254780330

254780330

30S ribosomal protein S18

GeneID in NCBI database:8209315Locus tag:CLIBASIA_01075
Protein GI in NCBI database:254780330Protein Accession:YP_003064743.1
Gene range:+(225055, 225306)Protein Length:83aa
Gene description:30S ribosomal protein S18
COG prediction:[J] Ribosomal protein S18
KEGG prediction:rpsR; 30S ribosomal protein S18; K02963 small subunit ribosomal protein S18
SEED prediction:SSU ribosomal protein S18p
Pathway involved in KEGG:Ribosome [PATH:las03010]
Subsystem involved in SEED:Ribosome SSU bacterial
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80---
MAEVAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVNL
cccccccccccccccccccccccccccccccccccHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHccccccc
cccccccHHHcccHHHccccccccccccccccHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHcccccc
maevaptpllrrnvshrrkscplsgkgapridykdIRLLNRFLSqrgkivpsrissvSHKKQRELAKAIKRARYLGLIAYVNL
maevaptpllrrnvshrrkscplsgkgapridykdIRLLNRFlsqrgkivpsrissvshkkQRELAKAIKrarylgliayvnl
MAEVAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVNL
*******************SCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVNL
MAEVAPTPLLRRNV************GAPRIDYKDIRLLNRFLSQRGKIVPS*************AKAIKRARYLGLIAYVNL
****APTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVNL
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhoo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAEVAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVNL
MAEVAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVNL
MAEVAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVNL

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target83 30S ribosomal protein S18 [Candidatus Liberibacter asia
31512224584 30S ribosomal protein S18 [Candidatus Liberibacter sola 1 1e-34
22782145982 30S ribosomal protein S18 [Sinorhizobium fredii NGR234] 1 3e-24
1596489082 30S ribosomal protein S18 [Sinorhizobium meliloti 1021] 1 4e-24
22208543582 ribosomal protein S18 [Agrobacterium radiobacter K84] L 1 6e-24
22214813582 30S ribosomal protein S18 [Agrobacterium vitis S4] Leng 1 1e-23
11625132082 30S ribosomal protein S18 [Rhizobium leguminosarum bv. 1 2e-23
8635707782 30S ribosomal protein S18 [Rhizobium etli CFN 42] Lengt 1 2e-23
8331120092 30S ribosomal protein S18 [Magnetospirillum magneticum 1 2e-23
31940830682 30S ribosomal protein S18 [Bartonella schoenbuchensis R 1 5e-23
31940404283 30S ribosomal protein S18 [Bartonella rochalimae ATCC B 1 5e-23
>gi|315122245|ref|YP_004062734.1| 30S ribosomal protein S18 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 84 Back     alignment and organism information
 Score =  149 bits (377), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 73/79 (92%), Positives = 76/79 (96%)

Query: 5  APTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRE 64
          +P PLLRRN+SHRRKSCP SGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVS KKQRE
Sbjct: 6  SPAPLLRRNMSHRRKSCPFSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSQKKQRE 65

