254780353

254780353

DNA topoisomerase IV subunit A

GeneID in NCBI database:8209338Locus tag:CLIBASIA_01190
Protein GI in NCBI database:254780353Protein Accession:YP_003064766.1
Gene range:-(249125, 251386)Protein Length:753aa
Gene description:DNA topoisomerase IV subunit A
COG prediction:none
KEGG prediction:parC; DNA topoisomerase IV subunit A (EC:5.99.1.-); K02621 topoisomerase IV subunit A [EC:5.99.1.-]
SEED prediction:Topoisomerase IV subunit A (EC 5.99.1.-)
Pathway involved in KEGG:not defined
Subsystem involved in SEED:DNA topoisomerases, Type II, ATP-dependent;
Resistance to fluoroquinolones
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED1 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750---
MGVDNISNSNTLVEENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFKKSARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDGDSAAAYRYTEARMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPSHNVQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVRARWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAEDVRIVLFPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREVLFRRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQVDAILNLRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSKSTDLGRRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEGDSLKIALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVYDSTCKLLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVVKVTGDHVAVVGENRKLLIFSIDQIPEMSRGKGVRLQSYKDGGISDVICFKICEGLTWIDSAGRSYNRSENDLLGWLGKRGGVGSLVPKGFPRSGKFLSS
ccccccccccccccccEEEEEHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHccccccccEEEHHHHHHHHHHHcccccHHHHHHHHHHHcccccccEEEEccccccccccccccccccHHHHHHHHHHHHHHHHcccccccEEEcccccEEccccccccccHHHHcccccEEEccccccccccHHHHHHHHHHHHHcccccHHHHHccccccccccccEEEccHHHHHHHHHccccEEEEEEEEEEEEEcccEEEEEEccccccccHHHHHHHHHHHHHccccccccccccccccEEEEEEEEccccccHHHHHHHHHHHcccccccccEEEEEEcccccEEEcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHcccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHcccccccccccEEEEcccccccccHHHHcccccEEEEEccccEEEEcccccccccccccccccEEEEEEEEccccEEEEEEccccEEEEEHHHcccccccccEEEEEcccccccEEEEEEEEccccEEEEEEcccEEEEEEHHHHcccccccEEEEEEccccEEEEEEEccccEEEEEEcccEEEEEEHHHcccccHHHccEEEEEcccccEEEEEEEEccccEEEEEEcccccccccHHHHHcccccccccccccccccccccccc
cccccccccccHHccccccccHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHcccccccccccEEEEEEcHcccccccccHHHHHHHHHHHcHcHccEEEEccccccccccccHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccEcccccccEEEcccccEEEccccccccccHHHHHHHHHHHHccccccHHHHHHHccccccccHEEEEccccHHHHHEcccccEEEEEEEEEEEEcccccEEEEEEcccHHHHHHHHHHHHHHHHHHHccccHHccccccccccEEEEEEEEccccHHHHHHHHHHHHHHHHHccEEEHEEEcccccEEccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHccccHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHccccccccccEEHEHcccccccccHHHccccccEEEEEEcccEEEEEcccccEEEEEEcccccEEEEEEEEccccEEEEEEcccEEEEEcccccccccccccEEEEEEEcccccEEEEEEEEccccEEEEEEccccEEEcccHHccccccccEEEEEEEcccEEEEEEEEccccEEEEEcccEEEEEcHHHcccccccccEEEEEEccccEEEEEEEEccccEEEEEcccccccccHHHccHHHcccccccEEEEEEEcccccEEcc
mgvdnisnsntlvEENVKAVSLRFALEERYLAYALSTIKeraipdlrdgfkpVHRRIIHAMSEMGLDFGAAFKKSARIVGEVIgklhphgdqsvYDSLVRLAqpfvqryplisgqgnfgnidgdsaAAYRYTEARMTQVAELILQgvdedavdfrdtyneedsepvvfpskfpnllangtsgiavgmatsipshNVQEICEAALALIDNPEISIEKLLEYiigpdfptggiiveSRESIVESYRLGRGGFRVRARWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRiplledirdesaeDVRIVlfpknrsldpdlLMESIFMLSdmetrfplnmnvlsmgrvpqvmplDGILKEWLAHRREVLFRRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIrnedkpkpvmvsrfslteNQVDAILNLRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSKstdlgrrrttfcevsRADKATLQQAMIEKEPITVVISnrgwirslkshsvdlsalhfkegdSLKIALHAHTTDRILLLstdgkaytlpagnllsgrghGEAIQLLIDLNHNQDIVTAFVYDSTCKLLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVVKVTGDHVAVVGENRKLLIFSIdqipemsrgkgvrlqsykdggisdVICFKICegltwidsagrsynrseNDLLGwlgkrggvgslvpkgfprsgkflss
mgvdnisnsntlveeNVKAVSLRFALEERYLAYALStikeraipdlrdgfKPVHRRIIHAMSEMGLDFGAAFKKSARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQryplisgqgnfgniDGDSAAAYRYTEARMTQVAELILQGVDEDAVDFRDTYNEedsepvvfpskfpNLLANGTSGIAVGMATSIPSHNVQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVEsyrlgrggfrvraRWCVEevgrgswcivvteipyqvQKSRLIEKIAELIIAKriplledirdesaEDVRIVlfpknrsldpdlLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREVLfrrssfrmqaiDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRfsltenqvdaILNLRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKeifskstdlgrrrttfcevsradkatlqqamiekepitvVISNRGWIRSLKSHSVDLSALHFKEGDSLKIALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVYDSTCKLLVVSSKGNAFiveeseiiantrkgktflkvsseeKMKLVVKVTgdhvavvgenrkLLIFsidqipemsrgKGVRLQSYKDGGISDVICFKICEGLTWIDSAGRSYNRSENDLLGwlgkrggvgslvpkgfprsgkflss
MGVDNISNSNTLVEENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFKKSARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDGDSAAAYRYTEARMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPSHNVQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVRARWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAEDVRIVLFPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREVLFRRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQVDAILNLRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSKSTDLGRRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEGDSLKIALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVYDSTCKLLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVVKVTGDHVAVVGENRKLLIFSIDQIPEMSRGKGVRLQSYKDGGISDVICFKICEGLTWIDSAGRSYNRSENDLLGWLGKRGGVGSLVPKGFPRSGKFLSS
********************SLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFKKSARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDGDSAAAYRYTEARMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPSHNVQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVRARWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAEDVRIVLFPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREVLFRRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQVDAILNLRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSKSTDLGRRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEGDSLKIALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVYDSTCKLLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVVKVTGDHVAVVGENRKLLIFSIDQIPEMSRGKGVRLQSYKDGGISDVICFKICEGLTWIDSAGRSYNRSENDLLGWLGKRGGVGSLVPKGFPR***F***
MGVDNISNSNTLVEENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFKKSARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDGDSAAAYRYTEARMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPSHNVQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVRARWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAEDVRIVLFPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREVLFRRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQVDAILNLRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSKSTDLGRRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEGDSLKIALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVYDSTCKLLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVVKVTGDHVAVVGENRKLLIFSIDQIPEMSRGKGVRLQSYKDGGISDVICFKICEGLTWIDSAGRSYNRSENDLLGWLGKRGGVGSLVPKGFP********
********SNTLVEENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFKKSARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDGDSAAAYRYTEARMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPSHNVQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVRARWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAEDVRIVLFPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREVLFRRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQVDAILNLRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSKSTDLGRRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEGDSLKIALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVYDSTCKLLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVVKVTGDHVAVVGENRKLLIFSIDQIPEMSRGKGVRLQSYKDGGISDVICFKICEGLTWIDSAGRSYNRSENDLLGWLGKRGGVGSLVPKGFPRSGKFLS*
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGVDNISNSNTLVEENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFKKSARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDGDSAAAYRYTEARMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPSHNVQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVRARWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAEDVRIVLFPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREVLFRRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQVDAILNLRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSKSTDLGRRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEGDSLKIALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVYDSTCKLLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVVKVTGDHVAVVGENRKLLIFSIDQIPEMSRGKGVRLQSYKDGGISDVICFKICEGLTWIDSAGRSYNRSENDLLGWLGKRGGVGSLVPKGFPRSGKFLSS
MGVDNISNSNTLVEENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFKKSARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDGDSAAAYRYTEARMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPSHNVQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVRARWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAEDVRIVLFPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREVLFRRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQVDAILNLRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSKSTDLGRRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEGDSLKIALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVYDSTCKLLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVVKVTGDHVAVVGENRKLLIFSIDQIPEMSRGKGVRLQSYKDGGISDVICFKICEGLTWIDSAGRSYNRSENDLLGWLGKRGGVGSLVPKGFPRSGKFLSS
MGVDNISNSNTLVEENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFKKSARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDGDSAAAYRYTEARMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPSHNVQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVRARWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRDESAEDVRIVLFPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREVLFRRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQVDAILNLRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSKSTDLGRRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDLSALHFKEGDSLKIALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVYDSTCKLLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVVKVTGDHVAVVGENRKLLIFSIDQIPEMSRGKGVRLQSYKDGGISDVICFKICEGLTWIDSAGRSYNRSENDLLGWLGKRGGVGSLVPKGFPRSGKFLSS

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target753 DNA topoisomerase IV subunit A [Candidatus Liberibacter
254780182 910 DNA gyrase subunit A [Candidatus Liberibacter asia 1e-105
>gi|254780182|ref|YP_003064595.1| DNA gyrase subunit A [Candidatus Liberibacter asiaticus str. psy62] Length = 910 Back     alignment
 Score =  375 bits (963), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 244/697 (35%), Positives = 374/697 (53%), Gaps = 65/697 (9%)

Query: 4   DNISNSNTLVEENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHAMSE 63
           ++I +S+   E+ + +VS+   ++  YL YA++ I  RAIPDLRDG KPVHRRI+  M +
Sbjct: 3   EHIISSDEEEEKGITSVSITDEMQNSYLTYAINVILGRAIPDLRDGLKPVHRRILFGMMQ 62

Query: 64  MGLDFGAAFKKSARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGNIDG 123
           MG+++   + K ARI GEV+GK HPHG+ ++YD+L R+AQ +  R  LI GQGNFG++DG
Sbjct: 63  MGVEWNKKYVKCARISGEVMGKYHPHGNAAIYDALARMAQDWSLRLLLIEGQGNFGSVDG 122

