHHHHHHHHHcHHHHHHHHHcccEEccccccccccccccccccccccccc
ccHHHHHHHHHHHccccccEEHHHHHHHHHccccccccccccccccEccccccccEEEEEEEccccEEEEcccccHHccccHHHHHHEcccEEEEEEcccEEEEEEEcccccccHHHHHHHHHHHHHHHccHHHHHHHHHccccccccHHHHHHHccHHHHHcccccccc
MEDIENIRDIIEQQggtlteentsqpeetssspaihsrkvdqwqrsyatgkrktSIARVWIKsgsgkftiNYVDISKYFTQDLLVLnikrpfntvsqdnMYDVFAtvsggglsgqaSAICHGVAKALtyfqpdlrpqikkggfltrdsRIVERKKYGKAKARRSFQFSKR
MEDIENIRDIIEqqggtlteentsqpeetssspaihsrkvdqwqrsyatgkrktsiarvwiksgsgkftiNYVDISKYFTQDLLVLNIKRPFNTVSQDNMYDVFATVSGGGLSGQASAICHGVAKALTYFqpdlrpqikkggfltrdsriverkkygkakarrsfqfskr
MEDIENIRDIIEQQGGTLTEENTSQPEETSSSPAIHSRKVDQWQRSYATGKRKTSIARVWIKSGSGKFTINYVDISKYFTQDLLVLNIKRPFNTVSQDNMYDVFATVSGGGLSGQASAICHGVAKALTYFQPDLRPQIKKGGFLTRDSRIVERKKYGKAKARRSFQFSKR
*******************************************QRSYATGKRKTSIARVWIKSGSGKFTINYVDISKYFTQDLLVLNIKRPFNTVSQDNMYDVFATVSGGGLSGQASAICHGVAKALTYFQPDLRPQIKKGGFLTRDSRIVERKKYGKAKARRSFQFS**
MEDIENIRDIIEQQGGT************************QWQRSYATGKRKTSIARVWIKSGSGKFTINYVDISKYFTQDLLVLNIKRPFNTVSQDNMYDVFATVSGGGLSGQASAICHGVAKALTYFQPDLRPQIKKGGFLTRDSRIVER*****************
MEDIENIRDIIEQQGGTLTEENTSQPEETSSSPAIHSRKVDQWQRSYATGKRKTSIARVWIKSGSGKFTINYVDISKYFTQDLLVLNIKRPFNTVSQDNMYDVFATVSGGGLSGQASAICHGVAKALTYFQPDLRPQIKKGGFLTRDSRIVERKKYG**KA*********
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEDIENIRDIIEQQGGTLTEENTSQPEETSSSPAIHSRKVDQWQRSYATGKRKTSIARVWIKSGSGKFTINYVDISKYFTQDLLVLNIKRPFNTVSQDNMYDVFATVSGGGLSGQASAICHGVAKALTYFQPDLRPQIKKGGFLTRDSRIVERKKYGKAKARRSFQFSKR
MEDIENIRDIIEQQGGTLTEENTSQPEETSSSPAIHSRKVDQWQRSYATGKRKTSIARVWIKSGSGKFTINYVDISKYFTQDLLVLNIKRPFNTVSQDNMYDVFATVSGGGLSGQASAICHGVAKALTYFQPDLRPQIKKGGFLTRDSRIVERKKYGKAKARRSFQFSKR
MEDIENIRDIIEQQGGTLTEENTSQPEETSSSPAIHSRKVDQWQRSYATGKRKTSIARVWIKSGSGKFTINYVDISKYFTQDLLVLNIKRPFNTVSQDNMYDVFATVSGGGLSGQASAICHGVAKALTYFQPDLRPQIKKGGFLTRDSRIVERKKYGKAKARRSFQFSKR

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target170 30S ribosomal protein S9 [Candidatus Liberibacter asiat
315122854173 30S ribosomal protein S9 [Candidatus Liberibacter solan 1 2e-71
319408569165 30S ribosomal protein S9 [Bartonella schoenbuchensis R1 1 3e-48
15888577155 30S ribosomal protein S9 [Agrobacterium tumefaciens str 1 4e-48
116251438155 30S ribosomal protein S9 [Rhizobium leguminosarum bv. v 1 6e-48
90418053158 small ribosomal subunit protein S9 [Aurantimonas mangan 1 3e-47
209548837155 30S ribosomal protein S9 [Rhizobium leguminosarum bv. t 1 5e-47
218682704155 30S ribosomal protein S9 [Rhizobium etli CIAT 894] Leng 1 6e-47
86357207155 30S ribosomal protein S9 [Rhizobium etli CFN 42] Length 1 7e-47
325292616155 30S ribosomal protein S9 [Agrobacterium sp. H13-3] Leng 1 7e-47
222085550157 30S ribosomal protein S9 [Agrobacterium radiobacter K84 1 9e-47
>gi|315122854|ref|YP_004063343.1| 30S ribosomal protein S9 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 173 Back     alignment and organism information
 Score =  271 bits (693), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 133/171 (77%), Positives = 150/171 (87%), Gaps = 2/171 (1%)

Query: 2   EDIENIRDIIEQQGG-TLTEENTSQPEETS-SSPAIHSRKVDQWQRSYATGKRKTSIARV 59
           EDI N++DIIE++ G T+ +  T + E+ + SS   +SRKVDQWQRSYATGKRKTSIARV
Sbjct: 3   EDITNLKDIIEKKEGITVAKIATEESEDKAISSSLTYSRKVDQWQRSYATGKRKTSIARV 62