Query: 65 LAKAIKRARYLGLIAYVNL 83
          LAKAIKRARYLGLIAYVN+
Sbjct: 66 LAKAIKRARYLGLIAYVNI 84


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|227821459|ref|YP_002825429.1| 30S ribosomal protein S18 [Sinorhizobium fredii NGR234] Length = 82 Back     alignment and organism information
>gi|15964890|ref|NP_385243.1| 30S ribosomal protein S18 [Sinorhizobium meliloti 1021] Length = 82 Back     alignment and organism information
>gi|222085435|ref|YP_002543965.1| ribosomal protein S18 [Agrobacterium radiobacter K84] Length = 82 Back     alignment and organism information
>gi|222148135|ref|YP_002549092.1| 30S ribosomal protein S18 [Agrobacterium vitis S4] Length = 82 Back     alignment and organism information
>gi|116251320|ref|YP_767158.1| 30S ribosomal protein S18 [Rhizobium leguminosarum bv. viciae 3841] Length = 82 Back     alignment and organism information
>gi|86357077|ref|YP_468969.1| 30S ribosomal protein S18 [Rhizobium etli CFN 42] Length = 82 Back     alignment and organism information
>gi|83311200|ref|YP_421464.1| 30S ribosomal protein S18 [Magnetospirillum magneticum AMB-1] Length = 92 Back     alignment and organism information
>gi|319408306|emb|CBI81959.1| 30S ribosomal protein S18 [Bartonella schoenbuchensis R1] Length = 82 Back     alignment and organism information
>gi|319404042|emb|CBI77630.1| 30S ribosomal protein S18 [Bartonella rochalimae ATCC BAA-1498] Length = 83 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target83 30S ribosomal protein S18 [Candidatus Liberibacter asia
PRK0039179 PRK00391, rpsR, 30S ribosomal protein S18; Reviewed 4e-21
TIGR0016570 TIGR00165, S18, ribosomal protein S18 2e-15
pfam0108454 pfam01084, Ribosomal_S18, Ribosomal protein S18 3e-15
PRK1340182 PRK13401, PRK13401, 30S ribosomal protein S18; Provisio 1e-12
CHL0007786 CHL00077, rps18, ribosomal protein S18 3e-12
PRK13400147 PRK13400, PRK13400, 30S ribosomal protein S18; Provisio 4e-10
KOG3162159 KOG3162, KOG3162, KOG3162, Mitochondrial/chloroplast ri 2e-07
COG023875 COG0238, RpsR, Ribosomal protein S18 [Translation, ribo 8e-16
>gnl|CDD|178997 PRK00391, rpsR, 30S ribosomal protein S18; Reviewed Back     alignment and domain information
>gnl|CDD|161738 TIGR00165, S18, ribosomal protein S18 Back     alignment and domain information
>gnl|CDD|144612 pfam01084, Ribosomal_S18, Ribosomal protein S18 Back     alignment and domain information
>gnl|CDD|184031 PRK13401, PRK13401, 30S ribosomal protein S18; Provisional Back     alignment and domain information
>gnl|CDD|177016 CHL00077, rps18, ribosomal protein S18 Back     alignment and domain information
>gnl|CDD|184030 PRK13400, PRK13400, 30S ribosomal protein S18; Provisional Back     alignment and domain information
>gnl|CDD|38372 KOG3162, KOG3162, KOG3162, Mitochondrial/chloroplast ribosomal protein S18 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|30587 COG0238, RpsR, Ribosomal protein S18 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 83 30S ribosomal protein S18 [Candidatus Liberibacter asia
PRK13400147 30S ribosomal protein S18; Provisional 99.96
PRK0039180 rpsR 30S ribosomal protein S18; Reviewed 99.96
PRK1340179 30S ribosomal protein S18; Provisional 99.96
CHL0007786 rps18 ribosomal protein S18 99.94
COG023875 RpsR Ribosomal protein S18 [Translation, ribosomal stru 99.93
pfam0108454 Ribosomal_S18 Ribosomal protein S18. 99.83
KOG3162159 consensus 99.8
TIGR0016573 S18 ribosomal protein S18; InterPro: IPR001648 Ribosome 99.67
KOG4021239 consensus 99.26
>PRK13400 30S ribosomal protein S18; Provisional Back     alignment and domain information
>PRK00391 rpsR 30S ribosomal protein S18; Reviewed Back     alignment and domain information
>PRK13401 30S ribosomal protein S18; Provisional Back     alignment and domain information
>CHL00077 rps18 ribosomal protein S18 Back     alignment and domain information
>COG0238 RpsR Ribosomal protein S18 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>pfam01084 Ribosomal_S18 Ribosomal protein S18 Back     alignment and domain information
>KOG3162 consensus Back     alignment and domain information
>TIGR00165 S18 ribosomal protein S18; InterPro: IPR001648 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>KOG4021 consensus Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target83 30S ribosomal protein S18 [Candidatus Liberibacter asia
1p6g_R74 Real Space Refined Coordinates Of The 30s Subunit F 2e-19
1vs5_R75 Crystal Structure Of The Bacterial Ribosome From Es 2e-19
3e1a_K75 Structure Of The 30s Subunit And The Trnas Of E. Co 3e-19
2gy9_R69 Structure Of The 30s Subunit Of A Pre-Translocation 6e-19
3fih_R55 Ternary Complex-Bound E.Coli 70s Ribosome. This Ent 5e-14
3bbn_R103 Homology Model For The Spinach Chloroplast 30s Subu 1e-13
2j00_R88 Structure Of The Thermus Thermophilus 70s Ribosome 2e-12
1i94_R87 Crystal Structures Of The Small Ribosomal Subunit W 3e-12
1fka_R88 Structure Of Functionally Activated Small Ribosomal 4e-12
3fic_R70 T. Thermophilus 70s Ribosome In Complex With Mrna, 4e-12
1pns_R73 Crystal Structure Of A Streptomycin Dependent Ribos 8e-12
>gi|33357895|pdb|1P6G|R Chain R, Real Space Refined Coordinates Of The 30s Subunit Fitted Into The Low Resolution Cryo-Em Map Of The Ef-G.Gtp State Of E. Coli 70s Ribosome Length = 74 Back     alignment and structure
 Score = 99.3 bits (247), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 35/70 (50%), Positives = 46/70 (65%)