Query: 124 DSAAAYRYTEARMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGI 183
           D  AA RYTE R+ + A  +L  + +D VDFR  Y+    EPVV  +++PN+L NG  GI
Sbjct: 123 DPPAAERYTECRLQKAAHFLLDDLGKDTVDFRPNYDGSFQEPVVLCARYPNVLVNGGGGI 182

Query: 184 AVGMATSIPSHNVQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESY 243
           AVGMAT+IP+HN+ E+ +  +A+IDNP+I ++ L+E I GPDFPTG +I+  R  I  +Y
Sbjct: 183 AVGMATNIPTHNLGEVVDGCVAVIDNPDIDLDALMEIIRGPDFPTGAVIL-GRTGIKNAY 241

Query: 244 RLGRGGFRVRARWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLEDIRD 303
             GRG   +R    +E+       IVVTEIPYQV K+ ++EKIAEL+  KRI  + D+RD
Sbjct: 242 ATGRGSIVIRGVSHIEKTSGDREQIVVTEIPYQVNKAAMLEKIAELVREKRIVDIADLRD 301

Query: 304 ESAEDVRIVLFPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGILKE 363
           ES      V+    R    D+++  ++  + +++ F +NM  L+ G  P+   L GILK 
Sbjct: 302 ESDRQGYRVVIELKRGASADVILNQLYRYTSLQSLFSVNMVALN-GYKPERFTLIGILKA 360

Query: 364 WLAHRREVLFRRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPV---MVSR 420
           ++A R EV+ RR+ + +     R  +L GL IA  N+DE++ IIR    P+     ++ R
Sbjct: 361 FVAFREEVVVRRTKYLLNKARDRAHVLVGLAIAVANLDEVVRIIRFSPNPETARRELMQR 420

Query: 421 --------------------------FSLTENQVDAILNLRLRSLRKLEEYQIKSELDNL 454
                                       L+E Q  AIL LRL  L  L    I++EL++L
Sbjct: 421 SWNASDIKDLIDLIDDSSYTIGSDGTMYLSEVQTRAILELRLARLTGLGRDDIRNELNSL 480

Query: 455 LAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSKSTDLGRRRTTFCE--VSRADKATLQQ 512
             E ++   +L+S  +    I  E+  VK+          RRT   E  +   D     +
Sbjct: 481 GIEIKECLDILSSRSRLLGIIKQELLSVKDELDTP-----RRTRIVEGLLDMED-----E 530

Query: 513 AMIEKEPITVVISNRGWI--------RSLKSHSVDLSALHFKEGDSLKIALHAHTTDRIL 564
             I +E + V +S+ G++        R+ +      S +  ++ D +       T   +L
Sbjct: 531 DCIVREDMVVTVSHLGYVKRVPLSVYRAQRRGGKGRSGVVMRDEDFVTDLFIVSTHTSVL 590

Query: 565 LLSTDG-----KAYTLPAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVY----DSTCKLL 615
             S+ G     K + LP G   S +  G+A+  ++ LN  + I T   +     S   L 
Sbjct: 591 FFSSLGFVYKEKVWRLPIG---SPQARGKALINILSLNQGERITTIMPFPEDESSWNNLY 647

Query: 616 VV--SSKGNAFIVEESEIIANTRKGKTFLKVSSEEKM 650
           VV  +  GN    + S+ I   R GK  +K+ S +++
Sbjct: 648 VVFATKHGNVRRNKLSDFIQINRSGKIAMKLDSRDEI 684

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target753 DNA topoisomerase IV subunit A [Candidatus Liberibacter
315122223753 DNA topoisomerase IV subunit A [Candidatus Liberibacter 1 0.0
116251375751 DNA topoisomerase IV subunit A [Rhizobium leguminosarum 1 0.0
150396031758 DNA topoisomerase IV subunit A [Sinorhizobium medicae W 1 0.0
15964952758 DNA topoisomerase IV subunit A [Sinorhizobium meliloti 1 0.0
307317757758 DNA topoisomerase IV, A subunit [Sinorhizobium meliloti 1 0.0
227821521753 DNA topoisomerase IV subunit A [Sinorhizobium fredii NG 1 0.0
222148193758 DNA topoisomerase IV subunit A [Agrobacterium vitis S4] 1 0.0
190891181751 DNA topoisomerase IV protein, subunit A [Rhizobium etli 1 0.0
327192117751 DNA topoisomerase IV protein, subunit A [Rhizobium etli 1 0.0
15888496750 DNA topoisomerase IV subunit A [Agrobacterium tumefacie 1 0.0
>gi|315122223|ref|YP_004062712.1| DNA topoisomerase IV subunit A [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 753 Back     alignment and organism information
 Score = 1335 bits (3456), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 642/752 (85%), Positives = 695/752 (92%)

Query: 1   MGVDNISNSNTLVEENVKAVSLRFALEERYLAYALSTIKERAIPDLRDGFKPVHRRIIHA 60
           MG D   NS+ LVEEN  +VSL+ ALEERYLAYALSTIKERAIPD RDGFKPVHRRIIHA
Sbjct: 1   MGSDKTPNSDDLVEENFNSVSLKSALEERYLAYALSTIKERAIPDSRDGFKPVHRRIIHA 60

Query: 61  MSEMGLDFGAAFKKSARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNFGN 120
           MSEMGLDF AAFKKSARIVGEVIGKLHPHGDQSVYDSLVRLAQ FVQRYPLI GQGNFGN
Sbjct: 61  MSEMGLDFNAAFKKSARIVGEVIGKLHPHGDQSVYDSLVRLAQSFVQRYPLIRGQGNFGN 120

Query: 121 IDGDSAAAYRYTEARMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGT 180
           IDGDSAAAYRYTEARMTQVA+LILQGVDE+AVDFRDTYNEEDSEPVVFP KFPNLLANG+
Sbjct: 121 IDGDSAAAYRYTEARMTQVADLILQGVDENAVDFRDTYNEEDSEPVVFPGKFPNLLANGS 180

Query: 181 SGIAVGMATSIPSHNVQEICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIV 240
           SGIAVGMATSIPSHNV+EICEAAL LI++PE S+EKLLE+IIGPDFPTGGIIVESRESI 
Sbjct: 181 SGIAVGMATSIPSHNVEEICEAALILINDPESSLEKLLEHIIGPDFPTGGIIVESRESIF 240

Query: 241 ESYRLGRGGFRVRARWCVEEVGRGSWCIVVTEIPYQVQKSRLIEKIAELIIAKRIPLLED 300
           ESYR GRGGFRVRA+WCVE++GRGSWCIVV+EIPYQVQKSRLIEKIA+LI+ KRIPLLED
Sbjct: 241 ESYRSGRGGFRVRAKWCVEDLGRGSWCIVVSEIPYQVQKSRLIEKIADLIMTKRIPLLED 300

Query: 301 IRDESAEDVRIVLFPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVMPLDGI 360
           IRDESAED+RIVLFPKNRS+DPDLLMES+F+LSD+ETRFPLNMNVLSMGRVPQVM LDG+
Sbjct: 301 IRDESAEDIRIVLFPKNRSVDPDLLMESMFVLSDLETRFPLNMNVLSMGRVPQVMSLDGV 360

Query: 361 LKEWLAHRREVLFRRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSR 420
           LKEWL HRREVL RRSSFRMQAIDRRVE+LKGL IAYLNIDEIIAIIRNEDKPK VM+SR
Sbjct: 361 LKEWLVHRREVLLRRSSFRMQAIDRRVEVLKGLSIAYLNIDEIIAIIRNEDKPKSVMISR 420

Query: 421 FSLTENQVDAILNLRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIR 480
           FSLTENQ DAILNLRLRSLRKLEEYQIKSELDNLL EK+ ++ LLNS K+QW+QIACEIR
Sbjct: 421 FSLTENQADAILNLRLRSLRKLEEYQIKSELDNLLLEKDNLNLLLNSEKKQWDQIACEIR 480

Query: 481 EVKEIFSKSTDLGRRRTTFCEVSRADKATLQQAMIEKEPITVVISNRGWIRSLKSHSVDL 540
           EVKEIFSKSTDLGRRRT FCE  + DK  +QQAMIEKEP+TVVIS RGWIRSLK HS+DL
Sbjct: 481 EVKEIFSKSTDLGRRRTVFCEALKTDKVAVQQAMIEKEPVTVVISKRGWIRSLKGHSIDL 540

Query: 541 SALHFKEGDSLKIALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLIDLNHNQ 600
           SAL+FKEGD LKIA HA+TT+RILL STDG+AYTLP GNLLSGRGHGEAIQLLID+NHNQ
Sbjct: 541 SALNFKEGDGLKIAFHAYTTERILLFSTDGRAYTLPVGNLLSGRGHGEAIQLLIDINHNQ 600

Query: 601 DIVTAFVYDSTCKLLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVVKVTGDH 660
           DI+ AFV D TCKLL VS+KGNAFIV+ES+II NTRKGK F KVSS + MKLVVKV GD+
Sbjct: 601 DIMAAFVQDPTCKLLFVSNKGNAFIVQESQIIPNTRKGKQFFKVSSGDSMKLVVKVIGDN 660

Query: 661 VAVVGENRKLLIFSIDQIPEMSRGKGVRLQSYKDGGISDVICFKICEGLTWIDSAGRSYN 720
           VAVVGENRKLLIF IDQIPEM+RGKGVRLQSYKDGG+SDV+CF I EGLTW+DSAGRS+N
Sbjct: 661 VAVVGENRKLLIFPIDQIPEMNRGKGVRLQSYKDGGVSDVVCFNISEGLTWVDSAGRSFN 720

Query: 721 RSENDLLGWLGKRGGVGSLVPKGFPRSGKFLS 752
           RS++DL+ WLGKRGG GSLVPKGFPRSG F S
Sbjct: 721 RSKDDLIRWLGKRGGAGSLVPKGFPRSGNFFS 752


