254780320

254780320

translation initiation factor IF-3

GeneID in NCBI database:8209305Locus tag:CLIBASIA_01025
Protein GI in NCBI database:254780320Protein Accession:YP_003064733.1
Gene range:-(211525, 211935)Protein Length:136aa
Gene description:translation initiation factor IF-3
COG prediction:[J] Translation initiation factor 3 (IF-3)
KEGG prediction:infC; translation initiation factor IF-3; K02520 translation initiation factor IF-3
SEED prediction:Translation initiation factor 3
Pathway involved in KEGG:not defined
Subsystem involved in SEED:Translation initiation factors bacterial
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130------
MQMAQEANLDLVEIDSSVTPSVCKILDLRKLRYTIQKNAVEARKKQKSTGIKEVKMRPVIDLHDLQVKLKAIDGFLRDGCKVKISVKFRGREIMHQDLGRELLSNIKERFGEISRIDCEPKFEGRQMIMILSSKCV
cccHHHccccEEEEcccccccEEEEEccHHHHHHHHHHHHHHHccccccEEEEEEEcccccccHHHHHHHHHHHHHHcccEEEEEEEEcccccccHHHHHHHHHHHHHHHHHHHHHHccccccccEEEEEEEcccc
ccHHHHccccEEEEcccccccEEEEEccccccHHHHHHHHHHHHHccEEEEEEEEEcccccHHHHHHHHHHHHHHHHcccEEEEEEEcccccccHHHHHHHHHHHHHHHccccEEEEEEEEEEccEEEEEEEEccc
MQMAQEANLDLveidssvtpsvckildlRKLRYTIQKNAVEARKKQKstgikevkmrpvidlHDLQVKLKAIDGFLRDGCKVKISVKFRGREIMHQDLGRELLSNIKERfgeisridcepkfegRQMIMILSSKCV
MQMAQEANLdlveidssvtpsvckildlrkLRYTIQKNAVearkkqkstgikevkmrpvidlhdLQVKLKaidgflrdgcKVKISVkfrgreimhqdlGRELLSNIKERfgeisridcepkfegrqmimilsskcv
MQMAQEANLDLVEIDSSVTPSVCKILDLRKLRYTIQKNAVEARKKQKSTGIKEVKMRPVIDLHDLQVKLKAIDGFLRDGCKVKISVKFRGREIMHQDLGRELLSNIKERFGEISRIDCEPKFEGRQMIMILSSKCV
*Q*AQEANLDLVEIDSSVTPSVCKILDLRKL******************GIKEVKMRPVIDLHDLQVKLKAIDGFLRDGCKVKISVKFRGREIMHQDLGRELLSNIKERFGEISRIDCEPKFEGRQMIMILSSK**
********LDLVEIDSSVTPSVCKILDLRKLRYTIQKNA***********IKEVKMRPVIDLHDLQVKLKAIDGFLRDGCKVKISVKFRGREIMHQDLGRELLSNIKERFGEISRIDCEPKFEGRQMIMILSSKCV
MQMAQEANLDLVEIDSSVTPSVCKILDLRKLRYTIQKNAVEARKKQKSTGIKEVKMRPVIDLHDLQVKLKAIDGFLRDGCKVKISVKFRGREIMHQDLGRELLSNIKERFGEISRIDCEPKFEGRQMIMILSSKCV
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQMAQEANLDLVEIDSSVTPSVCKILDLRKLRYTIQKNAVEARKKQKSTGIKEVKMRPVIDLHDLQVKLKAIDGFLRDGCKVKISVKFRGREIMHQDLGRELLSNIKERFGEISRIDCEPKFEGRQMIMILSSKCV
MQMAQEANLDLVEIDSSVTPSVCKILDLRKLRYTIQKNAVEARKKQKSTGIKEVKMRPVIDLHDLQVKLKAIDGFLRDGCKVKISVKFRGREIMHQDLGRELLSNIKERFGEISRIDCEPKFEGRQMIMILSSKCV
MQMAQEANLDLVEIDSSVTPSVCKILDLRKLRYTIQKNAVEARKKQKSTGIKEVKMRPVIDLHDLQVKLKAIDGFLRDGCKVKISVKFRGREIMHQDLGRELLSNIKERFGEISRIDCEPKFEGRQMIMILSSKCV