Query: 13 NVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRA 72
              RRK C  + +G   IDYKDI  L  ++++ GKIVPSRI+    K QR+LA+AIKRA
Sbjct: 2  RYFRRRKFCRFTAEGVQEIDYKDIATLKNYITESGKIVPSRITGTRAKYQRQLARAIKRA 61

Query: 73 RYLGLIAYVN 82
          RYL L+ Y +
Sbjct: 62 RYLSLLPYTD 71


gi|116666565|pdb|1VS5|R Chain R, Crystal Structure Of The Bacterial Ribosome From Escherichia Coli In Complex With The Antibiotic Kasugamyin At 3.5a Resolution. This File Contains The 30s Subunit Of One 70s Ribosome. The Entire Crystal Structure Contains Two 70s Ribosomes And Is Described In Remark 400. Length = 75 Back     alignment and structure
gi|256032361|pdb|3E1A|K Chain K, Structure Of The 30s Subunit And The Trnas Of E. Coli Ribosome In Pre-Accommodation State Length = 75 Back     alignment and structure
>gi|116667427|pdb|2GY9|R Chain R, Structure Of The 30s Subunit Of A Pre-Translocational E. Coli Ribosome Obtained By Fitting Atomic Models For Rna And Protein Components Into Cryo-Em Map Emd-1056 Length = 69 Back     alignment and structure
>gi|224510719|pdb|3FIH|R Chain R, Ternary Complex-Bound E.Coli 70s Ribosome. This Entry Consists Of The 30s Subunit, Trnas And The Ternary Complex. Length = 55 Back     alignment and structure
>gi|188036219|pdb|3BBN|R Chain R, Homology Model For The Spinach Chloroplast 30s Subunit Fitted To 9.4a Cryo-Em Map Of The 70s Chlororibosome Length = 103 Back     alignment and structure
gi|116668214|pdb|2J00|R Chain R, Structure Of The Thermus Thermophilus 70s Ribosome Complexed With Mrna, Trna And Paromomycin (Part 1 Of 4). This File Contains The 30s Subunit, Mrna, A-, P- And E-Site Trnas And Paromomycin For Molecule I. Length = 88 Back     alignment and structure
>gi|14278547|pdb|1I94|R Chain R, Crystal Structures Of The Small Ribosomal Subunit With Tetracycline, Edeine And If3 Length = 87 Back     alignment and structure
gi|10120581|pdb|1FKA|R Chain R, Structure Of Functionally Activated Small Ribosomal Subunit At 3.3 A Resolution Length = 88 Back     alignment and structure
>gi|224510695|pdb|3FIC|R Chain R, T. Thermophilus 70s Ribosome In Complex With Mrna, Trnas And Ef-Tu.Gdp.Kirromycin Ternary Complex, Fitted To A 6.4 A Cryo-Em Map. This File Contains The 30s Subunit And The Ligands Length = 70 Back     alignment and structure
>gi|34811546|pdb|1PNS|R Chain R, Crystal Structure Of A Streptomycin Dependent Ribosome From E. Coli, 30s Subunit Of 70s Ribosome. This File, 1pns, Contains The 30s Subunit, Two Trnas, And One Mrna Molecule. The 50s Ribosomal Subunit Is In File 1pnu. Length = 73 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target83 30S ribosomal protein S18 [Candidatus Liberibacter asia
3i1m_R75 30S ribosomal protein S18; ribosome structure, protein- 2e-19
3ofo_R55 30S ribosomal protein S18; protein biosynthesis, riboso 5e-17
3bbn_R103 Ribosomal protein S18; small ribosomal subunit, spinach 1e-16
2vqe_R88 30S ribosomal protein S18; tRNA-binding, rRNA-binding, 4e-15
>3i1m_R 30S ribosomal protein S18; ribosome structure, protein-RNA complex, ribonucleoprotein, ribosomal protein, RNA-binding, rRNA-binding, antibiotic resistance; 3.19A {Escherichia coli k-12} PDB: 1vs7_R* 1vs5_R 3i1o_R 3i1q_R 3i1s_R 3i1z_R 3i21_R 2qal_R* 1p6g_R 1p87_R 2aw7_R 2avy_R 2i2u_R 2i2p_R* 2qan_R* 2qb9_R* 2qbb_R* 2qbd_R 2qbf_R 2qbh_R* ... Length = 75 Back     alignment and structure
 Score = 88.9 bits (221), Expect = 2e-19
 Identities = 35/66 (53%), Positives = 46/66 (69%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          RRK C  + +G   IDYKDI  L  ++++ GKIVPSRI+    K QR+LA+AIKRARYL 
Sbjct: 7  RRKFCRFTAEGVQEIDYKDIATLKNYITESGKIVPSRITGTRAKYQRQLARAIKRARYLS 66