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|116251375|ref|YP_767213.1| DNA topoisomerase IV subunit A [Rhizobium leguminosarum bv. viciae 3841] Length = 751 Back     alignment and organism information
>gi|150396031|ref|YP_001326498.1| DNA topoisomerase IV subunit A [Sinorhizobium medicae WSM419] Length = 758 Back     alignment and organism information
>gi|15964952|ref|NP_385305.1| DNA topoisomerase IV subunit A [Sinorhizobium meliloti 1021] Length = 758 Back     alignment and organism information
>gi|307317757|ref|ZP_07597195.1| DNA topoisomerase IV, A subunit [Sinorhizobium meliloti AK83] Length = 758 Back     alignment and organism information
>gi|227821521|ref|YP_002825491.1| DNA topoisomerase IV subunit A [Sinorhizobium fredii NGR234] Length = 753 Back     alignment and organism information
>gi|222148193|ref|YP_002549150.1| DNA topoisomerase IV subunit A [Agrobacterium vitis S4] Length = 758 Back     alignment and organism information
>gi|190891181|ref|YP_001977723.1| DNA topoisomerase IV protein, subunit A [Rhizobium etli CIAT 652] Length = 751 Back     alignment and organism information
>gi|327192117|gb|EGE59094.1| DNA topoisomerase IV protein, subunit A [Rhizobium etli CNPAF512] Length = 751 Back     alignment and organism information
>gi|15888496|ref|NP_354177.1| DNA topoisomerase IV subunit A [Agrobacterium tumefaciens str. C58] Length = 750 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target753 DNA topoisomerase IV subunit A [Candidatus Liberibacter
PRK05561742 PRK05561, PRK05561, DNA topoisomerase IV subunit A; Val 0.0
TIGR01062735 TIGR01062, parC_Gneg, DNA topoisomerase IV, A subunit, 0.0
TIGR01061738 TIGR01061, parC_Gpos, DNA topoisomerase IV, A subunit, 1e-119
COG0188804 COG0188, GyrA, Type IIA topoisomerase (DNA gyrase/topo 0.0
PRK05560805 PRK05560, PRK05560, DNA gyrase subunit A; Validated 1e-178
TIGR01063800 TIGR01063, gyrA, DNA gyrase, A subunit 1e-171
pfam00521428 pfam00521, DNA_topoisoIV, DNA gyrase/topoisomerase IV, 1e-147
smart00434445 smart00434, TOP4c, DNA Topoisomerase IV 1e-146
cd00187445 cd00187, TOP4c, DNA Topoisomerase, subtype IIA; domain 1e-143
PHA02592439 PHA02592, 52, DNA topisomerase II medium subunit; Provi 5e-32
PLN031281135 PLN03128, PLN03128, DNA topoisomerase 2; Provisional 2e-15
PRK13979 957 PRK13979, PRK13979, DNA topoisomerase IV subunit A; Pro 1e-116
PRK09631635 PRK09631, PRK09631, DNA topoisomerase IV subunit A; Pro 1e-58
PRK12758 869 PRK12758, PRK12758, DNA topoisomerase IV subunit A; Pro 3e-52
KOG0355842 KOG0355, KOG0355, KOG0355, DNA topoisomerase type II [C 2e-15
PRK09630479 PRK09630, PRK09630, DNA topoisomerase IV subunit A; Pro 2e-35
PTZ001081388 PTZ00108, PTZ00108, DNA topoisomerase 2-like protein; P 6e-21
PLN032371465 PLN03237, PLN03237, DNA topoisomerase 2; Provisional 3e-12
KOG0355842 KOG0355, KOG0355, KOG0355, DNA topoisomerase type II [C 3e-10
>gnl|CDD|180129 PRK05561, PRK05561, DNA topoisomerase IV subunit A; Validated Back     alignment and domain information
>gnl|CDD|130134 TIGR01062, parC_Gneg, DNA topoisomerase IV, A subunit, proteobacterial Back     alignment and domain information
>gnl|CDD|162182 TIGR01061, parC_Gpos, DNA topoisomerase IV, A subunit, Gram-positive Back     alignment and domain information
>gnl|CDD|30537 COG0188, GyrA, Type IIA topoisomerase (DNA gyrase/topo II, topoisomerase IV), A subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|180128 PRK05560, PRK05560, DNA gyrase subunit A; Validated Back     alignment and domain information
>gnl|CDD|162183 TIGR01063, gyrA, DNA gyrase, A subunit Back     alignment and domain information
>gnl|CDD|144201 pfam00521, DNA_topoisoIV, DNA gyrase/topoisomerase IV, subunit A Back     alignment and domain information
>gnl|CDD|128711 smart00434, TOP4c, DNA Topoisomerase IV Back     alignment and domain information
>gnl|CDD|29149 cd00187, TOP4c, DNA Topoisomerase, subtype IIA; domain A'; bacterial DNA topoisomerase IV (C subunit, ParC), bacterial DNA gyrases (A subunit, GyrA),mammalian DNA toposiomerases II Back     alignment and domain information
>gnl|CDD|177419 PHA02592, 52, DNA topisomerase II medium subunit; Provisional Back     alignment and domain information
>gnl|CDD|178674 PLN03128, PLN03128, DNA topoisomerase 2; Provisional Back     alignment and domain information
>gnl|CDD|184434 PRK13979, PRK13979, DNA topoisomerase IV subunit A; Provisional Back     alignment and domain information
>gnl|CDD|182004 PRK09631, PRK09631, DNA topoisomerase IV subunit A; Provisional Back     alignment and domain information
>gnl|CDD|183728 PRK12758, PRK12758, DNA topoisomerase IV subunit A; Provisional Back     alignment and domain information
>gnl|CDD|35576 KOG0355, KOG0355, KOG0355, DNA topoisomerase type II [Chromatin structure and dynamics] Back     alignment and domain information
>gnl|CDD|170022 PRK09630, PRK09630, DNA topoisomerase IV subunit A; Provisional Back     alignment and domain information
>gnl|CDD|185451 PTZ00108, PTZ00108, DNA topoisomerase 2-like protein; Provisional Back     alignment and domain information
>gnl|CDD|178775 PLN03237, PLN03237, DNA topoisomerase 2; Provisional Back     alignment and domain information
>gnl|CDD|35576 KOG0355, KOG0355, KOG0355, DNA topoisomerase type II [Chromatin structure and dynamics] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 753 DNA topoisomerase IV subunit A [Candidatus Liberibacter
TIGR01063864 gyrA DNA gyrase, A subunit; InterPro: IPR005743 DNA top 100.0
PRK05561745 DNA topoisomerase IV subunit A; Validated 100.0
PRK05560822 DNA gyrase subunit A; Validated 100.0
PRK13979 959 DNA topoisomerase IV subunit A; Provisional,Validated 100.0
COG0188804 GyrA Type IIA topoisomerase (DNA gyrase/topo II, topois 100.0
TIGR01061745 parC_Gpos DNA topoisomerase IV, A subunit; InterPro: IP 100.0
TIGR01062747 parC_Gneg DNA topoisomerase IV, A subunit; InterPro: IP 100.0
PRK09631626 DNA topoisomerase IV subunit A; Provisional 100.0
PRK12758 879 DNA topoisomerase IV subunit A; Provisional 100.0
KOG0355842 consensus 99.96
PRK09630479 DNA topoisomerase IV subunit A; Provisional 100.0
smart00434445 TOP4c DNA Topoisomerase IV. Bacterial DNA topoisomerase 100.0
cd00187445 TOP4c DNA Topoisomerase, subtype IIA; domain A'; bacter 100.0
pfam00521428 DNA_topoisoIV DNA gyrase/topoisomerase IV, subunit A. 100.0
PTZ001081506 DNA topoisomerase II; Provisional 100.0
KOG0355842 consensus 99.96
PRK13979959 DNA topoisomerase IV subunit A; Provisional,Validated 99.93
PRK05561745 DNA topoisomerase IV subunit A; Validated 99.61
TIGR01062747 parC_Gneg DNA topoisomerase IV, A subunit; InterPro: IP 97.7
PRK05560822 DNA gyrase subunit A; Validated 99.92
TIGR01063864 gyrA DNA gyrase, A subunit; InterPro: IPR005743 DNA top 99.89
COG0188804 GyrA Type IIA topoisomerase (DNA gyrase/topo II, topois 99.61
TIGR01061745 parC_Gpos DNA topoisomerase IV, A subunit; InterPro: IP 98.98
pfam0398950 DNA_gyraseA_C DNA gyrase C-terminal domain, beta-propel 97.58
PRK09630479 DNA topoisomerase IV subunit A; Provisional 97.45
pfam0398950 DNA_gyraseA_C DNA gyrase C-terminal domain, beta-propel 96.9
PRK09631626 DNA topoisomerase IV subunit A; Provisional 93.59
>TIGR01063 gyrA DNA gyrase, A subunit; InterPro: IPR005743 DNA topoisomerases regulate the number of topological links between two DNA strands (i Back     alignment and domain information
>PRK05561 DNA topoisomerase IV subunit A; Validated Back     alignment and domain information
>PRK05560 DNA gyrase subunit A; Validated Back     alignment and domain information
>PRK13979 DNA topoisomerase IV subunit A; Provisional,Validated Back     alignment and domain information
>COG0188 GyrA Type IIA topoisomerase (DNA gyrase/topo II, topoisomerase IV), A subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR01061 parC_Gpos DNA topoisomerase IV, A subunit; InterPro: IPR005741 DNA topoisomerases regulate the number of topological links between two DNA strands (i Back     alignment and domain information
>TIGR01062 parC_Gneg DNA topoisomerase IV, A subunit; InterPro: IPR005742 DNA topoisomerases regulate the number of topological links between two DNA strands (i Back     alignment and domain information
>PRK09631 DNA topoisomerase IV subunit A; Provisional Back     alignment and domain information
>PRK12758 DNA topoisomerase IV subunit A; Provisional Back     alignment and domain information
>KOG0355 consensus Back     alignment and domain information
>PRK09630 DNA topoisomerase IV subunit A; Provisional Back     alignment and domain information
>smart00434 TOP4c DNA Topoisomerase IV Back     alignment and domain information
>cd00187 TOP4c DNA Topoisomerase, subtype IIA; domain A'; bacterial DNA topoisomerase IV (C subunit, ParC), bacterial DNA gyrases (A subunit, GyrA),mammalian DNA toposiomerases II Back     alignment and domain information
>pfam00521 DNA_topoisoIV DNA gyrase/topoisomerase IV, subunit A Back     alignment and domain information
>PTZ00108 DNA topoisomerase II; Provisional Back     alignment and domain information
>KOG0355 consensus Back     alignment and domain information
>PRK13979 DNA topoisomerase IV subunit A; Provisional,Validated Back     alignment and domain information
>PRK05561 DNA topoisomerase IV subunit A; Validated Back     alignment and domain information
>TIGR01062 parC_Gneg DNA topoisomerase IV, A subunit; InterPro: IPR005742 DNA topoisomerases regulate the number of topological links between two DNA strands (i Back     alignment and domain information
>PRK05560 DNA gyrase subunit A; Validated Back     alignment and domain information
>TIGR01063 gyrA DNA gyrase, A subunit; InterPro: IPR005743 DNA topoisomerases regulate the number of topological links between two DNA strands (i Back     alignment and domain information
>COG0188 GyrA Type IIA topoisomerase (DNA gyrase/topo II, topoisomerase IV), A subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR01061 parC_Gpos DNA topoisomerase IV, A subunit; InterPro: IPR005741 DNA topoisomerases regulate the number of topological links between two DNA strands (i Back     alignment and domain information
>pfam03989 DNA_gyraseA_C DNA gyrase C-terminal domain, beta-propeller Back     alignment and domain information
>PRK09630 DNA topoisomerase IV subunit A; Provisional Back     alignment and domain information
>pfam03989 DNA_gyraseA_C DNA gyrase C-terminal domain, beta-propeller Back     alignment and domain information
>PRK09631 DNA topoisomerase IV subunit A; Provisional Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target753 DNA topoisomerase IV subunit A [Candidatus Liberibacter
1zvu_A716 Structure Of The Full-Length E. Coli Parc Subunit L 1e-164
2xco_A726 The 3.1a Crystal Structure Of The Catalytic Core (B 1e-140
2xcr_B726 The 3.5a Crystal Structure Of The Catalytic Core (B 1e-139
2xcs_B692 The 2.1a Crystal Structure Of S. Aureus Gyrase Comp 1e-139
2wl2_B522 Crystal Structure Of N-Terminal Domain Of Gyra With 1e-135
3ifz_A508 Crystal Structure Of The First Part Of The Mycobact 1e-129
3nuh_A525 A Domain Insertion In E. Coli Gyrb Adopts A Novel F 1e-128
2nov_A496 Breakage-Reunion Domain Of S.Pneumoniae Topo Iv: Cr 1e-122
2xkj_E767 Crystal Structure Of Catalytic Core Of A. Baumannii 1e-122
2xkk_A767 Crystal Structure Of Moxifloxacin, Dna, And A. Baum 1e-120
2inr_A514 Crystal Structure Of A 59 Kda Fragment Of Topoisome 1e-119
3ilw_A470 Structure Of Dna Gyrase Subunit A N-Terminal Domain 1e-117
1ab4_A493 59kda Fragment Of Gyrase A From E. Coli Length = 49 1e-122
3lpx_A500 Crystal Structure Of Gyra Length = 500 1e-121
1bgw_A793 Topoisomerase Residues 410-1202 Length = 793 2e-48
2rgr_A759 Topoisomerase Iia Bound To G-Segment Dna Length = 7 3e-48
3l4k_A722 Topoisomerase Ii-Dna Cleavage Complex, Apo Length = 4e-48
1zi0_A307 A Superhelical Spiral In Escherichia Coli Dna Gyras 7e-48
3l6v_A370 Crystal Structure Of The Xanthomonas Campestris Gyr 3e-46
1zvt_A256 Structure Of The E. Coli Parc C-Terminal Domain Len 5e-37
1wp5_A323 Crystal Structure Of The C-Terminal Domain Of Dna T 5e-32
1suu_A312 Structure Of Dna Gyrase A C-Terminal Domain Length 5e-27
1zi0_A 307 A Superhelical Spiral In Escherichia Coli Dna Gyras 1e-06
3no0_A276 Aquifex Aeolicus Type Iia Topoisomerase C-Terminal 3e-22
3no0_A 276 Aquifex Aeolicus Type Iia Topoisomerase C-Terminal 6e-06
3l6v_A370 Crystal Structure Of The Xanthomonas Campestris Gyr 2e-08
1suu_A312 Structure Of Dna Gyrase A C-Terminal Domain Length 5e-08
3no0_A276 Aquifex Aeolicus Type Iia Topoisomerase C-Terminal 5e-09
3no0_A276 Aquifex Aeolicus Type Iia Topoisomerase C-Terminal 1e-04
>gi|71042522|pdb|1ZVU|A Chain A, Structure Of The Full-Length E. Coli Parc Subunit Length = 716 Back     alignment and structure
 Score =  582 bits (1500), Expect = e-164,   Method: Composition-based stats.
 Identities = 263/724 (36%), Positives = 433/724 (59%), Gaps = 25/724 (3%)