Query: 60  WIKSGSGKFTINYVDISKYFTQDLLVLNIKRPFNTVSQDNMYDVFATVSGGGLSGQASAI 119
           WIKSGSGKFTIN +DISKYF Q L +LN+KRP   VSQD+MYDVFATVSGGG SGQASAI
Sbjct: 63  WIKSGSGKFTINRMDISKYFKQSLPILNVKRPIKEVSQDDMYDVFATVSGGGFSGQASAI 122

Query: 120 CHGVAKALTYFQPDLRPQIKKGGFLTRDSRIVERKKYGKAKARRSFQFSKR 170
           CHG++KALTYFQPDLRPQ+KKGGFLTRDSRIVERKKYGKAKARRSFQFSKR
Sbjct: 123 CHGISKALTYFQPDLRPQLKKGGFLTRDSRIVERKKYGKAKARRSFQFSKR 173


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|319408569|emb|CBI82222.1| 30S ribosomal protein S9 [Bartonella schoenbuchensis R1] Length = 165 Back     alignment and organism information
>gi|15888577|ref|NP_354258.1| 30S ribosomal protein S9 [Agrobacterium tumefaciens str. C58] Length = 155 Back     alignment and organism information
>gi|116251438|ref|YP_767276.1| 30S ribosomal protein S9 [Rhizobium leguminosarum bv. viciae 3841] Length = 155 Back     alignment and organism information
>gi|90418053|ref|ZP_01225965.1| small ribosomal subunit protein S9 [Aurantimonas manganoxydans SI85-9A1] Length = 158 Back     alignment and organism information
>gi|209548837|ref|YP_002280754.1| 30S ribosomal protein S9 [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 155 Back     alignment and organism information
>gi|218682704|ref|ZP_03530305.1| 30S ribosomal protein S9 [Rhizobium etli CIAT 894] Length = 155 Back     alignment and organism information
>gi|86357207|ref|YP_469099.1| 30S ribosomal protein S9 [Rhizobium etli CFN 42] Length = 155 Back     alignment and organism information
>gi|325292616|ref|YP_004278480.1| 30S ribosomal protein S9 [Agrobacterium sp. H13-3] Length = 155 Back     alignment and organism information
>gi|222085550|ref|YP_002544080.1| 30S ribosomal protein S9 [Agrobacterium radiobacter K84] Length = 157 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target170 30S ribosomal protein S9 [Candidatus Liberibacter asiat
PRK00132130 PRK00132, rpsI, 30S ribosomal protein S9; Reviewed 2e-54
COG0103130 COG0103, RpsI, Ribosomal protein S9 [Translation, ribos 2e-41
CHL00079130 CHL00079, rps9, ribosomal protein S9 6e-39
KOG1697275 KOG1697, KOG1697, KOG1697, Mitochondrial/chloroplast ri 1e-35
PRK00474134 PRK00474, rps9p, 30S ribosomal protein S9P; Reviewed 2e-13
TIGR03627130 TIGR03627, arch_S9P, archaeal ribosomal protein S9P 3e-12
PLN00210141 PLN00210, PLN00210, 40S ribosomal protein S16; Provisio 6e-08
KOG1753145 KOG1753, KOG1753, KOG1753, 40S ribosomal protein S16 [T 8e-06
PTZ00086147 PTZ00086, PTZ00086, 40S ribosomal protein S16; Provisio 1e-05
pfam00380121 pfam00380, Ribosomal_S9, Ribosomal protein S9/S16 2e-48
>gnl|CDD|178888 PRK00132, rpsI, 30S ribosomal protein S9; Reviewed Back     alignment and domain information
>gnl|CDD|30452 COG0103, RpsI, Ribosomal protein S9 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|177018 CHL00079, rps9, ribosomal protein S9 Back     alignment and domain information
>gnl|CDD|36910 KOG1697, KOG1697, KOG1697, Mitochondrial/chloroplast ribosomal protein S9 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|179041 PRK00474, rps9p, 30S ribosomal protein S9P; Reviewed Back     alignment and domain information
>gnl|CDD|132666 TIGR03627, arch_S9P, archaeal ribosomal protein S9P Back     alignment and domain information
>gnl|CDD|177799 PLN00210, PLN00210, 40S ribosomal protein S16; Provisional Back     alignment and domain information
>gnl|CDD|36964 KOG1753, KOG1753, KOG1753, 40S ribosomal protein S16 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|185437 PTZ00086, PTZ00086, 40S ribosomal protein S16; Provisional Back     alignment and domain information