Query: 77 LIAYVN 82
          L+ Y +
Sbjct: 67 LLPYTD 72


>3ofo_R 30S ribosomal protein S18; protein biosynthesis, ribosomes, RNA, tRNA, transfer, eryThr ketolide, macrolide, antibiotic, EXIT, peptidyl; 3.10A {Escherichia coli} PDB: 3fih_R* 3iy8_R 2wwl_R 3ofp_R Length = 55 Back     alignment and structure
>3bbn_R Ribosomal protein S18; small ribosomal subunit, spinach chloroplast ribosome, ribonucleoprotein particle, macromolecular complex; 9.40A {Spinacea oleracea} SCOP: i.1.1.1 Length = 103 Back     alignment and structure
>2vqe_R 30S ribosomal protein S18; tRNA-binding, rRNA-binding, metal-binding, zinc-finger, translation; HET: TM2 PAR; 2.5A {Thermus thermophilus} SCOP: a.4.8.1 PDB: 1fka_R 1fjg_R 1gix_U* 1hnw_R* 1hnx_R* 1hnz_R* 1hr0_R 1ibk_R* 1ibl_R* 1ibm_R 1j5e_R 1jgo_U* 1jgp_U* 1jgq_U* 1ml5_U* 1n32_R* 1n33_R* 1n34_R 1n36_R 1xmo_R* ... Length = 88 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target83 30S ribosomal protein S18 [Candidatus Liberibacter asia
3i1m_R75 30S ribosomal protein S18; ribosome structure, protein- 99.95
2vqe_R88 30S ribosomal protein S18; tRNA-binding, rRNA-binding, 99.94
3bbn_R103 Ribosomal protein S18; small ribosomal subunit, spinach 99.92
3ofo_R55 30S ribosomal protein S18; protein biosynthesis, riboso 99.89
>3i1m_R 30S ribosomal protein S18; ribosome structure, protein-RNA complex, ribonucleoprotein, ribosomal protein, RNA-binding, rRNA-binding, antibiotic resistance; 3.19A {Escherichia coli k-12} PDB: 1vs7_R* 1vs5_R 3i1o_R 3i1q_R 3i1s_R 3i1z_R 3i21_R 3kc4_R 2qal_R* 1p6g_R 1p87_R 2aw7_R 2avy_R 2i2u_R 2i2p_R* 2qan_R* 2qb9_R* 2qbb_R* 2qbd_R 2qbf_R ... Back     alignment and structure
Probab=99.95  E-value=4.5e-29  Score=182.74  Aligned_cols=71  Identities=49%  Similarity=0.828  Sum_probs=67.0