Query: 39  KERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFKKSARIVGEVIGKLHPHGDQSVYDSL 98
            +RA+P + DG KPV RRI++AMSE+GL+  A FKKSAR VG+V+GK HPHGD + Y+++
Sbjct: 1   MDRALPFIGDGLKPVQRRIVYAMSELGLNASAKFKKSARTVGDVLGKYHPHGDSACYEAM 60

Query: 99  VRLAQPFVQRYPLISGQGNFGNIDG-DSAAAYRYTEARMTQVAELILQGVDEDAVDFRDT 157
           V +AQPF  RYPL+ GQGN+G  D   S AA RYTE+R+++ +EL+L  + +   D+   
Sbjct: 61  VLMAQPFSYRYPLVDGQGNWGAPDDPKSFAAMRYTESRLSKYSELLLSELGQGTADWVPN 120

Query: 158 YNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPSHNVQEICEAALALIDNPEISIEKL 217
           ++    EP + P++ PN+L NGT+GIAVGMAT IP HN++E+ +AA+ALID P+ ++++L
Sbjct: 121 FDGTLQEPKMLPARLPNILLNGTTGIAVGMATDIPPHNLREVAQAAIALIDQPKTTLDQL 180

Query: 218 LEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVRARWCVEEVGRGSWCIVVTEIPYQV 277
           L+ + GPD+PT   I+ SR  I + Y  GRG  R+RA W  E+       +V++ +P+QV
Sbjct: 181 LDIVQGPDYPTEAEIITSRAEIRKIYENGRGSVRMRAVWKKED-----GAVVISALPHQV 235

Query: 278 QKSRLIEKIAELIIAKRIPLLEDIRDESAEDV--RIVLFPKNRSLDPDLLMESIFMLSDM 335
             +R++E+IA  +  K++P+++D+RDES  +   R+V+ P++  +D D +M  +F  +D+
Sbjct: 236 SGARVLEQIAAQMRNKKLPMVDDLRDESDHENPTRLVIVPRSNRVDMDQVMNHLFATTDL 295

Query: 336 ETRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREVLFRRSSFRMQAIDRRVEILKGLLI 395
           E  + +N+N++ +   P V  L  IL EWL  RR+ + RR ++R++ + +R+ IL+GLL+
Sbjct: 296 EKSYRINLNMIGLDGRPAVKNLLEILSEWLVFRRDTVRRRLNYRLEKVLKRLHILEGLLV 355

Query: 396 AYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQVDAILNLRLRSLRKLEEYQIKSELDNLL 455
           A+LNIDE+I IIRNED+PKP ++SRF LTE Q +AIL L+LR L KLEE +I+ E   L 
Sbjct: 356 AFLNIDEVIEIIRNEDEPKPALMSRFGLTETQAEAILELKLRHLAKLEEMKIRGEQSELE 415

Query: 456 AEKEKIDSLLNSGKQQWNQIACEIREVKEIFSKSTDLGRRRTTFCEVSRADKATLQQAMI 515
            E++++  +L S ++  N +  E++   + +        RR+   E   A KA  +  M+
Sbjct: 416 KERDQLQGILASERKMNNLLKKELQADAQAYGD-----DRRSPLQEREEA-KAMSEHDML 469

Query: 516 EKEPITVVISNRGWIRSLKSHSVDLSALHFKEGDSLKIALHAHTTDRILLLSTDGKAYTL 575
             EP+T+V+S  GW+RS K H +D   L++K GDS K A+   +   ++ + + G++Y +
Sbjct: 470 PSEPVTIVLSQMGWVRSAKGHDIDAPGLNYKAGDSFKAAVKGKSNQPVVFVDSTGRSYAI 529

Query: 576 PAGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVYDSTCKLLVVSSKGNAFIVEESEIIANT 635
               L S RG GE +   + L     +    +     KLL+ S  G  F+   ++++A  
Sbjct: 530 DPITLPSARGQGEPLTGKLTLPPGATVDHMLMESDDQKLLMASDAGYGFVCTFNDLVARN 589

Query: 636 RKGKTFLKVSSEEKMKLVVKVTG--DHVAVVGENRKLLIFSIDQIPEMSRGKGVRLQSYK 693
           R GK  + +     +   V +    D +  + +  ++L+F +  +P++S+GKG ++ +  
Sbjct: 590 RAGKALITLPENAHVMPPVVIEDASDMLLAITQAGRMLMFPVSDLPQLSKGKGNKIINIP 649

Query: 694 -------DGGISDVICFKICEGLTWIDSAGRSYNRSENDLLGWLGKRGGVGSLVPKGFPR 746
                  + G++ +        LT      R       +L    G+RG  G+ + +G  R
Sbjct: 650 SAEAARGEDGLAQLYVLPPQSTLTI-HVGKRKIKLRPEELQKVTGERGRRGT-LMRGLQR 707