>gnl|CDD|144099 pfam00380, Ribosomal_S9, Ribosomal protein S9/S16 Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 170 30S ribosomal protein S9 [Candidatus Liberibacter asiat
PRK00132130 rpsI 30S ribosomal protein S9; Reviewed 100.0
CHL00079134 rps9 ribosomal protein S9 100.0
COG0103130 RpsI Ribosomal protein S9 [Translation, ribosomal struc 100.0
pfam00380121 Ribosomal_S9 Ribosomal protein S9/S16. This family incl 100.0
PRK00474132 rps9p 30S ribosomal protein S9P; Reviewed 100.0
TIGR03627130 arch_S9P archaeal ribosomal protein S9P. This model des 100.0
KOG1697275 consensus 100.0
PTZ00086147 40S ribosomal protein S16; Provisional 100.0
KOG1753145 consensus 99.93
TIGR02903616 spore_lon_C ATP-dependent protease, Lon family; InterPr 93.88
TIGR01193710 bacteriocin_ABC ABC-type bacteriocin transporter; Inter 93.4
TIGR00958770 3a01208 antigen peptide transporter 2; InterPro: IPR005 92.19
>PRK00132 rpsI 30S ribosomal protein S9; Reviewed Back     alignment and domain information
>CHL00079 rps9 ribosomal protein S9 Back     alignment and domain information
>COG0103 RpsI Ribosomal protein S9 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>pfam00380 Ribosomal_S9 Ribosomal protein S9/S16 Back     alignment and domain information
>PRK00474 rps9p 30S ribosomal protein S9P; Reviewed Back     alignment and domain information
>TIGR03627 arch_S9P archaeal ribosomal protein S9P Back     alignment and domain information
>KOG1697 consensus Back     alignment and domain information
>PTZ00086 40S ribosomal protein S16; Provisional Back     alignment and domain information
>KOG1753 consensus Back     alignment and domain information
>TIGR02903 spore_lon_C ATP-dependent protease, Lon family; InterPro: IPR014252 This entry shows some relation to the widely distributed ATP-dependent protease La, also called Lon or LonA (IPR004815 from INTERPRO), but is more closely related to LonB (IPR014251 from INTERPRO), a LonA paralog found only in endospore-forming bacteria Back     alignment and domain information
>TIGR01193 bacteriocin_ABC ABC-type bacteriocin transporter; InterPro: IPR005897 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems Back     alignment and domain information
>TIGR00958 3a01208 antigen peptide transporter 2; InterPro: IPR005293 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target170 30S ribosomal protein S9 [Candidatus Liberibacter asiat
3bbn_I197 Homology Model For The Spinach Chloroplast 30s Subu 1e-35
3fih_I127 Ternary Complex-Bound E.Coli 70s Ribosome. This Ent 9e-35
1vs5_I130 Crystal Structure Of The Bacterial Ribosome From Es 1e-34
1p6g_I129 Real Space Refined Coordinates Of The 30s Subunit F 1e-34
2gy9_I126 Structure Of The 30s Subunit Of A Pre-Translocation 1e-34
2hgi_L128 Crystal Structure Of The 70s Thermus Thermophilus R 3e-34
1fjg_I128 Structure Of The Thermus Thermophilus 30s Ribosomal 9e-34
1pns_I127 Crystal Structure Of A Streptomycin Dependent Ribos 9e-34
2zkq_i146 Structure Of A Mammalian Ribosomal 40s Subunit With 3e-23
3izb_I143 Localization Of The Small Subunit Ribosomal Protein 5e-23
1s1h_I142 Structure Of The Ribosomal 80s-Eef2-Sordarin Comple 6e-23
3jyv_I138 Structure Of The 40s Rrna And Proteins And PE TRNA 8e-23
3iz6_I149 Localization Of The Small Subunit Ribosomal Protein 9e-23
2xzm_I145 Crystal Structure Of The Eukaryotic 40s Ribosomal S 3e-19
gi|188036210|pdb|3BBN|I Chain I, Homology Model For The Spinach Chloroplast 30s Subunit Fitted To 9.4a Cryo-Em Map Of The 70s Chlororibosome. Length = 197 Back     alignment and structure
 Score =  152 bits (385), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 65/171 (38%), Positives = 89/171 (52%), Gaps = 1/171 (0%)