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target136 translation initiation factor IF-3 [Candidatus Liberiba
315122256161 translation initiation factor IF-3 [Candidatus Liberiba 1 1e-46
222147168151 translation initiation factor IF-3 [Agrobacterium vitis 1 1e-38
319404957164 translation initiation factor IF-3 [Bartonella sp. AR 1 1 5e-38
190889925168 translation initiation factor IF-3 protein [Rhizobium e 1 5e-38
86355918168 translation initiation factor IF-3 [Rhizobium etli CFN 1 5e-38
20532093177 RecName: Full=Translation initiation factor IF-3 Length 1 5e-38
15887604140 translation initiation factor IF-3 [Agrobacterium tumef 1 5e-38
222084528183 translation initiation factor IF-3 [Agrobacterium radio 1 5e-38
209551835178 translation initiation factor IF-3 [Rhizobium leguminos 1 6e-38
319403531164 translation initiation factor IF-3 [Bartonella rochalim 1 6e-38
>gi|315122256|ref|YP_004062745.1| translation initiation factor IF-3 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 161 Back     alignment and organism information
 Score =  189 bits (480), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 91/134 (67%), Positives = 108/134 (80%)

Query: 1   MQMAQEANLDLVEIDSSVTPSVCKILDLRKLRYTIQKNAVEARKKQKSTGIKEVKMRPVI 60
           ++ AQEANLDLVEIDSS  P +CK+LDLRKL+YT+QKNA EARKKQKS   KEVK+ P I
Sbjct: 28  LKKAQEANLDLVEIDSSANPPICKMLDLRKLKYTMQKNAAEARKKQKSVDTKEVKLSPGI 87

Query: 61  DLHDLQVKLKAIDGFLRDGCKVKISVKFRGREIMHQDLGRELLSNIKERFGEISRIDCEP 120
             +D +VKL++IDGFLR GCKVK+ V+FRGRE+M+ D G  LL+ IK    EISR+D EP
Sbjct: 88  KSNDYEVKLRSIDGFLRGGCKVKVYVRFRGREMMYPDQGYNLLTKIKNHVSEISRVDYEP 147