Query: 747 SGKF 750
             + 
Sbjct: 708 IDRV 711


>gi|302148632|pdb|2XCO|A Chain A, The 3.1a Crystal Structure Of The Catalytic Core (B'a' Region) Of Staphylococcus Aureus Dna Gyrase Length = 726 Back     alignment and structure
>gi|302148634|pdb|2XCR|B Chain B, The 3.5a Crystal Structure Of The Catalytic Core (B'a' Region) Of Staphylococcus Aureus Dna Gyrase Complexed With Gsk299423 And Dna Length = 726 Back     alignment and structure
>gi|302148642|pdb|2XCS|B Chain B, The 2.1a Crystal Structure Of S. Aureus Gyrase Complex With Gsk299423 And Dna Length = 692 Back     alignment and structure
>gi|301598495|pdb|3IFZ|A Chain A, Crystal Structure Of The First Part Of The Mycobacterium Tuberculosis Dna Gyrase Reaction Core: The Breakage And Reunion Domain At 2.7 A Resolution Length = 508 Back     alignment and structure
>gi|302566244|pdb|3NUH|A Chain A, A Domain Insertion In E. Coli Gyrb Adopts A Novel Fold That Plays A Critical Role In Gyrase Function Length = 525 Back     alignment and structure
>gi|119390532|pdb|2NOV|A Chain A, Breakage-Reunion Domain Of S.Pneumoniae Topo Iv: Crystal Structure Of A Gram-Positive Quinolone Target Length = 496 Back     alignment and structure
>gi|305677637|pdb|2XKJ|E Chain E, Crystal Structure Of Catalytic Core Of A. Baumannii Topo Iv (Pare-Parc Fusion Truncate) Length = 767 Back     alignment and structure
>gi|305677638|pdb|2XKK|A Chain A, Crystal Structure Of Moxifloxacin, Dna, And A. Baumannii Topo Iv (Pare-Parc Fusion Truncate) Length = 767 Back     alignment and structure
>gi|158428820|pdb|2INR|A Chain A, Crystal Structure Of A 59 Kda Fragment Of Topoisomerase Iv Subunit A (Grla) From Staphylococcus Aureus Length = 514 Back     alignment and structure
>gi|260656380|pdb|3ILW|A Chain A, Structure Of Dna Gyrase Subunit A N-Terminal Domain Length = 470 Back     alignment and structure
>gi|157829780|pdb|1AB4|A Chain A, 59kda Fragment Of Gyrase A From E. Coli Length = 493 Back     alignment and structure
>gi|323462878|pdb|3LPX|A Chain A, Crystal Structure Of Gyra Length = 500 Back     alignment and structure
>gi|157830305|pdb|1BGW|A Chain A, Topoisomerase Residues 410-1202 Length = 793 Back     alignment and structure
>gi|163931058|pdb|2RGR|A Chain A, Topoisomerase Iia Bound To G-Segment Dna Length = 759 Back     alignment and structure
>gi|67463753|pdb|1ZI0|A Chain A, A Superhelical Spiral In Escherichia Coli Dna Gyrase A C- Terminal Domain Imparts Unidirectional Supercoiling Bias Length = 307 Back     alignment and structure
>gi|290790184|pdb|3L6V|A Chain A, Crystal Structure Of The Xanthomonas Campestris Gyrase A C- Terminal Domain Length = 370 Back     alignment and structure
>gi|71042520|pdb|1ZVT|A Chain A, Structure Of The E. Coli Parc C-Terminal Domain Length = 256 Back     alignment and structure
>gi|56554393|pdb|1WP5|A Chain A, Crystal Structure Of The C-Terminal Domain Of Dna Topoisomerase Iv Length = 323 Back     alignment and structure
>gi|48425718|pdb|1SUU|A Chain A, Structure Of Dna Gyrase A C-Terminal Domain Length = 312 Back     alignment and structure
>gi|67463753|pdb|1ZI0|A Chain A, A Superhelical Spiral In Escherichia Coli Dna Gyrase A C- Terminal Domain Imparts Unidirectional Supercoiling Bias Length = 307 Back     alignment and structure
>gi|313103856|pdb|3NO0|A Chain A, Aquifex Aeolicus Type Iia Topoisomerase C-Terminal Domain Length = 276 Back     alignment and structure
>gi|313103856|pdb|3NO0|A Chain A, Aquifex Aeolicus Type Iia Topoisomerase C-Terminal Domain Length = 276 Back     alignment and structure
>gi|290790184|pdb|3L6V|A Chain A, Crystal Structure Of The Xanthomonas Campestris Gyrase A C- Terminal Domain Length = 370 Back     alignment and structure
>gi|48425718|pdb|1SUU|A Chain A, Structure Of Dna Gyrase A C-Terminal Domain Length = 312 Back     alignment and structure
>gi|313103856|pdb|3NO0|A Chain A, Aquifex Aeolicus Type Iia Topoisomerase C-Terminal Domain Length = 276 Back     alignment and structure
>gi|313103856|pdb|3NO0|A Chain A, Aquifex Aeolicus Type Iia Topoisomerase C-Terminal Domain Length = 276 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target753 DNA topoisomerase IV subunit A [Candidatus Liberibacter
1zvu_A716 Topoisomerase IV subunit A; beta-pinwheel, ATPase, supe 1e-167
2wl2_A522 GYRA, DNA gyrase subunit A; isomerase, aminocoumarin an 1e-145
2inr_A514 DNA topoisomerase 4 subunit A; topoisomerase II fold; H 1e-137
2xcs_B692 DNA gyrase subunit B, DNA gyrase subunit A; isomerase, 1e-136
2xkj_E767 Topoisomerase IV; type IIA topoisomerase; 2.20A {Acinet 1e-132
3ilw_A470 DNA gyrase subunit A; DNA topology, topoisomerase, anti 1e-122
2nov_A496 DNA topoisomerase 4 subunit A; protein, PARC, TOPO IV, 1e-120
3l4j_A757 DNA topoisomerase 2; topoisomerase, protein-DNA complex 5e-79
1bjt_A793 Topoisomerase II; quaternary change, DNA-binding, DNA t 1e-60
2pff_A1688 Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl-carr 4e-05
1zvt_A256 Topoisomerase IV subunit A; beta-pinwheel, ATPase, supe 2e-40
3l6v_A 370 GYRA, DNA gyrase subunit A; gyrase A C-terminal domain, 9e-17
3ku8_A156 GYRA14, DNA gyrase subunit A; alpha+beta, SH3 domain, t 4e-21
1zi0_A307 DNA gyrase subunit A; beta pinwheel, topoisomerase, spi 1e-11
1zi0_A307 DNA gyrase subunit A; beta pinwheel, topoisomerase, spi 2e-06
1wp5_A323 Topoisomerase IV; broken beta-propeller, hairpin-invade 7e-11
1suu_A312 DNA gyrase subunit A; topoisomerase,DNA gyrase, beta-pr 3e-06
>1zvu_A Topoisomerase IV subunit A; beta-pinwheel, ATPase, supercoiling, decatenation, DNA binding, DNA topology; 3.00A {Escherichia coli} Length = 716 Back     alignment and structure
 Score =  583 bits (1503), Expect = e-167
 Identities = 262/724 (36%), Positives = 431/724 (59%), Gaps = 25/724 (3%)

Query: 40  ERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFKKSARIVGEVIGKLHPHGDQSVYDSLV 99
           +RA+P + DG KPV RRI++AMSE+GL+  A FKKSAR VG+V+GK HPHGD + Y+++V
Sbjct: 2   DRALPFIGDGLKPVQRRIVYAMSELGLNASAKFKKSARTVGDVLGKYHPHGDSACYEAMV 61

Query: 100 RLAQPFVQRYPLISGQGNFGNIDG-DSAAAYRYTEARMTQVAELILQGVDEDAVDFRDTY 158
            +AQPF  RYPL+ GQGN+G  D   S AA RYTE+R+++ +EL+L  + +   D+   +
Sbjct: 62  LMAQPFSYRYPLVDGQGNWGAPDDPKSFAAMRYTESRLSKYSELLLSELGQGTADWVPNF 121

Query: 159 NEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPSHNVQEICEAALALIDNPEISIEKLL 218
           +    EP + P++ PN+L NGT+GIAVGMAT IP HN++E+ +AA+ALID P+ ++++LL
Sbjct: 122 DGTLQEPKMLPARLPNILLNGTTGIAVGMATDIPPHNLREVAQAAIALIDQPKTTLDQLL 181

Query: 219 EYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVRARWCVEEVGRGSWCIVVTEIPYQVQ 278
           + + GPD+PT   I+ SR  I + Y  GRG  R+RA W  E+       +V++ +P+QV 
Sbjct: 182 DIVQGPDYPTEAEIITSRAEIRKIYENGRGSVRMRAVWKKED-----GAVVISALPHQVS 236

Query: 279 KSRLIEKIAELIIAKRIPLLEDIRDESAED--VRIVLFPKNRSLDPDLLMESIFMLSDME 336
            +R++E+IA  +  K++P+++D+RDES  +   R+V+ P++  +D D +M  +F  +D+E
Sbjct: 237 GARVLEQIAAQMRNKKLPMVDDLRDESDHENPTRLVIVPRSNRVDMDQVMNHLFATTDLE 296

Query: 337 TRFPLNMNVLSMGRVPQVMPLDGILKEWLAHRREVLFRRSSFRMQAIDRRVEILKGLLIA 396
             + +N+N++ +   P V  L  IL EWL  RR+ + RR ++R++ + +R+ IL+GLL+A
Sbjct: 297 KSYRINLNMIGLDGRPAVKNLLEILSEWLVFRRDTVRRRLNYRLEKVLKRLHILEGLLVA 356

Query: 397 YLNIDEIIAIIRNEDKPKPVMVSRFSLTENQVDAILNLRLRSLRKLEEYQIKSELDNLLA 456
           +LNIDE+I IIRNED+PKP ++SRF LTE Q +AIL L+LR L KLEE +I+ E   L  
Sbjct: 357 FLNIDEVIEIIRNEDEPKPALMSRFGLTETQAEAILELKLRHLAKLEEMKIRGEQSELEK 416

Query: 457 EKEKIDSLLNSGKQQWNQIACEIREVKEIFSKSTDLGRRRTTFCEVSRADKATLQQAMIE 516
           E++++  +L S ++  N +  E++   + +      G  R +  +     KA  +  M+ 
Sbjct: 417 ERDQLQGILASERKMNNLLKKELQADAQAY------GDDRRSPLQEREEAKAMSEHDMLP 470

Query: 517 KEPITVVISNRGWIRSLKSHSVDLSALHFKEGDSLKIALHAHTTDRILLLSTDGKAYTLP 576
            EP+T+V+S  GW+RS K H +D   L++K GDS K A+   +   ++ + + G++Y + 
Sbjct: 471 SEPVTIVLSQMGWVRSAKGHDIDAPGLNYKAGDSFKAAVKGKSNQPVVFVDSTGRSYAID 530

Query: 577 AGNLLSGRGHGEAIQLLIDLNHNQDIVTAFVYDSTCKLLVVSSKGNAFIVEESEIIANTR 636
              L S RG GE +   + L     +    +     KLL+ S  G  F+   ++++A  R
Sbjct: 531 PITLPSARGQGEPLTGKLTLPPGATVDHMLMESDDQKLLMASDAGYGFVCTFNDLVARNR 590

Query: 637 KGKTFLKVSSEEKMKLVVKVTG--DHVAVVGENRKLLIFSIDQIPEMSRGKGVRLQSYKD 694
            GK  + +     +   V +    D +  + +  ++L+F +  +P++S+GKG ++ +   
Sbjct: 591 AGKALITLPENAHVMPPVVIEDASDMLLAITQAGRMLMFPVSDLPQLSKGKGNKIINIPS 650

Query: 695 G-------GISDVICFKICEGLTWIDSAGRSYNRSENDLLGWLGKRGGVGSLVPKGFPRS 747
                   G++ +        LT      R       +L    G+RG  G+L  +G  R 
Sbjct: 651 AEAARGEDGLAQLYVLPPQSTLTIH-VGKRKIKLRPEELQKVTGERGRRGTL-MRGLQRI 708