Query: 1   MEDIENIRDIIEQQGGTLTEENTSQPEETSSSPAIHSRKVDQWQRSYATGKRKTSIARVW 60
           + +   ++ ++            ++  +               Q    TG+RK +IARV 
Sbjct: 27  LSNPAVVKPLVITATSATAPVEVAETADLEKFVKSRLPGGFAAQTVIGTGRRKCAIARVV 86

Query: 61  IKSGSGKFTINYVDISKY-FTQDLLVLNIKRPFNTVSQDNMYDVFATVSGGGLSGQASAI 119
           ++ G+GKF INY D  +Y     L +  +K P  T+  +  YDVF    GGGLSGQA AI
Sbjct: 87  LQEGTGKFIINYRDAKEYLQGNPLWLQYVKTPLATLGYETNYDVFVKAHGGGLSGQAQAI 146

Query: 120 CHGVAKALTYFQPDLRPQIKKGGFLTRDSRIVERKKYGKAKARRSFQFSKR 170
             GVA+AL       R  +K+ G LTRDSRIVERKK G  KAR++ QFSKR
Sbjct: 147 SLGVARALLKVSASHRAPLKQEGLLTRDSRIVERKKPGLKKARKAPQFSKR 197


>gi|224510730|pdb|3FIH|I Chain I, Ternary Complex-Bound E.Coli 70s Ribosome. This Entry Consists Of The 30s Subunit, Trnas And The Ternary Complex. Length = 127 Back     alignment and structure
gi|116666556|pdb|1VS5|I Chain I, Crystal Structure Of The Bacterial Ribosome From Escherichia Coli In Complex With The Antibiotic Kasugamyin At 3.5a Resolution. This File Contains The 30s Subunit Of One 70s Ribosome. The Entire Crystal Structure Contains Two 70s Ribosomes And Is Described In Remark 400. Length = 130 Back     alignment and structure
>gi|33357886|pdb|1P6G|I Chain I, Real Space Refined Coordinates Of The 30s Subunit Fitted Into The Low Resolution Cryo-Em Map Of The Ef-G.Gtp State Of E. Coli 70s Ribosome Length = 129 Back     alignment and structure
>gi|116667418|pdb|2GY9|I Chain I, Structure Of The 30s Subunit Of A Pre-Translocational E. Coli Ribosome Obtained By Fitting Atomic Models For Rna And Protein Components Into Cryo-Em Map Emd-1056 Length = 126 Back     alignment and structure
gi|119389720|pdb|2HGI|L Chain L, Crystal Structure Of The 70s Thermus Thermophilus Ribosome Showing How The 16s 3'-End Mimicks Mrna E And P Codons. This Entry 2hgi Contains 30s Ribosomal Subunit. The 50s Ribosomal Subunit Can Be Found In Pdb Entry 2hgj. Length = 128 Back     alignment and structure
gi|10835593|pdb|1FJG|I Chain I, Structure Of The Thermus Thermophilus 30s Ribosomal Subunit In Complex With The Antibiotics Streptomycin, Spectinomycin, And Paromomycin Length = 128 Back     alignment and structure
>gi|34811537|pdb|1PNS|I Chain I, Crystal Structure Of A Streptomycin Dependent Ribosome From E. Coli, 30s Subunit Of 70s Ribosome. This File, 1pns, Contains The 30s Subunit, Two Trnas, And One Mrna Molecule. The 50s Ribosomal Subunit Is In File 1pnu. Length = 127 Back     alignment and structure
gi|187609262|pdb|2ZKQ|II Chain i, Structure Of A Mammalian Ribosomal 40s Subunit Within An 80s Complex Obtained By Docking Homology Models Of The Rna And Proteins Into An 8.7 A Cryo-Em Map Length = 146 Back     alignment and structure
gi|313103672|pdb|3IZB|I Chain I, Localization Of The Small Subunit Ribosomal Proteins Into A 6.1 A Cryo-Em Map Of Saccharomyces Cerevisiae Translating 80s Ribosome Length = 143 Back     alignment and structure
>gi|49258828|pdb|1S1H|I Chain I, Structure Of The Ribosomal 80s-Eef2-Sordarin Complex From Yeast Obtained By Docking Atomic Models For Rna And Protein Components Into A 11.7 A Cryo-Em Map. This File, 1s1h, Contains 40s Subunit. The 60s Ribosomal Subunit Is In File 1s1i Length = 142 Back     alignment and structure
>gi|281500814|pdb|3JYV|I Chain I, Structure Of The 40s Rrna And Proteins And PE TRNA FOR EUKARYOTIC Ribosome Based On Cryo-Em Map Of Thermomyces Lanuginosus Ribosome At 8.9a Resolution Length = 138 Back     alignment and structure
gi|313103634|pdb|3IZ6|I Chain I, Localization Of The Small Subunit Ribosomal Proteins Into A 5.5 A Cryo-Em Map Of Triticum Aestivum Translating 80s Ribosome Length = 149 Back     alignment and structure
>gi|319443364|pdb|2XZM|I Chain I, Crystal Structure Of The Eukaryotic 40s Ribosomal Subunit In Complex With Initiation Factor 1. This File Contains The 40s Subunit And Initiation Factor For Molecule 1 Length = 145 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target170 30S ribosomal protein S9 [Candidatus Liberibacter asiat
3ofo_I127 30S ribosomal protein S9; protein biosynthesis, ribosom 1e-46
3bbn_I197 Ribosomal protein S9; small ribosomal subunit, spinach 3e-41
3i1m_I130 30S ribosomal protein S9; ribosome structure, protein-R 3e-38
2vqe_I128 30S ribosomal protein S9, 30S ribosomal protein S6; tRN 1e-37
2zkq_i146 40S ribosomal protein S16E; protein-RNA complex, 40S ri 8e-33
3jyv_I138 40S ribosomal protein S16(A); eukaryotic ribosome, RACK 1e-32
>3ofo_I 30S ribosomal protein S9; protein biosynthesis, ribosomes, RNA, tRNA, transfer, eryThr ketolide, macrolide, antibiotic, EXIT, peptidyl; 3.10A {Escherichia coli} PDB: 3fih_I* 3iy8_I 2wwl_I 3ofp_I 2qal_I* 1p6g_I 1p87_I 2aw7_I 2avy_I 2i2u_I 2i2p_I* 2qan_I* 2qb9_I* 2qbb_I* 2qbd_I 2qbf_I 2qbh_I* 2qbj_I* 2qou_I* 2qow_I* ... Length = 127 Back     alignment and structure
 Score =  180 bits (459), Expect = 1e-46
 Identities = 60/124 (48%), Positives = 83/124 (66%)

Query: 47  YATGKRKTSIARVWIKSGSGKFTINYVDISKYFTQDLLVLNIKRPFNTVSQDNMYDVFAT 106
           Y TG+RK+S ARV+IK G+GK  IN   + +YF ++   + +++P   V      D++ T
Sbjct: 4   YGTGRRKSSAARVFIKPGNGKIVINQRSLEQYFGRETARMVVRQPLELVDMVEKLDLYIT 63

Query: 107 VSGGGLSGQASAICHGVAKALTYFQPDLRPQIKKGGFLTRDSRIVERKKYGKAKARRSFQ 166
           V GGG+SGQA AI HG+ +AL  +   LR +++K GF+TRD+R VERKK G  KARR  Q
Sbjct: 64  VKGGGISGQAGAIRHGITRALMEYDESLRSELRKAGFVTRDARQVERKKVGLRKARRRPQ 123