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCHHHHHHHCCCCCEECCCHHHCCCHHHHHHHHHHHHHHHHCCCCCCCCC
Q ss_conf             77778888543503885114468899999628998485503317489999999999999997046586769
Q gi|254780330|r   13 NVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVNL   83 (83)
Q Consensus        13 ~~~~~~k~c~~~~~~~~~iDYKn~~lL~~Fis~~GkI~prr~TG~~~k~Qr~i~~aIKrAR~~gLlPy~~~   83 (83)
                      ++++++|+|+||.+++++|||||+++|++||||+|+|+||++||+|++|||+|++|||+||+|||||||+-
T Consensus         3 r~~~rkk~C~~c~~~~~~idYKd~~lL~~Fis~~GkI~prr~TG~~~k~Qr~l~~aIkrAR~~gLlP~~~~   73 (75)
T 3i1m_R            3 RYFRRRKFCRFTAEGVQEIDYKDIATLKNYITESGKIVPSRITGTRAKYQRQLARAIKRARYLSLLPYTDR   73 (75)
T ss_dssp             -----------------CCSTTCHHHHGGGBCTTCCBCCHHHHCCCHHHHHHHHHHHHHHHTTTSSCSSSC
T ss_pred             CCCCCCCCCCCCCCCCCCCCCCCHHHHHHHCCCCCEECCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCC
T ss_conf             75678988988768998478659899998568887584774478699999999999999998536773547



>2vqe_R 30S ribosomal protein S18; tRNA-binding, rRNA-binding, metal-binding, zinc-finger, translation; HET: TM2 PAR; 2.5A {Thermus thermophilus} SCOP: a.4.8.1 PDB: 1fka_R 1fjg_R 1gix_U* 1hnw_R* 1hnx_R* 1hnz_R* 1hr0_R 1ibk_R* 1ibl_R* 1ibm_R 1j5e_R 1jgo_U* 1jgp_U* 1jgq_U* 1ml5_U* 1n32_R* 1n33_R* 1n34_R 1n36_R 1xmo_R* ... Back     alignment and structure
>3bbn_R Ribosomal protein S18; small ribosomal subunit, spinach chloroplast ribosome, ribonucleoprotein particle, macromolecular complex; 9.40A {Spinacea oleracea} SCOP: i.1.1.1 Back     alignment and structure
>3ofo_R 30S ribosomal protein S18; protein biosynthesis, ribosomes, RNA, tRNA, transfer, eryThr ketolide, macrolide, antibiotic, EXIT, peptidyl; 3.10A {Escherichia coli} PDB: 3fih_R* 3iy8_R 2wwl_R 3ofp_R Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 83 30S ribosomal protein S18 [Candidatus Liberibacter asia
d2qalr155 a.4.8.1 (R:19-73) Ribosomal protein S18 {Escherichia co 2e-16
d2uubr170 a.4.8.1 (R:19-88) Ribosomal protein S18 {Thermus thermo 3e-15
>d2qalr1 a.4.8.1 (R:19-73) Ribosomal protein S18 {Escherichia coli [TaxId: 562]} Length = 55 Back     information, alignment and structure

class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Ribosomal protein S18
family: Ribosomal protein S18
domain: Ribosomal protein S18
species: Escherichia coli [TaxId: 562]
 Score = 78.1 bits (193), Expect = 2e-16
 Identities = 30/52 (57%), Positives = 39/52 (75%)