Query: 748 GKFL 751
            +  
Sbjct: 709 DRVE 712


>2inr_A DNA topoisomerase 4 subunit A; topoisomerase II fold; HET: DNA; 2.80A {Staphylococcus aureus} Length = 514 Back     alignment and structure
>2xcs_B DNA gyrase subunit B, DNA gyrase subunit A; isomerase, type IIA topoisomerase; HET: DNA 5UA RXV; 2.10A {Staphylococcus aureus} PDB: 2xcr_B* 2xcq_A* 2xco_A* Length = 692 Back     alignment and structure
>2xkj_E Topoisomerase IV; type IIA topoisomerase; 2.20A {Acinetobacter baumannii} PDB: 2xkk_A* Length = 767 Back     alignment and structure
>3ilw_A DNA gyrase subunit A; DNA topology, topoisomerase, antibiotic resistance, breakage-reunion domain, structural genomics; HET: DNA; 1.60A {Mycobacterium tuberculosis} Length = 470 Back     alignment and structure
>2nov_A DNA topoisomerase 4 subunit A; protein, PARC, TOPO IV, GRAM-positive bacteria, quinolone target, DNA binding, DNA cleavage; HET: DNA; 2.67A {Streptococcus pneumoniae} PDB: 3foe_A* 3fof_A* Length = 496 Back     alignment and structure
>3l4j_A DNA topoisomerase 2; topoisomerase, protein-DNA complex, covalently linked comple supercoiling; HET: DNA PTR TSP; 2.48A {Saccharomyces cerevisiae} PDB: 3l4k_A* 1bjt_A 1bgw_A 2rgr_A* Length = 757 Back     alignment and structure
>1bjt_A Topoisomerase II; quaternary change, DNA-binding, DNA topology; 2.50A {Saccharomyces cerevisiae} SCOP: e.11.1.1 PDB: 1bgw_A 2rgr_A* Length = 793 Back     alignment and structure
>2pff_A Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl-carrier-; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl reductase, beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} Length = 1688 Back     alignment and structure
>1zvt_A Topoisomerase IV subunit A; beta-pinwheel, ATPase, supercoiling, decatenation, DNA binding, DNA topology; 1.70A {Escherichia coli} Length = 256 Back     alignment and structure
>3l6v_A GYRA, DNA gyrase subunit A; gyrase A C-terminal domain, GYRA C-terminal domain, DNA wrapping, beta-strand-bearing proline, ATP-binding; HET: DNA; 2.19A {Xanthomonas campestris PV} Length = 370 Back     alignment and structure
>3ku8_A GYRA14, DNA gyrase subunit A; alpha+beta, SH3 domain, topoisomerase, toxin-isomerase compl; HET: DNA; 1.93A {Escherichia coli} PDB: 1x75_A* 3kua_A* Length = 156 Back     alignment and structure
>1zi0_A DNA gyrase subunit A; beta pinwheel, topoisomerase, spiralling beta pinwheel, DNA wrapping, isomerase, DNA bindng protein; HET: DNA; 2.60A {Escherichia coli} Length = 307 Back     alignment and structure
>1zi0_A DNA gyrase subunit A; beta pinwheel, topoisomerase, spiralling beta pinwheel, DNA wrapping, isomerase, DNA bindng protein; HET: DNA; 2.60A {Escherichia coli} Length = 307 Back     alignment and structure
>1wp5_A Topoisomerase IV; broken beta-propeller, hairpin-invaded beta-propeller, six- bladed beta-propeller; 1.79A {Geobacillus stearothermophilus} SCOP: b.68.10.1 Length = 323 Back     alignment and structure
>1suu_A DNA gyrase subunit A; topoisomerase,DNA gyrase, beta-propeller, beta-pinwheel; HET: DNA; 1.75A {Borrelia burgdorferi} SCOP: b.68.10.1 Length = 312 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target753 DNA topoisomerase IV subunit A [Candidatus Liberibacter
1zvu_A716 Topoisomerase IV subunit A; beta-pinwheel, ATPase, supe 100.0
2wl2_A522 GYRA, DNA gyrase subunit A; isomerase, aminocoumarin an 100.0
2inr_A514 DNA topoisomerase 4 subunit A; topoisomerase II fold; H 100.0
2nov_A496 DNA topoisomerase 4 subunit A; protein, PARC, TOPO IV, 100.0
3ilw_A470 DNA gyrase subunit A; DNA topology, topoisomerase, anti 100.0
2xcs_B692 DNA gyrase subunit B, DNA gyrase subunit A; isomerase, 100.0
2xkj_E767 Topoisomerase IV; type IIA topoisomerase; 2.20A {Acinet 100.0
3l4j_A757 DNA topoisomerase 2; topoisomerase, protein-DNA complex 100.0
1wp5_A323 Topoisomerase IV; broken beta-propeller, hairpin-invade 100.0
3l6v_A370 GYRA, DNA gyrase subunit A; gyrase A C-terminal domain, 100.0
1suu_A312 DNA gyrase subunit A; topoisomerase,DNA gyrase, beta-pr 100.0
1zi0_A307 DNA gyrase subunit A; beta pinwheel, topoisomerase, spi 100.0
1zvt_A256 Topoisomerase IV subunit A; beta-pinwheel, ATPase, supe 100.0
3ku8_A156 GYRA14, DNA gyrase subunit A; alpha+beta, SH3 domain, t 99.95
1suu_A312 DNA gyrase subunit A; topoisomerase,DNA gyrase, beta-pr 99.9
3l6v_A370 GYRA, DNA gyrase subunit A; gyrase A C-terminal domain, 99.89
1zi0_A307 DNA gyrase subunit A; beta pinwheel, topoisomerase, spi 99.88
1wp5_A323 Topoisomerase IV; broken beta-propeller, hairpin-invade 99.87
1zvu_A716 Topoisomerase IV subunit A; beta-pinwheel, ATPase, supe 99.43
1zvt_A256 Topoisomerase IV subunit A; beta-pinwheel, ATPase, supe 99.16
3l4j_A757 DNA topoisomerase 2; topoisomerase, protein-DNA complex 94.61
>1zvu_A Topoisomerase IV subunit A; beta-pinwheel, ATPase, supercoiling, decatenation, DNA binding, DNA topology; 3.00A {Escherichia coli} Back     alignment and structure
Probab=100.00  E-value=0  Score=1690.12  Aligned_cols=699  Identities=37%  Similarity=0.691  Sum_probs=653.5

Q ss_pred             HHCCCCCCCCCCCHHHHHHHHHHHHCCCCCCCCEEEEEHHHHHHHCCCCCCHHHHHHHHHHHHCCHHHCCCCCCCCCCCC
Q ss_conf             51047641128970468999999986899989803540536665427688747899999996100132166132678870
Q gi|254780353|r   39 KERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFKKSARIVGEVIGKLHPHGDQSVYDSLVRLAQPFVQRYPLISGQGNF  118 (753)
Q Consensus        39 ~~Ralpd~~DGlKpvqRril~~m~~~~~~~~~~~~K~ar~vg~v~gkyhPHGd~s~y~a~v~maq~~~~~~pli~g~Gnf  118 (753)
                      .+|||||+|||||||||||||||+++|+.++++|+||||+||+|||+||||||+|+|||||||||+|+|||||+||||||
T Consensus         1 l~RalP~~~DGlKpvqRril~~m~~~~~~~~~~~~k~a~~vg~v~g~yhpHGd~s~~~a~v~maq~~~~~~pl~~~~Gnf   80 (716)
T 1zvu_A            1 MDRALPFIGDGLKPVQRRIVYAMSELGLNASAKFKKSARTVGDVLGKYHPHGDSACYEAMVLMAQPFSYRYPLVDGQGNW   80 (716)
T ss_dssp             -CCCCCBTTTCCCHHHHHHHHHHSTTCC----------CCHHHHHTTTSCTTCHHHHHHHHHHTSTTSCSSCSEEECSCC
T ss_pred             CCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCCCEEEEHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHCCCEEECCCCC
T ss_conf             98778972238857888999999862898999854435479887418889759999999999835323046216478987


Q ss_pred             CCCCCC-CCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCEEEEEEECCCCCHHHHCCCCCHHHHHHHHCCCCCHH
Q ss_conf             886779-7100246899855999999842187861752167996324223123452676426650467777516777889
Q gi|254780353|r  119 GNIDGD-SAAAYRYTEARMTQVAELILQGVDEDAVDFRDTYNEEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPSHNVQ  197 (753)
Q Consensus       119 Gs~~~d-~~Aa~RYte~rl~~~~~~ll~di~~~~v~~~~n~D~~~~EP~~lp~~~P~lL~Ng~~GIavG~at~ipphnl~  197 (753)
                      ||++|+ +||||||||||||++++.||+|+|++||||+|||||+++||+|||++|||||||||+|||||||||||||||+
T Consensus        81 Gs~~~~~~~Aa~RY~e~rls~~~~~~~~~~~~~~~~~~~n~Dg~~~EP~~lp~~~P~lLvNG~~GIavG~aT~IpphNl~  160 (716)
T 1zvu_A           81 GAPDDPKSFAAMRYTESRLSKYSELLLSELGQGTADWVPNFDGTLQEPKMLPARLPNILLNGTTGIAVGMATDIPPHNLR  160 (716)
T ss_dssp             SSSSSCCCTTSSCGGGEEECGGGHHHHTTTTSSCSCEEECTTSSSEEESSCCCSSCHHHHHCCCSCCSSCSCBCCCBCHH
T ss_pred             CCCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHCCCCCCCHHHHHCCCCCCHH
T ss_conf             89999965465667873557999998764065744766388987458730266564776357765456765277663368


Q ss_pred             HHHHHHHHHHHCCCCCCHHHHHHCCCCCCCCCCCCCCCHHHHHHHHHCCCCEEEEEEEEEEEECCCCCEEEEEECCCCCC
Q ss_conf             99999999872865320134432036778877601069889998985033415999999986437884079995242002
Q gi|254780353|r  198 EICEAALALIDNPEISIEKLLEYIIGPDFPTGGIIVESRESIVESYRLGRGGFRVRARWCVEEVGRGSWCIVVTEIPYQV  277 (753)
Q Consensus       198 ev~~a~~~~i~~~~~~~~~l~~~i~gPDFPTGG~i~~~~~~i~~~y~tG~G~i~~r~k~~~e~~~~~~~~ivIteiPy~v  277 (753)
                      ||++||+++|++|++++++||++||||||||||.|+.+++++.++|+||||+|++||+|++|+     ++|||||||||+
T Consensus       161 ev~~a~~~~i~~~~~~~~~l~~~i~gPdfptgg~i~~~~~~i~~~y~tG~G~i~~r~~~~~e~-----~~ivItEiPy~~  235 (716)
T 1zvu_A          161 EVAQAAIALIDQPKTTLDQLLDIVQGPDYPTEAEIITSRAEIRKIYENGRGSVRMRAVWKKED-----GAVVISALPHQV  235 (716)
T ss_dssp             HHHHHHHHHHHCTTCCHHHHTTTCCSBCCSSSSEECSCTTHHHHHHHHTEEEEEEECEEEEET-----TEEEEEECCTTC
T ss_pred             HHHHHHHHHHCCCCCCHHHHHHCCCCCCCCCCCEEECCHHHHHHHHHCCCEEEEEEEEEECCC-----CEEEEEECCCCC
T ss_conf             888778998629987889996137789989856697684888876526985999999982448-----749999788545