Query: 167 FSKR 170
           FSKR
Sbjct: 124 FSKR 127


>3bbn_I Ribosomal protein S9; small ribosomal subunit, spinach chloroplast ribosome, ribonucleoprotein particle, macromolecular complex; 9.40A {Spinacea oleracea} Length = 197 Back     alignment and structure
>3i1m_I 30S ribosomal protein S9; ribosome structure, protein-RNA complex, ribonucleoprotein, ribosomal protein, RNA-binding, rRNA-binding, antibiotic resistance; 3.19A {Escherichia coli k-12} PDB: 1vs7_I* 3e1a_W 3e1c_W 1vs5_I 3i1o_I 3i1q_I 3i1s_I 3i1z_I 3i21_I 2qal_I* 1p6g_I 1p87_I 2aw7_I 2avy_I 2i2u_I 2i2p_I* 2qan_I* 2qb9_I* 2qbb_I* 2qbd_I ... Length = 130 Back     alignment and structure
>2vqe_I 30S ribosomal protein S9, 30S ribosomal protein S6; tRNA-binding, rRNA-binding, metal-binding, zinc-finger, translation; HET: TM2 PAR; 2.5A {Thermus thermophilus} SCOP: d.14.1.1 PDB: 1gix_L* 1hnw_I* 1hnx_I* 1hnz_I* 1hr0_I 1i94_I* 1i95_I* 1i96_I* 1i97_I* 1ibk_I* 1ibl_I* 1ibm_I 1j5e_I 1jgo_L* 1jgp_L* 1jgq_L* 1ml5_L* 1n32_I* 1n33_I* 1n34_I ... Length = 128 Back     alignment and structure
>2zkq_i 40S ribosomal protein S16E; protein-RNA complex, 40S ribosomal subunit, ribosomal protein/RNA complex; 8.70A {Canis familiaris} Length = 146 Back     alignment and structure
>3jyv_I 40S ribosomal protein S16(A); eukaryotic ribosome, RACK1 protein, flexible fitting; HET: 2MG H2U M2G OMC OMG YYG PSU 5MC 7MG 5MU 1MA; 8.90A {Thermomyces lanuginosus} PDB: 1s1h_I Length = 138 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target170 30S ribosomal protein S9 [Candidatus Liberibacter asiat
3bbn_I197 Ribosomal protein S9; small ribosomal subunit, spinach 100.0
2vqe_I128 30S ribosomal protein S9, 30S ribosomal protein S6; tRN 100.0
3ofo_I127 30S ribosomal protein S9; protein biosynthesis, ribosom 100.0
3jyv_I138 40S ribosomal protein S16(A); eukaryotic ribosome, RACK 100.0
2zkq_i146 40S ribosomal protein S16E; protein-RNA complex, 40S ri 100.0
>3bbn_I Ribosomal protein S9; small ribosomal subunit, spinach chloroplast ribosome, ribonucleoprotein particle, macromolecular complex; 9.40A {Spinacea oleracea} Back     alignment and structure
Probab=100.00  E-value=0  Score=364.62  Aligned_cols=135  Identities=48%  Similarity=0.682  Sum_probs=128.7

Q ss_pred             CCCCCCCCCCCEEEEECCCEEEEEEEECCCCEEEEECCCHHHHCC-CHHHHHHHHHHHHHHCCCCCEEEEEEEECCCCCH
Q ss_conf             346545435500131112108999998189739994100888446-9899999999998738566410799982598301
Q gi|254780293|r   36 HSRKVDQWQRSYATGKRKTSIARVWIKSGSGKFTINYVDISKYFT-QDLLVLNIKRPFNTVSQDNMYDVFATVSGGGLSG  114 (170)
Q Consensus        36 ~~~~~d~~g~~~~tGrRKtsvArV~l~~GsG~I~INgk~~~~Yf~-~~~~r~~i~~Pl~~~~~~~~~Di~~~V~GGG~sg  114 (170)
                      ..+.....+..|||||||+|+|+|||++|+|+|+|||+|+++||+ ++.+++.+++||.+++.+++|||+|+|+|||+||
T Consensus        62 ~~~~~~a~~~i~gtGRRKtAiArV~l~~GsGkI~INgk~l~~YF~~~~~~~~~v~~PL~~t~~~~kyDI~v~V~GGG~sG  141 (197)
T 3bbn_I           62 RLPGGFAAQTVIGTGRRKCAIARVVLQEGTGKFIINYRDAKEYLQGNPLWLQYVKTPLATLGYETNYDVFVKAHGGGLSG  141 (197)
T ss_dssp             ---------CBCCCCEETTEEEEEEEEESSCCEEETTEEHHHHSCSCCGGGTTTSHHHHTTTCTTTEEEEEEEESSCHHH
T ss_pred             HCCCCCCCEEEEEECCCCCEEEEEEEEECCEEEEECCCCHHHHCCCCHHHHHHHHHHHHHHCCCCCEEEEEEEECCCHHH
T ss_conf             07776441179864688157999999807438999993489977947999998621477745477424899996897576


Q ss_pred             HHHHHHHHHHHHHHHHCHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             88899999999997657634487997798335755416759528984335430579
Q gi|254780293|r  115 QASAICHGVAKALTYFQPDLRPQIKKGGFLTRDSRIVERKKYGKAKARRSFQFSKR  170 (170)
Q Consensus       115 Qa~AirlaIarAL~~~~p~~r~~Lk~~glLt~D~R~~ErKK~G~~kARk~~q~skR  170 (170)
                      ||+||||||||||+.++|++++.||++||||+|+|++||||||++||||+||||||
T Consensus       142 QA~AIRlaIARAL~~~~p~~r~~Lk~~glLtrD~R~~ERKK~G~~kARk~~Q~SKR  197 (197)
T 3bbn_I          142 QAQAISLGVARALLKVSASHRAPLKQEGLLTRDSRIVERKKPGLKKARKAPQFSKR  197 (197)
T ss_dssp             HHHHHHHHHHHHTTTSCGGGSHHHHTTTCSSCCCCCCCCCCTTSSSTTCCCCCCCC
T ss_pred             HHHHHHHHHHHHHHHHCHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
T ss_conf             89999999999999979787788987769215741235676787565426255679