Query: 121 KFEGRQMIMILSSK 134
           KFEGRQMIMILS K
Sbjct: 148 KFEGRQMIMILSPK 161


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|222147168|ref|YP_002548125.1| translation initiation factor IF-3 [Agrobacterium vitis S4] Length = 151 Back     alignment and organism information
>gi|319404957|emb|CBI78559.1| translation initiation factor IF-3 [Bartonella sp. AR 15-3] Length = 164 Back     alignment and organism information
>gi|190889925|ref|YP_001976467.1| translation initiation factor IF-3 protein [Rhizobium etli CIAT 652] Length = 168 Back     alignment and organism information
>gi|86355918|ref|YP_467810.1| translation initiation factor IF-3 [Rhizobium etli CFN 42] Length = 168 Back     alignment and organism information
>gi|20532093|sp|Q92ST3|IF3_RHIME RecName: Full=Translation initiation factor IF-3 Length = 177 Back     alignment and organism information
>gi|15887604|ref|NP_353285.1| translation initiation factor IF-3 [Agrobacterium tumefaciens str. C58] Length = 140 Back     alignment and organism information
>gi|222084528|ref|YP_002543057.1| translation initiation factor IF-3 [Agrobacterium radiobacter K84] Length = 183 Back     alignment and organism information
>gi|209551835|ref|YP_002283752.1| translation initiation factor IF-3 [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 178 Back     alignment and organism information
>gi|319403531|emb|CBI77112.1| translation initiation factor IF-3 [Bartonella rochalimae ATCC BAA-1498] Length = 164 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target136 translation initiation factor IF-3 [Candidatus Liberiba
PRK00028177 PRK00028, infC, translation initiation factor IF-3; Rev 4e-45
TIGR00168165 TIGR00168, infC, translation initiation factor IF-3 6e-34
CHL00199182 CHL00199, infC, translation initiation factor 3; Provis 7e-26
COG0290176 COG0290, InfC, Translation initiation factor 3 (IF-3) [ 8e-38
pfam0070787 pfam00707, IF3_C, Translation initiation factor IF-3, C 2e-25
pfam0519876 pfam05198, IF3_N, Translation initiation factor IF-3, N 4e-08
>gnl|CDD|178804 PRK00028, infC, translation initiation factor IF-3; Reviewed Back     alignment and domain information
>gnl|CDD|129272 TIGR00168, infC, translation initiation factor IF-3 Back     alignment and domain information
>gnl|CDD|164575 CHL00199, infC, translation initiation factor 3; Provisional Back     alignment and domain information
>gnl|CDD|30638 COG0290, InfC, Translation initiation factor 3 (IF-3) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|144345 pfam00707, IF3_C, Translation initiation factor IF-3, C-terminal domain Back     alignment and domain information
>gnl|CDD|147407 pfam05198, IF3_N, Translation initiation factor IF-3, N-terminal domain Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 136 translation initiation factor IF-3 [Candidatus Liberiba
COG0290176 InfC Translation initiation factor 3 (IF-3) [Translatio 100.0
CHL00199182 infC translation initiation factor 3; Provisional 100.0
PRK00028175 infC translation initiation factor IF-3; Reviewed 100.0
TIGR00168165 infC translation initiation factor IF-3; InterPro: IPR0 99.97
pfam0070787 IF3_C Translation initiation factor IF-3, C-terminal do 99.96
pfam0519876 IF3_N Translation initiation factor IF-3, N-terminal do 99.69
>COG0290 InfC Translation initiation factor 3 (IF-3) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>CHL00199 infC translation initiation factor 3; Provisional Back     alignment and domain information
>PRK00028 infC translation initiation factor IF-3; Reviewed Back     alignment and domain information
>TIGR00168 infC translation initiation factor IF-3; InterPro: IPR001288 Initiation factor 3 (IF-3) (gene infC) is one of the three factors required for the initiation of protein biosynthesis in bacteria Back     alignment and domain information
>pfam00707 IF3_C Translation initiation factor IF-3, C-terminal domain Back     alignment and domain information
>pfam05198 IF3_N Translation initiation factor IF-3, N-terminal domain Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target136 translation initiation factor IF-3 [Candidatus Liberiba
1tig_A94 Translation Initiation Factor 3 C-Terminal Domain L 6e-21
2ife_A100 Translation Initiation Factor If3 From Escherichia 3e-19
1i96_V89 Crystal Structure Of The 30s Ribosomal Subunit From 2e-18
2crq_A112 Solution Structure Of C-Terminal Domain Of Riken Cd 1e-06
1tif_A78 Translation Initiation Factor 3 N-Terminal Domain L 2e-06
>gi|157833956|pdb|1TIG|A Chain A, Translation Initiation Factor 3 C-Terminal Domain Length = 94 Back     alignment and structure
 Score =  103 bits (258), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 34/91 (37%), Positives = 57/91 (62%)

Query: 45  KQKSTGIKEVKMRPVIDLHDLQVKLKAIDGFLRDGCKVKISVKFRGREIMHQDLGRELLS 104
           KQK   +KEV++ P I+ HD   KL+    FL  G KVK +++F+GR I H+++G+ +L 
Sbjct: 1   KQKVINVKEVRLSPTIEEHDFNTKLRNARKFLEKGDKVKATIRFKGRAITHKEIGQRVLD 60

Query: 105 NIKERFGEISRIDCEPKFEGRQMIMILSSKC 135
            + E   +I+ ++  PK +GR M ++L+ K 
Sbjct: 61  RLSEACADIAVVETAPKMDGRNMFLVLAPKN 91


>gi|6729964|pdb|2IFE|A Chain A, Translation Initiation Factor If3 From Escherichia Coli Ribosome Binding Domain (Residues 84-180) Length = 100 Back     alignment and structure
>gi|14278593|pdb|1I96|V Chain V, Crystal Structure Of The 30s Ribosomal Subunit From Thermus Thermophilus In Complex With The Translation Initiation Factor If3 (C-Terminal Domain) Length = 89 Back     alignment and structure
>gi|159163905|pdb|2CRQ|A Chain A, Solution Structure Of C-Terminal Domain Of Riken Cdna 2810012l14 Length = 112 Back     alignment and structure
>gi|157833955|pdb|1TIF|A Chain A, Translation Initiation Factor 3 N-Terminal Domain Length = 78 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target136 translation initiation factor IF-3 [Candidatus Liberiba
2crq_A112 Mitochondrial translational initiation factor 3; riboso 2e-23
1i96_V89 Translation initiation factor IF3; 30S ribosome; HET: W 2e-22
2ife_A100 Protein (translation initiation factor IF3); gene regul 2e-22
1tig_A94 IF3-C, translation initiation factor 3; IF3 C-terminal 4e-21
1tif_A78 IF3-N, translation initiation factor 3; IF3 N-terminal 3e-06
>2crq_A Mitochondrial translational initiation factor 3; ribosome, structural genomics, NPPSFA; NMR {Mus musculus} Length = 112 Back     alignment and structure
 Score =  102 bits (257), Expect = 2e-23
 Identities = 20/95 (21%), Positives = 37/95 (38%), Gaps = 2/95 (2%)