Q ss_pred             CHHHHHHHHHHHHHHCCCHHHHHHHHCCCCCE-EE-EEEEECCCCCHHHHHHHHHHHCCCCCCCCCCEEEEECCCCCCCC
Q ss_conf             16899999999864022213457764067660-58-89850454588999998754200001223311333126897220
Q gi|254780353|r  278 QKSRLIEKIAELIIAKRIPLLEDIRDESAEDV-RI-VLFPKNRSLDPDLLMESIFMLSDMETRFPLNMNVLSMGRVPQVM  355 (753)
Q Consensus       278 ~k~~~ie~I~~lv~~~ki~gi~dirDeSd~~~-~~-vi~~~~r~~~~~~vl~~Lyk~T~Lq~sf~~N~~~l~~~~~P~~~  355 (753)
                      |+++++|+|++++++||+++|+|+|||||+++ ++ |+++++++++++.+|++|||+|+||+||++||+++..+++|+++
T Consensus       236 ~~~~lie~i~~lv~~kki~~i~d~~DeSd~~~~~~vv~~~~~~~~~~e~vl~~Lyk~T~Lq~s~~~N~~~i~~~g~P~~~  315 (716)
T 1zvu_A          236 SGARVLEQIAAQMRNKKLPMVDDLRDESDHENPTRLVIVPRSNRVDMDQVMNHLFATTDLEKSYRINLNMIGLDGRPAVK  315 (716)
T ss_dssp             CHHHHHHHHHHHHHTTSCTTEEEEEECCCSSSTTCEEEEESSSSCCHHHHHHHHHHHSTTEEEEEEECEEECTTSCEEEC
T ss_pred             CHHHHHHHHHHHHHCCCCCCCCEEECCCCCCCCEEEEECCCCCCCCHHHHHHHHHHHCHHHHHCCCCEEEEEECCCCCCC
T ss_conf             67889999998876489662000111356667579995055568899999999998442344313045788309964505


Q ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCHHHHHHHHHHH
Q ss_conf             49999998999989999999999999999999999999986410789999752000011000000257757788998878
Q gi|254780353|r  356 PLDGILKEWLAHRREVLFRRSSFRMQAIDRRVEILKGLLIAYLNIDEIIAIIRNEDKPKPVMVSRFSLTENQVDAILNLR  435 (753)
Q Consensus       356 ~l~eil~~f~~~R~~vi~rr~~~~L~k~~~RlhIleGl~~a~~~ID~vI~iIR~s~~~k~~L~~~f~lse~QA~aIL~mr  435 (753)
                      +|+++|++|++||.++++||++|+|+++++|+||||||++|+.+||+||++||+|++|+.+||++|+|||.||+|||+||
T Consensus       316 ~l~eiL~~f~~~R~evi~rR~~~~L~k~~~rl~ilegl~~a~~~iD~vI~iIr~s~~~~~~l~~~f~~se~Qa~aIL~mr  395 (716)
T 1zvu_A          316 NLLEILSEWLVFRRDTVRRRLNYRLEKVLKRLHILEGLLVAFLNIDEVIEIIRNEDEPKPALMSRFGLTETQAEAILELK  395 (716)
T ss_dssp             CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTHHHHHHHHHHSSSHHHHHHHSTTCCTTHHHHHHTCC
T ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHCCCCHHHHHHHHHHH
T ss_conf             79999999999999999999999999999999999829999983999999996588558999985599989999999757


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCEEECCCHHHHHHHHCCC
Q ss_conf             99998899997666789999887765442039788789999999999874177433455542000011000000110024
Q gi|254780353|r  436 LRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIREVKEIFSKSTDLGRRRTTFCEVSRADKATLQQAMI  515 (753)
Q Consensus       436 L~rLt~le~~kl~~E~~eL~~~i~~L~~IL~s~~~l~~iI~~EL~eikkkfgd~~~~~~RRT~iie~~~~~~~~~~EdlI  515 (753)
                      |||||+||++|+++|+++|.++|++|++||+|+++++++|++||.+++++||++     |||.+.+. +.......+++|
T Consensus       396 L~~Lt~le~~kl~~E~~~l~~~i~~l~~IL~s~~~l~~~I~~EL~elkkkfgd~-----RRT~i~~~-~~~~~~~~edli  469 (716)
T 1zvu_A          396 LRHLAKLEEMKIRGEQSELEKERDQLQGILASERKMNNLLKKELQADAQAYGDD-----RRSPLQER-EEAKAMSEHDML  469 (716)
T ss_dssp             GGGGSHHHHHHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHHHHHHHHHCCC-----CCSCBCCC-CCCCCCCSSTTS
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHCCC-----CCCCCCCC-CCCCCCCHHHHC
T ss_conf             878778889999999999999999997420488898999998999999971898-----87422145-322457887807


Q ss_pred             CCCCCEEEEECCCEEECCCCCCCCCCCCCCCCCCCCEEEEEECCCCCEEEEECCCEEEEEEHHHCCCCCCCCCCCCCCCC
Q ss_conf             56670599871010202565544553223455555401211114781789806882787551121212344442222357
Q gi|254780353|r  516 EKEPITVVISNRGWIRSLKSHSVDLSALHFKEGDSLKIALHAHTTDRILLLSTDGKAYTLPAGNLLSGRGHGEAIQLLID  595 (753)
Q Consensus       516 ~~E~v~V~LS~~GyIKr~k~~~~~~~~~~~KegD~l~~~~~~~t~d~LLffTs~GkvY~l~a~~Ips~~~kG~pI~~ll~  595 (753)
                      ++|+++|++|++||||+++++++..++.++|++|.+.+++.|+|||+++|||+.|++|++++|+||+++++|+|+.++++
T Consensus       470 ~~e~v~V~ls~~GyIkr~~~~~~~~~~~~~k~~D~~~~~~~~~t~d~ll~fT~~Grvy~l~v~~lP~~~~kG~pi~~~l~  549 (716)
T 1zvu_A          470 PSEPVTIVLSQMGWVRSAKGHDIDAPGLNYKAGDSFKAAVKGKSNQPVVFVDSTGRSYAIDPITLPSARGQGEPLTGKLT  549 (716)
T ss_dssp             CCCCCCEEEETTTEEEECCC---------------CCEEECCCSSSCEEEEETTSEEEEECTTTSCCCC---CBSTTTSC
T ss_pred             CCCCEEEEECCCCEEEECCCCCCCCCCCCCCCCCCCEEEEEEECCCCEEEECCCCCEEEEEEEECCCCCCCCCCCCCCCC
T ss_conf             67650688636876862367765544542323665347899715764068835882799741457677678865434104


Q ss_pred             CCCCCEEEEEEEECCCCEEEEEECCCCEEEEEHHHHHCCCCCCEEEEEECCCCCEEEEEECCC--CEEEEEECCCCEEEE
Q ss_conf             676530789998579985999974897899638874023335627885368980568896189--809999569938995
Q gi|254780353|r  596 LNHNQDIVTAFVYDSTCKLLVVSSKGNAFIVEESEIIANTRKGKTFLKVSSEEKMKLVVKVTG--DHVAVVGENRKLLIF  673 (753)
Q Consensus       596 l~~~EkIv~~~~~~~~~~lll~Tk~G~ikr~~l~~~~~~~k~Gk~~ikLk~~D~li~v~~~~~--d~iiliT~~Gk~LrF  673 (753)
                      ++++|+|++++.++++.+++++|++|++|++.+++|.+++++|+.+++|+++|+++.+..+++  |+++++|++|++|||
T Consensus       550 l~~~E~I~~i~~~~~d~~lll~T~~G~~K~~~l~~~~~~~k~Gk~aikLke~Deli~~~~~~~~~d~vl~vT~~Gk~lrF  629 (716)
T 1zvu_A          550 LPPGATVDHMLMESDDQKLLMASDAGYGFVCTFNDLVARNRAGKALITLPENAHVMPPVVIEDASDMLLAITQAGRMLMF  629 (716)
T ss_dssp             CCTTCCEEEEECCCTTCEEEEEBTTSEEEEEEGGGGCCCSTTCEECBCCCTTCCBCCCEECCCTTCEEEEEETTSEEEEE
T ss_pred             CCCCCEEEEEEECCCCCEEEEEECCCCEEEEEHHHHCCCCCCCCEEEEECCCCEEEEEEEECCCCCEEEEECCCCEEEEE
T ss_conf             79998489987327886799997589589985136105475773778768998899899965999889998889829997


Q ss_pred             EHHHCCCCCHHHCCEEEECCCC-------CEEEEEEEECCCCCEEEEECCCCCCC-CCHHHHCCCCCCCCCCCCCCCCCC
Q ss_conf             5787783361214133421878-------75689997338883699941775664-511432254441366602755267
Q gi|254780353|r  674 SIDQIPEMSRGKGVRLQSYKDG-------GISDVICFKICEGLTWIDSAGRSYNR-SENDLLGWLGKRGGVGSLVPKGFP  745 (753)
Q Consensus       674 ~~~eIr~~gRgkGVk~i~Lkd~-------~~~~~~~~~~~e~~~il~~t~~g~~k-~~~~~~~~~~~RggkG~~~~k~~~  745 (753)
                      ++++||.||||+||++|+|+++       .++.+.++...+ . ++..+++++++ +..+.+++.++||++|++++ .++
T Consensus       630 ~~~ev~~~grg~GVkgikL~~~~~~~~~d~v~~~~v~~~~~-~-llv~t~~g~~k~~~~~~~~~~~~Rg~kG~~~~-~~~  706 (716)
T 1zvu_A          630 PVSDLPQLSKGKGNKIINIPSAEAARGEDGLAQLYVLPPQS-T-LTIHVGKRKIKLRPEELQKVTGERGRRGTLMR-GLQ  706 (716)
T ss_dssp             ESTTSCBCSSBSCEESSCCCHHHHHTTSSCEEEEEEECSSC-C-EEEEETTEEEEECHHHHTTSBCCTTSCCEECT-TCC
T ss_pred             EHHHCCCCCCCCCCCEEECCCCCCCCCCCEEEEEEEECCCC-E-EEEEECCCEEEECHHHHHHHCCCCCCCCCCCC-CCC
T ss_conf             88998865754771207306555556785599999977998-6-99998898078587883020178788887997-776