>2vqe_I 30S ribosomal protein S9, 30S ribosomal protein S6; tRNA-binding, rRNA-binding, metal-binding, zinc-finger, translation; HET: TM2 PAR; 2.5A {Thermus thermophilus} SCOP: d.14.1.1 PDB: 1gix_L* 1hnw_I* 1hnx_I* 1hnz_I* 1hr0_I 1i94_I* 1i95_I* 1i96_I* 1i97_I* 1ibk_I* 1ibl_I* 1ibm_I 1j5e_I 1jgo_L* 1jgp_L* 1jgq_L* 1ml5_L* 1n32_I* 1n33_I* 1n34_I ... Back     alignment and structure
>3ofo_I 30S ribosomal protein S9; protein biosynthesis, ribosomes, RNA, tRNA, transfer, eryThr ketolide, macrolide, antibiotic, EXIT, peptidyl; 3.10A {Escherichia coli} PDB: 3fih_I* 3iy8_I 2wwl_I 3ofp_I 2qal_I* 1p6g_I 1p87_I 2aw7_I 2avy_I 2i2u_I 2i2p_I* 2qan_I* 2qb9_I* 2qbb_I* 2qbd_I 2qbf_I 2qbh_I* 2qbj_I* 2qou_I* 2qow_I* ... Back     alignment and structure
>3jyv_I 40S ribosomal protein S16(A); eukaryotic ribosome, RACK1 protein, flexible fitting; HET: 2MG H2U M2G OMC OMG YYG PSU 5MC 7MG 5MU 1MA; 8.90A {Thermomyces lanuginosus} PDB: 1s1h_I Back     alignment and structure
>2zkq_i 40S ribosomal protein S16E; protein-RNA complex, 40S ribosomal subunit, ribosomal protein/RNA complex; 8.70A {Canis familiaris} Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 170 30S ribosomal protein S9 [Candidatus Liberibacter asiat
d2gy9i1126 d.14.1.1 (I:4-129) Ribosomal protein S9 {Escherichia co 1e-39
d2vqei1127 d.14.1.1 (I:2-128) Ribosomal protein S9 {Thermus thermo 9e-39
>d2gy9i1 d.14.1.1 (I:4-129) Ribosomal protein S9 {Escherichia coli [TaxId: 562]} Length = 126 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Ribosomal protein S5 domain 2-like
superfamily: Ribosomal protein S5 domain 2-like
family: Translational machinery components
domain: Ribosomal protein S9
species: Escherichia coli [TaxId: 562]
 Score =  156 bits (396), Expect = 1e-39
 Identities = 60/124 (48%), Positives = 83/124 (66%)

Query: 47  YATGKRKTSIARVWIKSGSGKFTINYVDISKYFTQDLLVLNIKRPFNTVSQDNMYDVFAT 106
           Y TG+RK+S ARV+IK G+GK  IN   + +YF ++   + +++P   V      D++ T
Sbjct: 3   YGTGRRKSSAARVFIKPGNGKIVINQRSLEQYFGRETARMVVRQPLELVDMVEKLDLYIT 62

Query: 107 VSGGGLSGQASAICHGVAKALTYFQPDLRPQIKKGGFLTRDSRIVERKKYGKAKARRSFQ 166
           V GGG+SGQA AI HG+ +AL  +   LR +++K GF+TRD+R VERKK G  KARR  Q
Sbjct: 63  VKGGGISGQAGAIRHGITRALMEYDESLRSELRKAGFVTRDARQVERKKVGLRKARRRPQ 122

Query: 167 FSKR 170
           FSKR
Sbjct: 123 FSKR 126


>d2vqei1 d.14.1.1 (I:2-128) Ribosomal protein S9 {Thermus thermophilus [TaxId: 274]} Length = 127 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target170 30S ribosomal protein S9 [Candidatus Liberibacter asiat
d2gy9i1126 Ribosomal protein S9 {Escherichia coli [TaxId: 562]} 100.0
d2vqei1127 Ribosomal protein S9 {Thermus thermophilus [TaxId: 274] 100.0
>d2gy9i1 d.14.1.1 (I:4-129) Ribosomal protein S9 {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Ribosomal protein S5 domain 2-like
superfamily: Ribosomal protein S5 domain 2-like
family: Translational machinery components
domain: Ribosomal protein S9
species: Escherichia coli [TaxId: 562]
Probab=100.00  E-value=0  Score=341.01  Aligned_cols=125  Identities=48%  Similarity=0.792  Sum_probs=123.4