Query: 42  ARKKQKSTGIKEVKMRPVIDLHDLQVKLKAIDGFLRDGCKVKISVKFRGREIMHQDLGRE 101
           +  K   T  KE+     I  HDL  K K I  ++     V++++K R      ++   E
Sbjct: 6   SGPKTGPTMTKELVFSSNIGQHDLDTKSKQIQQWIEKKYHVQVTIKRRKDAEQSEEETEE 65

Query: 102 LLSNIKERFGEISRIDCEPKF--EGRQMIMILSSK 134
           + + I +   +I+     PK    G   + +    
Sbjct: 66  IFNQILQTMPDIATFSSRPKAIRGGTASMCVFRHL 100


>1i96_V Translation initiation factor IF3; 30S ribosome; HET: WO2; 4.20A {Thermus thermophilus} SCOP: d.68.1.1 Length = 89 Back     alignment and structure
>2ife_A Protein (translation initiation factor IF3); gene regulation; NMR {Escherichia coli} SCOP: d.68.1.1 Length = 100 Back     alignment and structure
>1tig_A IF3-C, translation initiation factor 3; IF3 C-terminal domain, ribosome binding factor; 2.00A {Geobacillus stearothermophilus} SCOP: d.68.1.1 Length = 94 Back     alignment and structure
>1tif_A IF3-N, translation initiation factor 3; IF3 N-terminal domain, ribosome binding factor; 1.80A {Geobacillus stearothermophilus} SCOP: d.15.8.1 Length = 78 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target136 translation initiation factor IF-3 [Candidatus Liberiba
2ife_A100 Protein (translation initiation factor IF3); gene regul 99.97
1tig_A94 IF3-C, translation initiation factor 3; IF3 C-terminal 99.97
1i96_V89 Translation initiation factor IF3; 30S ribosome; HET: W 99.97
2crq_A112 Mitochondrial translational initiation factor 3; riboso 99.96
1tif_A78 IF3-N, translation initiation factor 3; IF3 N-terminal 99.69
>2ife_A Protein (translation initiation factor IF3); gene regulation; NMR {Escherichia coli} SCOP: d.68.1.1 Back     alignment and structure
Probab=99.97  E-value=2.9e-32  Score=212.09  Aligned_cols=95  Identities=46%  Similarity=0.748  Sum_probs=91.3

Q ss_pred             HHHHCCCCCCCEEEEEEEECCHHHHHHHHHHHHHHHCCCCCEEEEEEECCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCC
Q ss_conf             21100222220026897400867999999999999603791999999709743573568999999999842243203677
Q gi|254780320|r   41 EARKKQKSTGIKEVKMRPVIDLHDLQVKLKAIDGFLRDGCKVKISVKFRGREIMHQDLGRELLSNIKERFGEISRIDCEP  120 (136)
Q Consensus        41 ~~Kkkq~~~~~KEir~~~~I~~hDl~~K~k~~~~FL~~G~kVki~i~frGRe~~~~e~g~~~l~~i~~~l~~~~~~e~~p  120 (136)
                      ..|++|+.+++|||||+|+||+|||++|+++|++||++||+|+|+|+|||||++|+|.|.++|++|+++|+|+|++|+.|
T Consensus         3 ~qKkkqk~~~vKEIrl~~~I~~hDl~~K~k~a~kFL~~G~kVKv~v~frGRE~~~~e~g~~~l~~i~~~l~d~~~ve~~p   82 (100)
T 2ife_A            3 FQKKKQKVIQVKEIKFRPGTDEGDYQVKLRSLIRFLEEGDKAKITLRFRGREMAHQQIGMEVLNRVKDDLQELAVVESFP   82 (100)
T ss_dssp             -------CCEEEEEEECTTCCHHHHTHHHHHHHHHHHTTEEEEEEECCSSCTTCCSSHHHHHHHHHHHHHTTTEEESCCC
T ss_pred             HHHCCCCCEEEEEEEECCCCCCCHHHHHHHHHHHHHHCCCEEEEEEEECCCCCCCHHHHHHHHHHHHHHHCCCEEEECCC
T ss_conf             23316884267889960787712599999999999977997999999737431498999999999999831512884467