Q ss_pred             CCCCEE
Q ss_conf             768610
Q gi|254780353|r  746 RSGKFL  751 (753)
Q Consensus       746 K~gklV  751 (753)
                      |.+++-
T Consensus       707 k~D~~e  712 (716)
T 1zvu_A          707 RIDRVE  712 (716)
T ss_dssp             SCCEEE
T ss_pred             CCCCEE
T ss_conf             678378



>2inr_A DNA topoisomerase 4 subunit A; topoisomerase II fold; HET: DNA; 2.80A {Staphylococcus aureus} Back     alignment and structure
>2nov_A DNA topoisomerase 4 subunit A; protein, PARC, TOPO IV, GRAM-positive bacteria, quinolone target, DNA binding, DNA cleavage; HET: DNA; 2.67A {Streptococcus pneumoniae} PDB: 3foe_A* 3fof_A* 3k9f_A* 3ksa_A* 3ksb_A* 3ltn_A* Back     alignment and structure
>3ilw_A DNA gyrase subunit A; DNA topology, topoisomerase, antibiotic resistance, breakage-reunion domain, struct genomics; HET: DNA; 1.60A {Mycobacterium tuberculosis} PDB: 3ifz_A* Back     alignment and structure
>2xcs_B DNA gyrase subunit B, DNA gyrase subunit A; isomerase, type IIA topoisomerase; HET: DNA 5UA RXV; 2.10A {Staphylococcus aureus} PDB: 2xcr_B* 2xcq_A* 2xco_A* Back     alignment and structure
>2xkj_E Topoisomerase IV; type IIA topoisomerase; 2.20A {Acinetobacter baumannii} PDB: 2xkk_A* Back     alignment and structure
>3l4j_A DNA topoisomerase 2; topoisomerase, protein-DNA complex, covalently linked comple supercoiling; HET: DNA PTR TSP; 2.48A {Saccharomyces cerevisiae} PDB: 3l4k_A* 1bjt_A 1bgw_A 2rgr_A* Back     alignment and structure
>1wp5_A Topoisomerase IV; broken beta-propeller, hairpin-invaded beta-propeller, six- bladed beta-propeller; 1.79A {Geobacillus stearothermophilus} SCOP: b.68.10.1 Back     alignment and structure
>3l6v_A GYRA, DNA gyrase subunit A; gyrase A C-terminal domain, GYRA C-terminal domain, DNA wrapping, beta-strand-bearing proline, ATP-binding; HET: DNA; 2.19A {Xanthomonas campestris PV} Back     alignment and structure
>1suu_A DNA gyrase subunit A; topoisomerase,DNA gyrase, beta-propeller, beta-pinwheel; HET: DNA; 1.75A {Borrelia burgdorferi} SCOP: b.68.10.1 Back     alignment and structure
>1zi0_A DNA gyrase subunit A; beta pinwheel, topoisomerase, spiralling beta pinwheel, DNA wrapping, isomerase, DNA bindng protein; HET: DNA; 2.60A {Escherichia coli} Back     alignment and structure
>1zvt_A Topoisomerase IV subunit A; beta-pinwheel, ATPase, supercoiling, decatenation, DNA binding, DNA topology; 1.70A {Escherichia coli} Back     alignment and structure
>3ku8_A GYRA14, DNA gyrase subunit A; alpha+beta, SH3 domain, topoisomerase, toxin-isomerase compl; HET: DNA; 1.93A {Escherichia coli} PDB: 1x75_A* 3kua_A* Back     alignment and structure
>1suu_A DNA gyrase subunit A; topoisomerase,DNA gyrase, beta-propeller, beta-pinwheel; HET: DNA; 1.75A {Borrelia burgdorferi} SCOP: b.68.10.1 Back     alignment and structure
>3l6v_A GYRA, DNA gyrase subunit A; gyrase A C-terminal domain, GYRA C-terminal domain, DNA wrapping, beta-strand-bearing proline, ATP-binding; HET: DNA; 2.19A {Xanthomonas campestris PV} Back     alignment and structure
>1zi0_A DNA gyrase subunit A; beta pinwheel, topoisomerase, spiralling beta pinwheel, DNA wrapping, isomerase, DNA bindng protein; HET: DNA; 2.60A {Escherichia coli} Back     alignment and structure
>1wp5_A Topoisomerase IV; broken beta-propeller, hairpin-invaded beta-propeller, six- bladed beta-propeller; 1.79A {Geobacillus stearothermophilus} SCOP: b.68.10.1 Back     alignment and structure
>1zvu_A Topoisomerase IV subunit A; beta-pinwheel, ATPase, supercoiling, decatenation, DNA binding, DNA topology; 3.00A {Escherichia coli} Back     alignment and structure
>1zvt_A Topoisomerase IV subunit A; beta-pinwheel, ATPase, supercoiling, decatenation, DNA binding, DNA topology; 1.70A {Escherichia coli} Back     alignment and structure
>3l4j_A DNA topoisomerase 2; topoisomerase, protein-DNA complex, covalently linked comple supercoiling; HET: DNA PTR TSP; 2.48A {Saccharomyces cerevisiae} PDB: 3l4k_A* 1bjt_A 1bgw_A 2rgr_A* Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 753 DNA topoisomerase IV subunit A [Candidatus Liberibacter
d1ab4a_493 e.11.1.1 (A:) DNA Gyrase A {Escherichia coli [TaxId: 56 1e-127
d1bjta_760 e.11.1.1 (A:) DNA topoisomerase II, C-terminal fragment 1e-59
d1x75a1132 e.11.1.1 (A:363-494) DNA Gyrase A {Escherichia coli [Ta 1e-14
d1wp5a_323 b.68.10.1 (A:) Topoisomerase IV subunit A, ParC, C-term 2e-13
d1suua_304 b.68.10.1 (A:) DNA gyrase A C-terminal domain {Lyme dis 2e-04
d1suua_304 b.68.10.1 (A:) DNA gyrase A C-terminal domain {Lyme dis 0.001
>d1ab4a_ e.11.1.1 (A:) DNA Gyrase A {Escherichia coli [TaxId: 562]} Length = 493 Back     information, alignment and structure

class: Multi-domain proteins (alpha and beta)
fold: Type II DNA topoisomerase
superfamily: Type II DNA topoisomerase
family: Type II DNA topoisomerase
domain: DNA Gyrase A
species: Escherichia coli [TaxId: 562]
 Score =  450 bits (1158), Expect = e-127
 Identities = 210/496 (42%), Positives = 297/496 (59%), Gaps = 45/496 (9%)

Query: 40  ERAIPDLRDGFKPVHRRIIHAMSEMGLDFGAAFKKSARIVGEVIGKLHPHGDQSVYDSLV 99
            RA+PD+RDG KPVHRR+++AM+ +G D+  A+KKSAR+VG+VIGK HPHGD +VYD++V
Sbjct: 2   GRALPDVRDGLKPVHRRVLYAMNVLGNDWNKAYKKSARVVGDVIGKYHPHGDSAVYDTIV 61

Query: 100 RLAQPFVQRYPLISGQGNFGNIDGDSAAAYRYTEARMTQVAELILQGVDEDAVDFRDTYN 159
           R+AQPF  RY L+ GQGNFG+IDGDSAAA RYTE R+ ++A  ++  ++++ VDF D Y+
Sbjct: 62  RMAQPFSLRYMLVDGQGNFGSIDGDSAAAMRYTEIRLAKIAHELMADLEKETVDFVDNYD 121

Query: 160 EEDSEPVVFPSKFPNLLANGTSGIAVGMATSIPSHNVQEICEAALALIDNPEISIEKLLE 219
             +  P V P+K PNLL NG+SGIAVGMAT+IP HN+ E+    LA ID+ +ISIE L+E
Sbjct: 122 GTEKIPDVMPTKIPNLLVNGSSGIAVGMATNIPPHNLTEVINGCLAYIDDEDISIEGLME 181

Query: 220 YIIGPDFPTGGIIVESRESIVESYRLGRGGFRVRARWCVEEVGR-GSWCIVVTEIPYQVQ 278
           +I GPDFPT  II   R  I E+YR GRG   +RAR  VE   + G   I+V EIPYQV 
Sbjct: 182 HIPGPDFPTAAIIN-GRRGIEEAYRTGRGKVYIRARAEVEVDAKTGRETIIVHEIPYQVN 240

Query: 279 KSRLIEKIAELIIAKRIPLLEDIRDESAEDVRIVLFPKNRSLDPDLLMESIFMLSDMETR 338
           K+RLIEKIAEL+  KR+  +  +RDES +D   ++    R    ++++ +++  + ++  
Sbjct: 241 KARLIEKIAELVKEKRVEGISALRDESDKDGMRIVIEVKRDAVGEVVLNNLYSQTQLQVS 300

Query: 339 FPLNMNVLSMGRVPQVMPLDGILKEWLAHRREVLFRRSSFRMQAIDRRVEILKGLLIAYL 398
           F +NM  L  G+ P++M L  I+  ++ HRREV+ RR+ F ++    R  IL+ L +A  
Sbjct: 301 FGINMVALHHGQ-PKIMNLKDIIAAFVRHRREVVTRRTIFELRKARDRAHILEALAVALA 359

Query: 399 NIDEIIAIIRNEDKPKPVMV-------------------------------------SRF 421
           NID II +IR+   P                                            +
Sbjct: 360 NIDPIIELIRHAPTPAEAKTALVANPWQLGNVAAMLERAGDDAARPEWLEPEFGVRDGLY 419

Query: 422 SLTENQVDAILNLRLRSLRKLEEYQIKSELDNLLAEKEKIDSLLNSGKQQWNQIACEIRE 481
            LTE Q  AIL+LRL+ L  LE  ++  E   LL +  ++  +L S  +    I  E+  
Sbjct: 420 YLTEQQAQAILDLRLQKLTGLEHEKLLDEYKELLDQIAELLRILGSADRLMEVIREELEL 479

Query: 482 VKEIFSKSTDLGRRRT 497
           V+E F       +RRT
Sbjct: 480 VREQFGD-----KRRT 490


>d1bjta_ e.11.1.1 (A:) DNA topoisomerase II, C-terminal fragment (residues 410-1202) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 760 Back     information, alignment and structure
>d1x75a1 e.11.1.1 (A:363-494) DNA Gyrase A {Escherichia coli [TaxId: 562]} Length = 132 Back     information, alignment and structure
>d1wp5a_ b.68.10.1 (A:) Topoisomerase IV subunit A, ParC, C-terminal domain {Bacillus stearothermophilus [TaxId: 1422]} Length = 323