Query: 31 IDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN 82
          IDYKDI  L  ++++ GKIVPSRI+    K QR+LA+AIKRARYL L+ Y +
Sbjct: 2  IDYKDIATLKNYITESGKIVPSRITGTRAKYQRQLARAIKRARYLSLLPYTD 53


>d2uubr1 a.4.8.1 (R:19-88) Ribosomal protein S18 {Thermus thermophilus [TaxId: 274]} Length = 70 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target83 30S ribosomal protein S18 [Candidatus Liberibacter asia
d2uubr170 Ribosomal protein S18 {Thermus thermophilus [TaxId: 274 99.91
d2qalr155 Ribosomal protein S18 {Escherichia coli [TaxId: 562]} 99.89
>d2uubr1 a.4.8.1 (R:19-88) Ribosomal protein S18 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Ribosomal protein S18
family: Ribosomal protein S18
domain: Ribosomal protein S18
species: Thermus thermophilus [TaxId: 274]
Probab=99.91  E-value=1.6e-25  Score=161.57  Aligned_cols=64  Identities=42%  Similarity=0.647  Sum_probs=59.2

Q ss_pred             CCCCCCCCCCCCCCCCCHHHHHHHCCCCCEECCCHHHCCCHHHHHHHHHHHHHHHHCCCCCCCC
Q ss_conf             8854350388511446889999962899848550331748999999999999999704658676
Q gi|254780330|r   19 KSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN   82 (83)
Q Consensus        19 k~c~~~~~~~~~iDYKn~~lL~~Fis~~GkI~prr~TG~~~k~Qr~i~~aIKrAR~~gLlPy~~   82 (83)
                      +.|..+..+++.+||||+++|++||||+|+|+||++||+|++|||+|++|||+||+||||||++
T Consensus         2 ~k~k~~~~~~~~iDYKn~~lL~~Fis~~GkIlprr~TGl~~k~Qr~l~~aIkrAR~~gLlPy~~   65 (70)
T d2uubr1           2 AKVKATLGEFDLRDYRNVEVLKRFLSETGKILPRRRTGLSAKEQRILAKTIKRARILGLLPFTE   65 (70)
T ss_dssp             CCTTTSSCSCCTTCTTCHHHHGGGBCSSSCBCCHHHHCCCHHHHHHHHHHHHHHHHTTSSCSCC
T ss_pred             CCCCCCCCCCCCCCCCCHHHHHHHCCCCCEEECCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCH
T ss_conf             8756562546845866879999866998758167448978999999999999999974353108



>d2qalr1 a.4.8.1 (R:19-73) Ribosomal protein S18 {Escherichia coli [TaxId: 562]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 83 30S ribosomal protein S18 [Candidatus Liberibacter
3i1m_R_75 (R:) 30S ribosomal protein S18; ribosome structure 2e-16
2vqe_R_88 (R:) 30S ribosomal protein S18; tRNA-binding, rRNA 3e-15
3bbn_R_103 (R:) Ribosomal protein S18; small ribosomal subuni 6e-14
>3i1m_R (R:) 30S ribosomal protein S18; ribosome structure, protein-RNA complex, ribonucleoprotein, ribosomal protein, RNA-binding, rRNA-binding, antibiotic resistance; 3.19A {Escherichia coli k-12} PDB: 1vs7_R* 1vs5_R 3i1o_R 3i1q_R 3i1s_R 3i1z_R 3i21_R 2qal_R* 1p6g_R 1p87_R 2aw7_R 2avy_R 2i2u_R 2i2p_R* 2qan_R* 2qb9_R* 2qbb_R* 2qbd_R 2qbf_R 2qbh_R* ...Length = 75 Back     alignment and structure
 Score = 78.9 bits (195), Expect = 2e-16
 Identities = 35/66 (53%), Positives = 46/66 (69%)

Query: 17 RRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLG 76
          RRK C  + +G   IDYKDI  L  ++++ GKIVPSRI+    K QR+LA+AIKRARYL 
Sbjct: 7  RRKFCRFTAEGVQEIDYKDIATLKNYITESGKIVPSRITGTRAKYQRQLARAIKRARYLS 66