Q ss_pred             -CCCCCEEEEEEEECC
Q ss_conf             -324876999992046
Q gi|254780320|r  121 -KFEGRQMIMILSSKC  135 (136)
Q Consensus       121 -k~~Gr~~~~~l~Pkk  135 (136)
                       +++||+|+|+|+|++
T Consensus        83 ~k~eGr~~~~~l~P~k   98 (100)
T 2ife_A           83 TKIEGRQMIMVLAPKK   98 (100)
T ss_dssp             CCCCSSCCEEEEEECC
T ss_pred             CCCCCCEEEEEEECCC
T ss_conf             6554874999995189



>1tig_A IF3-C, translation initiation factor 3; IF3 C-terminal domain, ribosome binding factor; 2.00A {Geobacillus stearothermophilus} SCOP: d.68.1.1 Back     alignment and structure
>1i96_V Translation initiation factor IF3; 30S ribosome; HET: WO2; 4.20A {Thermus thermophilus} SCOP: d.68.1.1 Back     alignment and structure
>2crq_A Mitochondrial translational initiation factor 3; ribosome, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1tif_A IF3-N, translation initiation factor 3; IF3 N-terminal domain, ribosome binding factor; 1.80A {Geobacillus stearothermophilus} SCOP: d.15.8.1 Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 136 translation initiation factor IF-3 [Candidatus Liberiba
d1tiga_88 d.68.1.1 (A:) Translation initiation factor IF3, C-term 1e-22
d2ifea_91 d.68.1.1 (A:) Translation initiation factor IF3, C-term 3e-22
d1tifa_76 d.15.8.1 (A:) Translation initiation factor IF3, N-term 3e-06
>d1tiga_ d.68.1.1 (A:) Translation initiation factor IF3, C-terminal domain {Bacillus stearothermophilus [TaxId: 1422]} Length = 88 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: IF3-like
superfamily: Translation initiation factor IF3, C-terminal domain
family: Translation initiation factor IF3, C-terminal domain
domain: Translation initiation factor IF3, C-terminal domain
species: Bacillus stearothermophilus [TaxId: 1422]
 Score = 98.6 bits (246), Expect = 1e-22
 Identities = 31/84 (36%), Positives = 54/84 (64%)

Query: 51  IKEVKMRPVIDLHDLQVKLKAIDGFLRDGCKVKISVKFRGREIMHQDLGRELLSNIKERF 110
           +KEV++ P I+ HD   KL+    FL  G KVK +++F+GR I H+++G+ +L  + E  
Sbjct: 3   VKEVRLSPTIEEHDFNTKLRNARKFLEKGDKVKATIRFKGRAITHKEIGQRVLDRLSEAC 62

Query: 111 GEISRIDCEPKFEGRQMIMILSSK 134
            +I+ ++  PK +GR M ++L+ K
Sbjct: 63  ADIAVVETAPKMDGRNMFLVLAPK 86


>d2ifea_ d.68.1.1 (A:) Translation initiation factor IF3, C-terminal domain {Escherichia coli [TaxId: 562]} Length = 91 Back     information, alignment and structure
>d1tifa_ d.15.8.1 (A:) Translation initiation factor IF3, N-terminal domain {Bacillus stearothermophilus [TaxId: 1422]} Length = 76 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target136 translation initiation factor IF-3 [Candidatus Liberiba
d1i96v_86 Translation initiation factor IF3, C-terminal domain {T 99.97
d1tiga_88 Translation initiation factor IF3, C-terminal domain {B 99.97
d2ifea_91 Translation initiation factor IF3, C-terminal domain {E 99.96
d1tifa_76 Translation initiation factor IF3, N-terminal domain {B 99.68
>d1i96v_ d.68.1.1 (V:) Translation initiation factor IF3, C-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: IF3-like
superfamily: Translation initiation factor IF3, C-terminal domain
family: Translation initiation factor IF3, C-terminal domain
domain: Translation initiation factor IF3, C-terminal domain
species: Thermus thermophilus [TaxId: 274]
Probab=99.97  E-value=7.9e-31  Score=202.10  Aligned_cols=86  Identities=38%  Similarity=0.713  Sum_probs=84.8