Q ss_pred             CEEEEECCCEEEEEEEECCCCEEEEECCCHHHHCCCHHHHHHHHHHHHHHCCCCCEEEEEEEECCCCCHHHHHHHHHHHH
Q ss_conf             00131112108999998189739994100888446989999999999873856641079998259830188899999999
Q gi|254780293|r   46 SYATGKRKTSIARVWIKSGSGKFTINYVDISKYFTQDLLVLNIKRPFNTVSQDNMYDVFATVSGGGLSGQASAICHGVAK  125 (170)
Q Consensus        46 ~~~tGrRKtsvArV~l~~GsG~I~INgk~~~~Yf~~~~~r~~i~~Pl~~~~~~~~~Di~~~V~GGG~sgQa~AirlaIar  125 (170)
                      .|||||||||+|+|||++|+|+|+||++|+++||++..+++.+++||.+++..++|||+|+|+|||+||||+||||||||
T Consensus         2 ~y~tGrRKtaiArv~l~~G~G~I~IN~~~~~~yf~~~~~~~~~~~pl~~~~~~~~~di~v~V~GGG~sgQa~Air~aIaR   81 (126)
T d2gy9i1           2 YYGTGRRKSSAARVFIKPGNGKIVINQRSLEQYFGRETARMVVRQPLELVDMVEKLDLYITVKGGGISGQAGAIRHGITR   81 (126)
T ss_dssp             EEECCEETTEEEEEEEEESSSCEEETTEEHHHHTTTCGGGGGGGHHHHHTTCGGGEEEEEEEESSCHHHHHHHHHHHHHH
T ss_pred             CCCCCCCCCEEEEEEEEECCCEEEECCHHHHHHCCHHHHHHHHHHHHHHHCCCCCEEEEEEEECCCCHHHHHHHHHHHHH
T ss_conf             50316251589999999267679787045755353576999997678763655514689998469813589899999999


Q ss_pred             HHHHHCHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             997657634487997798335755416759528984335430579
Q gi|254780293|r  126 ALTYFQPDLRPQIKKGGFLTRDSRIVERKKYGKAKARRSFQFSKR  170 (170)
Q Consensus       126 AL~~~~p~~r~~Lk~~glLt~D~R~~ErKK~G~~kARk~~q~skR  170 (170)
                      ||+.++|++++.|+++||||+|||++||||||++||||+||||||
T Consensus        82 aLv~~~~~~r~~lk~~glLt~D~R~~ErKK~G~~kARk~~Q~skR  126 (126)
T d2gy9i1          82 ALMEYDESLRSELRKAGFVTRDARQVERKKVGLRKARRRPQFSKR  126 (126)
T ss_dssp             HHHHHCGGGHHHHTTTTTTSCCCCCCCCCCSSSSSSSSCCCCSCC
T ss_pred             HHHHHCHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
T ss_conf             998869787899988769026743354477898664527355679



>d2vqei1 d.14.1.1 (I:2-128) Ribosomal protein S9 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 170 30S ribosomal protein S9 [Candidatus Liberibacter
3i1m_I_130 (I:) 30S ribosomal protein S9; ribosome structure, 3e-41
2vqe_I_128 (I:) 30S ribosomal protein S9, 30S ribosomal prote 1e-40
2zkq_i_146 (i:) 40S ribosomal protein S16E; protein-RNA compl 2e-37
3jyv_I_138 (I:) 40S ribosomal protein S16(A); eukaryotic ribo 8e-35
3bbn_I_197 (I:) Ribosomal protein S9; small ribosomal subunit 5e-39
>3i1m_I (I:) 30S ribosomal protein S9; ribosome structure, protein-RNA complex, ribonucleoprotein, ribosomal protein, RNA-binding, rRNA-binding, antibiotic resistance; 3.19A {Escherichia coli k-12} PDB: 1vs7_I* 3e1a_W 3e1c_W 1vs5_I 3i1o_I 3i1q_I 3i1s_I 3i1z_I 3i21_I 2qal_I* 1p6g_I 1p87_I 2aw7_I 2avy_I 2i2u_I 2i2p_I* 2qan_I* 2qb9_I* 2qbb_I* 2qbd_I ...Length = 130 Back     alignment and structure
 Score =  162 bits (411), Expect = 3e-41
 Identities = 60/127 (47%), Positives = 84/127 (66%)

Query: 44  QRSYATGKRKTSIARVWIKSGSGKFTINYVDISKYFTQDLLVLNIKRPFNTVSQDNMYDV 103
            + Y TG+RK+S ARV+IK G+GK  IN   + +YF ++   + +++P   V      D+
Sbjct: 4   NQYYGTGRRKSSAARVFIKPGNGKIVINQRSLEQYFGRETARMVVRQPLELVDMVEKLDL 63

Query: 104 FATVSGGGLSGQASAICHGVAKALTYFQPDLRPQIKKGGFLTRDSRIVERKKYGKAKARR 163
           + TV GGG+SGQA AI HG+ +AL  +   LR +++K GF+TRD+R VERKK G  KARR
Sbjct: 64  YITVKGGGISGQAGAIRHGITRALMEYDESLRSELRKAGFVTRDARQVERKKVGLRKARR 123

Query: 164 SFQFSKR 170
             QFSKR
Sbjct: 124 RPQFSKR 130


>2vqe_I (I:) 30S ribosomal protein S9, 30S ribosomal protein S6; tRNA-binding, rRNA-binding, metal-binding, zinc-finger, translation; HET: TM2 PAR; 2.5A {Thermus thermophilus}Length = 128 Back     alignment and structure
>2zkq_i (i:) 40S ribosomal protein S16E; protein-RNA complex, 40S ribosomal subunit, ribosomal protein/RNA complex; 8.70A {Canis familiaris}Length = 146 Back     alignment and structure
>3jyv_I (I:) 40S ribosomal protein S16(A); eukaryotic ribosome, RACK1 protein, flexible fitting; HET: 2MG H2U M2G OMC OMG YYG PSU 5MC 7MG 5MU 1MA; 8.90A {Thermomyces lanuginosus} PDB: 1s1h_ILength = 138 Back     alignment and structure
>3bbn_I (I:) Ribosomal protein S9; small ribosomal subunit, spinach chloroplast ribosome, ribonucleoprotein particle, macromolecular complex; 9.40A {Spinacea oleracea}Length = 197 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target170 30S ribosomal protein S9 [Candidatus Liberibacter asiat
3bbn_I_197 Ribosomal protein S9; small ribosomal subunit, spi 100.0
2vqe_I_128 30S ribosomal protein S9, 30S ribosomal protein S6 100.0
3i1m_I_130 30S ribosomal protein S9; ribosome structure, prot 100.0
2zkq_i_146 40S ribosomal protein S16E; protein-RNA complex, 4 100.0
3jyv_I_138 40S ribosomal protein S16(A); eukaryotic ribosome, 100.0
>3bbn_I (I:) Ribosomal protein S9; small ribosomal subunit, spinach chloroplast ribosome, ribonucleoprotein particle, macromolecular complex; 9.40A {Spinacea oleracea} Back     alignment and structure
Probab=100.00  E-value=0  Score=361.32  Aligned_cols=145  Identities=45%  Similarity=0.624  Sum_probs=136.3