Query: 77 LIAYVN 82
          L+ Y +
Sbjct: 67 LLPYTD 72


>2vqe_R (R:) 30S ribosomal protein S18; tRNA-binding, rRNA-binding, metal-binding, zinc-finger, translation; HET: TM2 PAR; 2.5A {Thermus thermophilus}Length = 88 Back     alignment and structure
>3bbn_R (R:) Ribosomal protein S18; small ribosomal subunit, spinach chloroplast ribosome, ribonucleoprotein particle, macromolecular complex; 9.40A {Spinacea oleracea}Length = 103 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target83 30S ribosomal protein S18 [Candidatus Liberibacter asia
2vqe_R_88 30S ribosomal protein S18; tRNA-binding, rRNA-bind 99.95
3i1m_R_75 30S ribosomal protein S18; ribosome structure, pro 99.95
3bbn_R_103 Ribosomal protein S18; small ribosomal subunit, sp 99.9
>2vqe_R (R:) 30S ribosomal protein S18; tRNA-binding, rRNA-binding, metal-binding, zinc-finger, translation; HET: TM2 PAR; 2.5A {Thermus thermophilus} Back     alignment and structure
Probab=99.95  E-value=1.3e-28  Score=181.10  Aligned_cols=79  Identities=37%  Similarity=0.526  Sum_probs=72.8

Q ss_pred             CCCCCHHHCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHCCCCCEECCCHHHCCCHHHHHHHHHHHHHHHHCCCCCCCC
Q ss_conf             6667132277777888854350388511446889999962899848550331748999999999999999704658676
Q gi|254780330|r    4 VAPTPLLRRNVSHRRKSCPLSGKGAPRIDYKDIRLLNRFLSQRGKIVPSRISSVSHKKQRELAKAIKRARYLGLIAYVN   82 (83)
Q Consensus         4 ~~p~p~~~~~~~~~~k~c~~~~~~~~~iDYKn~~lL~~Fis~~GkI~prr~TG~~~k~Qr~i~~aIKrAR~~gLlPy~~   82 (83)
                      ..+.+...+....+++.|+||.++++.|||||+++|++|||++|+|+||++||+|++|||+|++|||+||+||||||+.
T Consensus         5 ~~~~~~~~~~~~~~~~~c~~~~~~~~~idykn~~lL~~Fis~~GkIlprr~TGl~~k~Qr~l~~aIkrAR~~gLlP~~~   83 (88)
T 2vqe_R            5 NAKPKKEAQRRPSRKAKVKATLGEFDLRDYRNVEVLKRFLSETGKILPRRRTGLSGKEQRILAKTIKRARILGLLPFTE   83 (88)
T ss_dssp             -----------CCCSCCTTTSCCCEETTCTTCHHHHGGGBCSSSCBCCHHHHCCCHHHHHHHHHHHHHHHHTTSSCSCC
T ss_pred             CCCCCCHHHCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHCCCCCEEECCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCH
T ss_conf             6464412320887776663333666866765889999876998858177458878999999999999999975453229



>3i1m_R (R:) 30S ribosomal protein S18; ribosome structure, protein-RNA complex, ribonucleoprotein, ribosomal protein, RNA-binding, rRNA-binding, antibiotic resistance; 3.19A {Escherichia coli k-12} PDB: 1vs7_R* 1vs5_R 3i1o_R 3i1q_R 3i1s_R 3i1z_R 3i21_R 2qal_R* 1p6g_R 1p87_R 2aw7_R 2avy_R 2i2u_R 2i2p_R* 2qan_R* 2qb9_R* 2qbb_R* 2qbd_R 2qbf_R 2qbh_R* ... Back     alignment and structure
>3bbn_R (R:) Ribosomal protein S18; small ribosomal subunit, spinach chloroplast ribosome, ribonucleoprotein particle, macromolecular complex; 9.40A {Spinacea oleracea} Back     alignment and structure