Q ss_pred             CCEEEEEEEECCHHHHHHHHHHHHHHHCCCCCEEEEEEECCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCEEEE
Q ss_conf             20026897400867999999999999603791999999709743573568999999999842243203677324876999
Q gi|254780320|r   50 GIKEVKMRPVIDLHDLQVKLKAIDGFLRDGCKVKISVKFRGREIMHQDLGRELLSNIKERFGEISRIDCEPKFEGRQMIM  129 (136)
Q Consensus        50 ~~KEir~~~~I~~hDl~~K~k~~~~FL~~G~kVki~i~frGRe~~~~e~g~~~l~~i~~~l~~~~~~e~~pk~~Gr~~~~  129 (136)
                      ++|||+|+|+||+|||++|+++|++||++||+|+|+|+|||||++|+|.|.++|++|+++|+++|++|++|+++|++|+|
T Consensus         1 evKEIrl~~~I~~hDl~~K~k~a~~FL~~G~kVKv~v~frGRe~~~~e~g~~~l~~~~~~l~d~~~ve~~pk~~Gr~~~~   80 (86)
T d1i96v_           1 EVKSIKFRVKIDEHDYQTKLGHIKRFLQEGHKVKVTIMFRGREVAHPELGERILNRVTEDLKDLAVVEMKPEMLGRDMNM   80 (86)
T ss_pred             CCCEEEEECCCCCCHHHHHHHHHHHHHHCCCEEEEEEEEECCCCCCHHHHHHHHHHHHHHHHHHEEEECCCCCCCCEEEE
T ss_conf             96149960687711699999999999850780899999836655587889999999999713031870376350888999


Q ss_pred             EEEECC
Q ss_conf             992046
Q gi|254780320|r  130 ILSSKC  135 (136)
Q Consensus       130 ~l~Pkk  135 (136)
                      +|+|+|
T Consensus        81 ~l~P~K   86 (86)
T d1i96v_          81 LLAPVK   86 (86)
T ss_pred             EEEECC
T ss_conf             996089



>d1tiga_ d.68.1.1 (A:) Translation initiation factor IF3, C-terminal domain {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2ifea_ d.68.1.1 (A:) Translation initiation factor IF3, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tifa_ d.15.8.1 (A:) Translation initiation factor IF3, N-terminal domain {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 136 translation initiation factor IF-3 [Candidatus Lib
2ife_A_100 (A:) Protein (translation initiation factor IF3); 3e-24
2crq_A_112 (A:) Mitochondrial translational initiation factor 5e-24
1tig_A_94 (A:) IF3-C, translation initiation factor 3; IF3 C 8e-24
1i96_V_89 (V:) Translation initiation factor IF3; 30S riboso 8e-23
1tif_A_78 (A:) IF3-N, translation initiation factor 3; IF3 N 4e-08
>2ife_A (A:) Protein (translation initiation factor IF3); gene regulation; NMR {Escherichia coli}Length = 100 Back     alignment and structure
 Score =  105 bits (263), Expect = 3e-24
 Identities = 44/95 (46%), Positives = 66/95 (69%), Gaps = 1/95 (1%)

Query: 41  EARKKQKSTGIKEVKMRPVIDLHDLQVKLKAIDGFLRDGCKVKISVKFRGREIMHQDLGR 100
             +KKQK   +KE+K RP  D  D QVKL+++  FL +G K KI+++FRGRE+ HQ +G 
Sbjct: 3   FQKKKQKVIQVKEIKFRPGTDEGDYQVKLRSLIRFLEEGDKAKITLRFRGREMAHQQIGM 62

Query: 101 ELLSNIKERFGEISRIDCEP-KFEGRQMIMILSSK 134
           E+L+ +K+   E++ ++  P K EGRQMIM+L+ K
Sbjct: 63  EVLNRVKDDLQELAVVESFPTKIEGRQMIMVLAPK 97