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCEEEEECCCEEEEEEEECCCCEEEEECCCHHHHCC-CHHHHHHHHHHHHHHCCCCCEEEE
Q ss_conf             3323223222346545435500131112108999998189739994100888446-989999999999873856641079
Q gi|254780293|r   26 PEETSSSPAIHSRKVDQWQRSYATGKRKTSIARVWIKSGSGKFTINYVDISKYFT-QDLLVLNIKRPFNTVSQDNMYDVF  104 (170)
Q Consensus        26 ~~~~~~~~~~~~~~~d~~g~~~~tGrRKtsvArV~l~~GsG~I~INgk~~~~Yf~-~~~~r~~i~~Pl~~~~~~~~~Di~  104 (170)
                      .............+.|..+++|++||||+|+|+|||++|+|+|+|||+|+++||+ +..+++.++.||.+++..++|||+
T Consensus        52 ~~~~~~~~~~~~~~~~~~~~~~~~GrRKta~A~V~l~~GtG~i~INg~~~~~yf~~~~~~~~~~~~pl~~~~~~~~~dv~  131 (197)
T 3bbn_I           52 TADLEKFVKSRLPGGFAAQTVIGTGRRKCAIARVVLQEGTGKFIINYRDAKEYLQGNPLWLQYVKTPLATLGYETNYDVF  131 (197)
T ss_dssp             -------------------CBCCCCEETTEEEEEEEEESSCCEEETTEEHHHHSCSCCGGGTTTSHHHHTTTCTTTEEEE
T ss_pred             HHHHHHHHHHCCCCCCCCEEEEEECCCCCEEEEEEEECCCEEEEECCCCHHHHCCCCHHHHHHHHHHHHHHCCCCCCEEE
T ss_conf             33266664320677534116885468805799999983742899999048997791699999998888874115762069


Q ss_pred             EEEECCCCCHHHHHHHHHHHHHHHHHCHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             998259830188899999999997657634487997798335755416759528984335430579
Q gi|254780293|r  105 ATVSGGGLSGQASAICHGVAKALTYFQPDLRPQIKKGGFLTRDSRIVERKKYGKAKARRSFQFSKR  170 (170)
Q Consensus       105 ~~V~GGG~sgQa~AirlaIarAL~~~~p~~r~~Lk~~glLt~D~R~~ErKK~G~~kARk~~q~skR  170 (170)
                      |+|+|||+||||+||||||||||+.++|++++.|+++||||+|+|++||||||++||||+||||||
T Consensus       132 ~~v~GGG~sgQa~Air~aiaraL~~~~~~~~~~l~~~glLt~D~R~~ErKK~G~~kARk~~q~skR  197 (197)
T 3bbn_I          132 VKAHGGGLSGQAQAISLGVARALLKVSASHRAPLKQEGLLTRDSRIVERKKPGLKKARKAPQFSKR  197 (197)
T ss_dssp             EEEESSCHHHHHHHHHHHHHHHTTTSCGGGSHHHHTTTCSSCCCCCCCCCCTTSSSTTCCCCCCCC
T ss_pred             EEEECCCCCCCCHHHHHHHHHHHHHHCHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
T ss_conf             999518965410217999999999979776798988749126741124577897566426244679



>2vqe_I (I:) 30S ribosomal protein S9, 30S ribosomal protein S6; tRNA-binding, rRNA-binding, metal-binding, zinc-finger, translation; HET: TM2 PAR; 2.5A {Thermus thermophilus} Back     alignment and structure
>3i1m_I (I:) 30S ribosomal protein S9; ribosome structure, protein-RNA complex, ribonucleoprotein, ribosomal protein, RNA-binding, rRNA-binding, antibiotic resistance; 3.19A {Escherichia coli k-12} PDB: 1vs7_I* 3e1a_W 3e1c_W 1vs5_I 3i1o_I 3i1q_I 3i1s_I 3i1z_I 3i21_I 2qal_I* 1p6g_I 1p87_I 2aw7_I 2avy_I 2i2u_I 2i2p_I* 2qan_I* 2qb9_I* 2qbb_I* 2qbd_I ... Back     alignment and structure
>2zkq_i (i:) 40S ribosomal protein S16E; protein-RNA complex, 40S ribosomal subunit, ribosomal protein/RNA complex; 8.70A {Canis familiaris} Back     alignment and structure
>3jyv_I (I:) 40S ribosomal protein S16(A); eukaryotic ribosome, RACK1 protein, flexible fitting; HET: 2MG H2U M2G OMC OMG YYG PSU 5MC 7MG 5MU 1MA; 8.90A {Thermomyces lanuginosus} PDB: 1s1h_I Back     alignment and structure