>2crq_A (A:) Mitochondrial translational initiation factor 3; ribosome, structural genomics, NPPSFA; NMR {Mus musculus}Length = 112 Back     alignment and structure
>1tig_A (A:) IF3-C, translation initiation factor 3; IF3 C-terminal domain, ribosome binding factor; 2.00A {Geobacillus stearothermophilus}Length = 94 Back     alignment and structure
>1i96_V (V:) Translation initiation factor IF3; 30S ribosome; HET: WO2; 4.20A {Thermus thermophilus}Length = 89 Back     alignment and structure
>1tif_A (A:) IF3-N, translation initiation factor 3; IF3 N-terminal domain, ribosome binding factor; 1.80A {Geobacillus stearothermophilus}Length = 78 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target136 translation initiation factor IF-3 [Candidatus Liberiba
2ife_A_100 Protein (translation initiation factor IF3); gene 99.97
1tig_A_94 IF3-C, translation initiation factor 3; IF3 C-term 99.97
2crq_A_112 Mitochondrial translational initiation factor 3; r 99.96
1i96_V_89 Translation initiation factor IF3; 30S ribosome; H 99.96
1tif_A_78 IF3-N, translation initiation factor 3; IF3 N-term 99.69
>2ife_A (A:) Protein (translation initiation factor IF3); gene regulation; NMR {Escherichia coli} Back     alignment and structure
Probab=99.97  E-value=4e-31  Score=206.19  Aligned_cols=97  Identities=45%  Similarity=0.724  Sum_probs=93.8

Q ss_pred             HHHHHHCCCCCCCEEEEEEEECCHHHHHHHHHHHHHHHCCCCCEEEEEEECCCCCCCHHHHHHHHHHHHHHHHHHHHCCC
Q ss_conf             43211002222200268974008679999999999996037919999997097435735689999999998422432036
Q gi|254780320|r   39 AVEARKKQKSTGIKEVKMRPVIDLHDLQVKLKAIDGFLRDGCKVKISVKFRGREIMHQDLGRELLSNIKERFGEISRIDC  118 (136)
Q Consensus        39 ~k~~Kkkq~~~~~KEir~~~~I~~hDl~~K~k~~~~FL~~G~kVki~i~frGRe~~~~e~g~~~l~~i~~~l~~~~~~e~  118 (136)
                      .++++++|+.+++|||+|+|+||+|||++|++++++||++||+|+|+|+|||||++|+|.|.++|++|+++|+++|++|+
T Consensus         1 lke~kkkq~~~~~KEir~~~~I~~hDl~~K~k~~~~FL~~G~kVkv~i~~rGRe~~~~e~g~~ll~~i~~~l~~~~~~e~   80 (100)
T 2ife_A            1 MEFQKKKQKVIQVKEIKFRPGTDEGDYQVKLRSLIRFLEEGDKAKITLRFRGREMAHQQIGMEVLNRVKDDLQELAVVES   80 (100)
T ss_dssp             ---------CCEEEEEEECTTCCHHHHTHHHHHHHHHHHTTEEEEEEECCSSCTTCCSSHHHHHHHHHHHHHTTTEEESC
T ss_pred             CCHHHCCCCCCEEEEEEEECCCCHHHHHHHHHHHHHHHHCCCEEEEEEEEECCCCCCHHHHHHHHHHHHHHHHHHEEEEC
T ss_conf             92132057750478899735857537999999999999779969999998153002888999999999998531307824


Q ss_pred             CC-CCCCCEEEEEEEECC
Q ss_conf             77-324876999992046
Q gi|254780320|r  119 EP-KFEGRQMIMILSSKC  135 (136)
Q Consensus       119 ~p-k~~Gr~~~~~l~Pkk  135 (136)
                      .| +++|++|+|+|+|++
T Consensus        81 ~p~~~~G~~~~~~l~P~k   98 (100)
T 2ife_A           81 FPTKIEGRQMIMVLAPKK   98 (100)
T ss_dssp             CCCCCCSSCCEEEEEECC
T ss_pred             CCCCCCCCEEEEEEECCC
T ss_conf             676556873999993179



>1tig_A (A:) IF3-C, translation initiation factor 3; IF3 C-terminal domain, ribosome binding factor; 2.00A {Geobacillus stearothermophilus} Back     alignment and structure
>2crq_A (A:) Mitochondrial translational initiation factor 3; ribosome, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1i96_V (V:) Translation initiation factor IF3; 30S ribosome; HET: WO2; 4.20A {Thermus thermophilus} Back     alignment and structure
>1tif_A (A:) IF3-N, translation initiation factor 3; IF3 N-terminal domain, ribosome binding factor; 1.80A {Geobacillus stearothermophilus} Back     alignment and structure